BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007C09 602 bp,:Filtered

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003596211.1|  Ubiquitin carboxyl-terminal hydrolase              154   1e-39   
ref|XP_007022154.1|  Ubiquitin-specific protease 15, putative iso...    152   6e-39   Theobroma cacao [chocolate]
ref|XP_007022155.1|  Ubiquitin-specific protease 15, putative iso...    152   9e-39   Theobroma cacao [chocolate]
ref|XP_007022153.1|  Ubiquitin-specific protease 15, putative iso...    152   9e-39   Theobroma cacao [chocolate]
ref|XP_007149328.1|  hypothetical protein PHAVU_005G061400g             151   2e-38   Phaseolus vulgaris [French bean]
emb|CDP06086.1|  unnamed protein product                                150   4e-38   Coffea canephora [robusta coffee]
ref|XP_011077821.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    150   5e-38   Sesamum indicum [beniseed]
gb|AES66462.2|  ubiquitin carboxy-terminal hydrolase                    149   6e-38   Medicago truncatula
ref|XP_010092717.1|  Ubiquitin carboxyl-terminal hydrolase 15           149   1e-37   Morus notabilis
gb|KHN47474.1|  Ubiquitin carboxyl-terminal hydrolase 15                149   1e-37   Glycine soja [wild soybean]
ref|XP_006594689.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-37   Glycine max [soybeans]
ref|XP_003541793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-37   Glycine max [soybeans]
ref|XP_006598163.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-37   Glycine max [soybeans]
ref|XP_006598161.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-37   Glycine max [soybeans]
gb|KHN29845.1|  Ubiquitin carboxyl-terminal hydrolase 15                148   2e-37   Glycine soja [wild soybean]
gb|KHG25224.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    148   2e-37   Gossypium arboreum [tree cotton]
gb|EYU28912.1|  hypothetical protein MIMGU_mgv1a001776mg                146   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_010324419.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   3e-37   Solanum lycopersicum
ref|XP_009609977.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   4e-37   Nicotiana tomentosiformis
ref|XP_006348364.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   4e-37   
ref|XP_004244319.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   4e-37   Solanum lycopersicum
gb|KJB12847.1|  hypothetical protein B456_002G039300                    147   4e-37   Gossypium raimondii
gb|KJB12846.1|  hypothetical protein B456_002G039300                    147   4e-37   Gossypium raimondii
gb|KJB45884.1|  hypothetical protein B456_007G335200                    146   8e-37   Gossypium raimondii
gb|KJB45883.1|  hypothetical protein B456_007G335200                    146   8e-37   Gossypium raimondii
gb|KHF97895.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    146   8e-37   Gossypium arboreum [tree cotton]
ref|XP_010694568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-36   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009776208.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-36   Nicotiana sylvestris
ref|XP_010539169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_011465545.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-36   Fragaria vesca subsp. vesca
ref|XP_011465544.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-36   Fragaria vesca subsp. vesca
ref|XP_011465542.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-36   Fragaria vesca subsp. vesca
ref|XP_011044935.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-36   Populus euphratica
ref|XP_011044933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-36   Populus euphratica
ref|XP_011044931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-36   Populus euphratica
ref|XP_002317364.2|  UBIQUITIN-SPECIFIC PROTEASE 15 family protein      144   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011044934.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   3e-36   Populus euphratica
ref|XP_010644793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-36   Vitis vinifera
emb|CAN68406.1|  hypothetical protein VITISV_035043                     144   5e-36   Vitis vinifera
ref|XP_010540128.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_004488653.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   7e-36   Cicer arietinum [garbanzo]
emb|CDX96790.1|  BnaA08g23330D                                          143   7e-36   Brassica napus [oilseed rape]
ref|XP_010459276.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010498051.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010459274.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Camelina sativa [gold-of-pleasure]
emb|CDY48465.1|  BnaC05g13250D                                          143   8e-36   Brassica napus [oilseed rape]
ref|XP_009149147.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Brassica rapa
emb|CDY65125.1|  BnaA06g38410D                                          143   8e-36   Brassica napus [oilseed rape]
ref|XP_010476845.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Camelina sativa [gold-of-pleasure]
emb|CBI33027.3|  unnamed protein product                                143   8e-36   Vitis vinifera
ref|XP_006306123.1|  hypothetical protein CARUB_v10011568mg             143   8e-36   Capsella rubella
ref|XP_009110426.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-36   Brassica rapa
ref|XP_006416743.1|  hypothetical protein EUTSA_v10006749mg             143   8e-36   Eutrema salsugineum
ref|XP_006477933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-36   Citrus sinensis [Valencia orange]
ref|XP_006477929.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   Citrus sinensis [Valencia orange]
ref|XP_006442255.1|  hypothetical protein CICLE_v10018666mg             143   1e-35   Citrus clementina
ref|XP_010476847.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   Camelina sativa [gold-of-pleasure]
emb|CDX83925.1|  BnaC08g17200D                                          143   1e-35   Brassica napus [oilseed rape]
ref|XP_011045595.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-35   Populus euphratica
ref|XP_008781931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-35   Phoenix dactylifera
ref|XP_008782751.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-35   Phoenix dactylifera
gb|AAD50020.1|AC007651_15  Unknown protein                              142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045594.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-35   Populus euphratica
gb|AAG42756.1|AF302665_1  ubiquitin-specific protease 15                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564014.1|  ubiquitin carboxyl-terminal hydrolase 15              142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45638.1|  hypothetical protein CISIN_1g0014791mg                  141   3e-35   Citrus sinensis [Valencia orange]
ref|XP_002892935.1|  ubiquitin-specific protease 15                     142   3e-35   Arabidopsis lyrata subsp. lyrata
ref|NP_001185019.1|  ubiquitin carboxyl-terminal hydrolase 15           142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFW65941.1|  putative ubiquitin carboxyl-terminal hydrolase su...    130   3e-35   Zea mays [maize]
ref|XP_008782673.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-35   
ref|XP_010279646.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   4e-35   Nelumbo nucifera [Indian lotus]
gb|KDO45637.1|  hypothetical protein CISIN_1g0014791mg                  140   5e-35   Citrus sinensis [Valencia orange]
ref|XP_002530131.1|  conserved hypothetical protein                     141   5e-35   
ref|XP_006477932.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   6e-35   Citrus sinensis [Valencia orange]
ref|XP_002298917.2|  hypothetical protein POPTR_0001s38800g             139   8e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010062748.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   9e-35   Eucalyptus grandis [rose gum]
ref|XP_010062747.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Eucalyptus grandis [rose gum]
ref|XP_008226235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Prunus mume [ume]
ref|XP_010062746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Eucalyptus grandis [rose gum]
ref|XP_008226232.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Prunus mume [ume]
ref|XP_010062745.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010062743.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Eucalyptus grandis [rose gum]
ref|XP_007211338.1|  hypothetical protein PRUPE_ppa000901mg             140   1e-34   Prunus persica
ref|XP_010915558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Elaeis guineensis
ref|XP_008382966.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Malus domestica [apple tree]
ref|XP_008783949.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Phoenix dactylifera
ref|XP_009354862.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009367759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009354860.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_008382965.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Malus domestica [apple tree]
ref|XP_009354861.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_009354859.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_008356196.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   
ref|XP_008356195.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Malus domestica [apple tree]
ref|XP_008356197.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   
ref|XP_009367758.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_009354863.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_010925671.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    139   4e-34   Elaeis guineensis
ref|XP_010274759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009390669.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    137   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006840775.1|  hypothetical protein AMTR_s00096p00170210          135   4e-33   
ref|XP_010234088.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    134   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_003571975.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    134   1e-32   Brachypodium distachyon [annual false brome]
gb|AFW71122.1|  putative ubiquitin carboxyl-terminal hydrolase su...    134   1e-32   Zea mays [maize]
gb|AFW71123.1|  putative ubiquitin carboxyl-terminal hydrolase su...    134   2e-32   Zea mays [maize]
ref|XP_008645575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    133   4e-32   Zea mays [maize]
ref|XP_002453597.1|  hypothetical protein SORBIDRAFT_04g008750          133   4e-32   Sorghum bicolor [broomcorn]
gb|EEE56641.1|  hypothetical protein OsJ_06049                          132   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008679796.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    132   5e-32   Zea mays [maize]
gb|AFW65940.1|  putative ubiquitin carboxyl-terminal hydrolase su...    129   6e-32   Zea mays [maize]
gb|EEC72815.1|  hypothetical protein OsI_06524                          132   8e-32   Oryza sativa Indica Group [Indian rice]
dbj|BAJ87234.1|  predicted protein                                      132   9e-32   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006647115.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    132   9e-32   Oryza brachyantha
ref|NP_001046415.1|  Os02g0244300                                       132   1e-31   
dbj|BAD28270.1|  putative ubiquitin-specific protease                   131   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMS59305.1|  Ubiquitin carboxyl-terminal hydrolase 15                131   1e-31   Triticum urartu
ref|XP_004951331.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    131   2e-31   
gb|EMT09965.1|  Ubiquitin carboxyl-terminal hydrolase 15                129   4e-31   Aegilops tauschii
ref|XP_006841208.1|  hypothetical protein AMTR_s00135p00021060          116   4e-26   Amborella trichopoda
ref|XP_003613074.1|  Ubiquitin carboxyl-terminal hydrolase              115   8e-26   
ref|XP_007158378.1|  hypothetical protein PHAVU_002G148100g             114   2e-25   Phaseolus vulgaris [French bean]
emb|CBI19252.3|  unnamed protein product                                113   3e-25   Vitis vinifera
ref|XP_010916668.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    112   4e-25   Elaeis guineensis
ref|XP_010664385.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    113   5e-25   Vitis vinifera
ref|XP_010664383.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    113   5e-25   Vitis vinifera
gb|KHN14516.1|  Ubiquitin carboxyl-terminal hydrolase 17                112   5e-25   Glycine soja [wild soybean]
gb|KJB64168.1|  hypothetical protein B456_010G035400                    112   6e-25   Gossypium raimondii
gb|AES96032.2|  ubiquitin carboxy-terminal hydrolase                    112   8e-25   Medicago truncatula
ref|XP_002514028.1|  conserved hypothetical protein                     112   9e-25   
ref|XP_001772702.1|  predicted protein                                  108   1e-24   Physcomitrella patens
ref|XP_010277575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008795170.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   1e-24   Phoenix dactylifera
ref|XP_008795169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   1e-24   Phoenix dactylifera
ref|XP_008802270.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   2e-24   Phoenix dactylifera
ref|XP_010916667.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   2e-24   Elaeis guineensis
ref|XP_004489806.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   2e-24   
ref|XP_010939750.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    111   2e-24   Elaeis guineensis
ref|XP_009387155.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002970813.1|  hypothetical protein SELMODRAFT_171601             108   2e-24   Selaginella moellendorffii
ref|XP_011013097.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   2e-24   Populus euphratica
ref|XP_011013096.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   2e-24   Populus euphratica
ref|XP_011016915.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   2e-24   Populus euphratica
ref|XP_011016914.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   2e-24   Populus euphratica
ref|XP_002301091.2|  UBIQUITIN-SPECIFIC PROTEASE 16 family protein      110   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_002307344.2|  hypothetical protein POPTR_0005s17820g             110   3e-24   Populus trichocarpa [western balsam poplar]
gb|KHG13290.1|  Ubiquitin carboxyl-terminal hydrolase 16 -like pr...    110   3e-24   Gossypium arboreum [tree cotton]
ref|XP_001774704.1|  predicted protein                                  107   4e-24   Physcomitrella patens
gb|KDP41469.1|  hypothetical protein JCGZ_15876                         110   5e-24   Jatropha curcas
ref|XP_008795168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    109   6e-24   Phoenix dactylifera
ref|XP_008795167.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    109   6e-24   Phoenix dactylifera
ref|XP_009761470.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    109   7e-24   Nicotiana sylvestris
emb|CDP11495.1|  unnamed protein product                                109   7e-24   Coffea canephora [robusta coffee]
ref|XP_004301361.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    109   7e-24   Fragaria vesca subsp. vesca
ref|XP_010646974.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   8e-24   Vitis vinifera
ref|XP_002969545.1|  hypothetical protein SELMODRAFT_91996              106   9e-24   Selaginella moellendorffii
ref|XP_007018207.1|  Ubiquitin-specific protease 16, putative iso...    109   9e-24   Theobroma cacao [chocolate]
ref|XP_007018208.1|  Ubiquitin-specific protease 16, putative iso...    109   9e-24   Theobroma cacao [chocolate]
ref|XP_007137649.1|  hypothetical protein PHAVU_009G144200g             108   1e-23   Phaseolus vulgaris [French bean]
ref|XP_010942663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   1e-23   Elaeis guineensis
gb|KDO81148.1|  hypothetical protein CISIN_1g0011341mg                  105   2e-23   Citrus sinensis [Valencia orange]
ref|XP_006472486.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Citrus sinensis [Valencia orange]
ref|XP_008219286.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Prunus mume [ume]
ref|XP_007225419.1|  hypothetical protein PRUPE_ppa000527mg             108   2e-23   Prunus persica
ref|XP_003635052.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Vitis vinifera
gb|KJB64167.1|  hypothetical protein B456_010G035400                    108   2e-23   Gossypium raimondii
gb|KJB64166.1|  hypothetical protein B456_010G035400                    108   2e-23   Gossypium raimondii
gb|KJB29358.1|  hypothetical protein B456_005G096600                    107   2e-23   Gossypium raimondii
ref|XP_004237986.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Solanum lycopersicum
ref|XP_006338134.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_006433843.1|  hypothetical protein CICLE_v10000079mg             107   3e-23   Citrus clementina
gb|KJB29359.1|  hypothetical protein B456_005G096600                    107   3e-23   Gossypium raimondii
ref|XP_003519843.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   3e-23   Glycine max [soybeans]
ref|XP_004501631.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   4e-23   Cicer arietinum [garbanzo]
ref|XP_010525922.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_009609184.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   5e-23   Nicotiana tomentosiformis
emb|CBI18698.3|  unnamed protein product                                106   5e-23   Vitis vinifera
ref|XP_007047805.1|  Ubiquitin-specific protease 17, putative iso...    106   6e-23   Theobroma cacao [chocolate]
ref|XP_010928622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   6e-23   Elaeis guineensis
emb|CAN77546.1|  hypothetical protein VITISV_025214                     106   7e-23   Vitis vinifera
ref|XP_008789702.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   7e-23   Phoenix dactylifera
ref|XP_008378636.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   1e-22   
ref|XP_002980323.1|  hypothetical protein SELMODRAFT_420048             105   1e-22   Selaginella moellendorffii
gb|EMT11184.1|  Ubiquitin carboxyl-terminal hydrolase 16                105   1e-22   Aegilops tauschii
ref|XP_003523774.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Glycine max [soybeans]
ref|XP_006578260.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Glycine max [soybeans]
ref|XP_004973705.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   
gb|KHN08238.1|  Ubiquitin carboxyl-terminal hydrolase 16                105   1e-22   Glycine soja [wild soybean]
ref|XP_006578259.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Glycine max [soybeans]
ref|XP_004973704.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Setaria italica
emb|CBI35523.3|  unnamed protein product                                104   2e-22   Vitis vinifera
ref|XP_011100001.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Sesamum indicum [beniseed]
ref|XP_003602929.1|  Ubiquitin carboxyl-terminal hydrolase              105   2e-22   Medicago truncatula
gb|KEH35732.1|  ubiquitin carboxy-terminal hydrolase                    105   2e-22   Medicago truncatula
ref|XP_009376247.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_010266094.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Nelumbo nucifera [Indian lotus]
gb|EPS72742.1|  hypothetical protein M569_02015                         102   3e-22   Genlisea aurea
ref|XP_007223115.1|  hypothetical protein PRUPE_ppa005433mg             102   3e-22   Prunus persica
gb|EYU30946.1|  hypothetical protein MIMGU_mgv1a004116mg                103   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_009396938.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    104   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    104   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565576.1|  ubiquitin carboxyl-terminal hydrolase 19              103   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044972.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   5e-22   Populus euphratica
gb|KGN60255.1|  hypothetical protein Csa_3G890110                       103   5e-22   Cucumis sativus [cucumbers]
ref|XP_008466167.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    103   5e-22   
ref|XP_006355189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   5e-22   Solanum tuberosum [potatoes]
ref|XP_003518257.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   5e-22   Glycine max [soybeans]
ref|XP_003544242.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   5e-22   Glycine max [soybeans]
ref|XP_008377533.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   5e-22   
ref|XP_010548553.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   6e-22   Tarenaya hassleriana [spider flower]
ref|XP_009410122.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220608.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   6e-22   Prunus mume [ume]
ref|XP_002308728.2|  hypothetical protein POPTR_0006s28540g             103   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002324377.2|  hypothetical protein POPTR_0018s03350g             103   6e-22   Populus trichocarpa [western balsam poplar]
gb|ACF84178.1|  unknown                                                 100   6e-22   Zea mays [maize]
gb|KDP33469.1|  hypothetical protein JCGZ_07040                         103   7e-22   Jatropha curcas
ref|XP_003527871.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   7e-22   
ref|XP_004498826.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   8e-22   Cicer arietinum [garbanzo]
ref|XP_007011632.1|  Ubiquitin carboxyl-terminal hydrolase 19, pu...    102   9e-22   Theobroma cacao [chocolate]
ref|XP_003615274.1|  Ubiquitin carboxyl-terminal hydrolase              103   1e-21   
gb|KHN26130.1|  Ubiquitin carboxyl-terminal hydrolase 16                103   1e-21   Glycine soja [wild soybean]
ref|XP_009373969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009363067.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Pyrus x bretschneideri [bai li]
tpg|DAA48490.1|  TPA: putative ubiquitin carboxyl-terminal hydrol...    103   1e-21   Zea mays [maize]
ref|NP_001189593.1|  ubiquitin carboxyl-terminal hydrolase 19           101   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008352731.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    1e-21   Malus domestica [apple tree]
ref|XP_008664540.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    103   1e-21   Zea mays [maize]
ref|XP_008452810.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Cucumis melo [Oriental melon]
ref|XP_010060095.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Eucalyptus grandis [rose gum]
ref|XP_008359211.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Malus domestica [apple tree]
ref|XP_008385675.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Malus domestica [apple tree]
gb|KEH39885.1|  ubiquitin carboxy-terminal hydrolase                    102   2e-21   Medicago truncatula
ref|XP_006483493.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Citrus sinensis [Valencia orange]
gb|KHG26104.1|  Ubiquitin carboxyl-terminal hydrolase 17                102   2e-21   Gossypium arboreum [tree cotton]
gb|AES98232.2|  ubiquitin carboxy-terminal hydrolase                    102   2e-21   Medicago truncatula
gb|KHG26103.1|  Ubiquitin carboxyl-terminal hydrolase 17                102   2e-21   Gossypium arboreum [tree cotton]
gb|KDO60602.1|  hypothetical protein CISIN_1g039539mg                   100   2e-21   Citrus sinensis [Valencia orange]
gb|KDO67336.1|  hypothetical protein CISIN_1g004724mg                   102   2e-21   Citrus sinensis [Valencia orange]
gb|ACF83022.1|  unknown                                                 100   2e-21   Zea mays [maize]
ref|XP_004245303.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Solanum lycopersicum
ref|XP_011074220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Sesamum indicum [beniseed]
ref|NP_001063411.2|  Os09g0464400                                       102   2e-21   
gb|EEC84719.1|  hypothetical protein OsI_31685                          102   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_003523663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   2e-21   Glycine max [soybeans]
dbj|BAD33960.1|  putative ubiquitin-specific protease                   102   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006466293.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Citrus sinensis [Valencia orange]
gb|KJB18261.1|  hypothetical protein B456_003G043300                    101   2e-21   Gossypium raimondii
ref|XP_003545417.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   2e-21   Glycine max [soybeans]
ref|XP_011031394.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   2e-21   Populus euphratica
ref|XP_010675222.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006483492.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   2e-21   Citrus sinensis [Valencia orange]
ref|XP_006426286.1|  hypothetical protein CICLE_v10024864mg             102   2e-21   Citrus clementina
gb|KHN29656.1|  Ubiquitin carboxyl-terminal hydrolase 19                101   2e-21   Glycine soja [wild soybean]
ref|XP_006450208.1|  hypothetical protein CICLE_v10007658mg             101   2e-21   Citrus clementina
ref|XP_008678623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   3e-21   Zea mays [maize]
ref|XP_008678622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   3e-21   Zea mays [maize]
ref|XP_008338940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   3e-21   Malus domestica [apple tree]
ref|XP_002445647.1|  hypothetical protein SORBIDRAFT_07g023330          102   3e-21   Sorghum bicolor [broomcorn]
gb|KHN19658.1|  Ubiquitin carboxyl-terminal hydrolase 19                101   3e-21   Glycine soja [wild soybean]
ref|XP_003527768.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   3e-21   Glycine max [soybeans]
ref|XP_006293755.1|  hypothetical protein CARUB_v10022714mg             101   3e-21   Capsella rubella
gb|KJB18262.1|  hypothetical protein B456_003G043300                    101   3e-21   Gossypium raimondii
gb|KHN37220.1|  Ubiquitin carboxyl-terminal hydrolase 19                101   3e-21   Glycine soja [wild soybean]
ref|XP_009381476.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU22051.1|  hypothetical protein MIMGU_mgv1a001964mg                101   3e-21   Erythranthe guttata [common monkey flower]
gb|KJB18260.1|  hypothetical protein B456_003G043300                    101   3e-21   Gossypium raimondii
ref|XP_006466294.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   3e-21   Citrus sinensis [Valencia orange]
gb|EYU39312.1|  hypothetical protein MIMGU_mgv1a001469mg                101   3e-21   Erythranthe guttata [common monkey flower]
ref|XP_006660217.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   3e-21   
ref|XP_007208087.1|  hypothetical protein PRUPE_ppa001429mg             101   4e-21   Prunus persica
ref|XP_004141442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   4e-21   Cucumis sativus [cucumbers]
ref|XP_010049833.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   4e-21   Eucalyptus grandis [rose gum]
ref|XP_004157412.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   4e-21   
ref|XP_003550229.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   4e-21   Glycine max [soybeans]
ref|XP_003574640.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   4e-21   
gb|EMT33844.1|  Ubiquitin carboxyl-terminal hydrolase 17                101   5e-21   Aegilops tauschii
ref|XP_007136918.1|  hypothetical protein PHAVU_009G084800g             100   5e-21   Phaseolus vulgaris [French bean]
ref|XP_010429445.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    100   5e-21   Camelina sativa [gold-of-pleasure]
gb|EMS47345.1|  Ubiquitin carboxyl-terminal hydrolase 17                101   5e-21   Triticum urartu
ref|XP_006845518.1|  hypothetical protein AMTR_s00019p00164720          100   5e-21   Amborella trichopoda
ref|XP_008393558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   6e-21   
ref|XP_009359053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   6e-21   
ref|XP_008235462.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   6e-21   
ref|XP_010417220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   6e-21   
dbj|BAD44466.1|  unknown protein                                        100   7e-21   
ref|NP_194895.1|  ubiquitin carboxyl-terminal hydrolase 18              100   7e-21   
ref|XP_002271840.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   8e-21   
ref|XP_009359054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.8    9e-21   
emb|CBI23999.3|  unnamed protein product                                100   1e-20   
emb|CDX75188.1|  BnaA01g05140D                                        99.4    1e-20   
ref|XP_002880603.1|  ubiquitin carboxyl-terminal hydrolase family...  99.4    1e-20   
gb|KHG15081.1|  Ubiquitin carboxyl-terminal hydrolase 19 -like pr...  99.0    1e-20   
ref|XP_010107689.1|  Ubiquitin carboxyl-terminal hydrolase 16           100   1e-20   
ref|XP_009126746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    1e-20   
ref|XP_009408046.1|  PREDICTED: uncharacterized protein LOC103990...  99.8    2e-20   
ref|XP_010523321.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   
ref|XP_009117107.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   
ref|XP_010472472.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   
ref|XP_006601204.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   
ref|XP_010432836.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   
ref|XP_006412571.1|  hypothetical protein EUTSA_v10024675mg           98.6    2e-20   
ref|XP_006283326.1|  hypothetical protein CARUB_v10004366mg           98.6    2e-20   
ref|XP_010432837.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.6    2e-20   
ref|XP_010447529.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.6    2e-20   
ref|XP_011070235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   
gb|KJB07712.1|  hypothetical protein B456_001G040200                  98.6    2e-20   
ref|XP_010259741.1|  PREDICTED: uncharacterized protein LOC104599075  99.8    2e-20   
gb|EPS64787.1|  hypothetical protein M569_09988                       96.3    2e-20   
emb|CDX68773.1|  BnaC01g06800D                                        98.6    2e-20   
ref|XP_004965693.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   
ref|XP_010061517.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   
ref|XP_006405001.1|  hypothetical protein EUTSA_v10000088mg           98.6    3e-20   
gb|KJB65934.1|  hypothetical protein B456_010G120800                  98.6    3e-20   
ref|XP_011082032.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    3e-20   
emb|CDY34761.1|  BnaA09g41280D                                        98.6    3e-20   
ref|XP_004291227.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.6    3e-20   
ref|XP_007141259.1|  hypothetical protein PHAVU_008G181000g           99.0    3e-20   
emb|CDX76801.1|  BnaC08g33870D                                        98.2    3e-20   
ref|XP_010438014.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.2    3e-20   
gb|KFK32657.1|  hypothetical protein AALP_AA6G271600                  98.2    3e-20   
gb|EEE68872.1|  hypothetical protein OsJ_27681                        98.6    3e-20   
ref|XP_002867287.1|  ubiquitin carboxyl-terminal hydrolase family...  97.8    4e-20   
ref|NP_001062051.1|  Os08g0478500                                     98.6    4e-20   
ref|XP_009772698.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.2    4e-20   
gb|KCW68483.1|  hypothetical protein EUGRSUZ_F02136                   98.2    5e-20   
ref|XP_007161112.1|  hypothetical protein PHAVU_001G043700g           97.8    5e-20   
dbj|BAD43230.1|  unknown protein                                      97.8    5e-20   
ref|XP_011097488.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    7e-20   
ref|XP_009340982.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    7e-20   
ref|XP_008444940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    8e-20   
ref|XP_004148434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    9e-20   
ref|XP_008444939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    9e-20   
ref|XP_004163959.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  97.8    9e-20   
gb|KFK29759.1|  hypothetical protein AALP_AA7G175300                  96.7    1e-19   
ref|XP_002515370.1|  cysteine-type endopeptidase, putative            96.7    1e-19   
ref|XP_010098405.1|  Ubiquitin carboxyl-terminal hydrolase 19         96.7    1e-19   
ref|XP_010049834.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    2e-19   
ref|XP_004957062.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    2e-19   
ref|XP_004957061.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.9    3e-19   
ref|XP_008649027.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.9    3e-19   
ref|XP_010520756.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.9    3e-19   
ref|XP_010693053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.9    4e-19   
gb|EYU36471.1|  hypothetical protein MIMGU_mgv1a000653mg              95.5    5e-19   
ref|XP_010239389.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.1    5e-19   
emb|CDY20330.1|  BnaC04g36260D                                        94.7    5e-19   
ref|NP_001058243.1|  Os06g0654000                                     95.1    5e-19   
ref|XP_009140568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    5e-19   
ref|XP_009607564.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.1    5e-19   
ref|XP_006657202.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  95.1    6e-19   
gb|EAZ01926.1|  hypothetical protein OsI_23952                        95.1    7e-19   
ref|XP_004490438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    7e-19   
ref|XP_011468537.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    8e-19   
gb|EAZ37856.1|  hypothetical protein OsJ_22202                        94.7    8e-19   
ref|XP_002530694.1|  cysteine-type endopeptidase, putative            94.4    8e-19   
dbj|BAD37420.1|  putative ubiquitin-specific protease 15              94.4    1e-18   
emb|CDX92643.1|  BnaC07g39010D                                        94.0    1e-18   
ref|XP_002438776.1|  hypothetical protein SORBIDRAFT_10g026010        94.0    1e-18   
dbj|BAJ97014.1|  predicted protein                                    94.0    1e-18   
ref|XP_006394032.1|  hypothetical protein EUTSA_v10003706mg           93.2    2e-18   
ref|XP_008653981.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  93.6    2e-18   
emb|CDY11021.1|  BnaA03g46800D                                        93.6    2e-18   
ref|XP_009137457.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  93.6    2e-18   
ref|XP_010525656.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  92.8    4e-18   
gb|KDP29752.1|  hypothetical protein JCGZ_18687                       92.4    4e-18   
gb|EMT03019.1|  Ubiquitin carboxyl-terminal hydrolase 19              92.4    5e-18   
gb|EMS56666.1|  Ubiquitin carboxyl-terminal hydrolase 19              92.4    5e-18   
ref|XP_006282127.1|  hypothetical protein CARUB_v10028379mg           91.3    9e-18   
ref|XP_010681055.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  91.3    1e-17   
ref|XP_002864957.1|  hypothetical protein ARALYDRAFT_332761           90.9    1e-17   
emb|CDY45587.1|  BnaA04g14540D                                        90.5    1e-17   
gb|EPS59868.1|  hypothetical protein M569_14935                       88.6    2e-17   
ref|XP_010444522.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.5    2e-17   
ref|XP_010484359.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.5    2e-17   
ref|XP_002462507.1|  hypothetical protein SORBIDRAFT_02g026980        90.9    2e-17   
ref|XP_003560376.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.9    2e-17   
gb|KFK28246.1|  hypothetical protein AALP_AA8G491300                  90.5    2e-17   
emb|CDY03441.1|  BnaC01g16410D                                        90.1    3e-17   
ref|XP_009138224.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.1    3e-17   
emb|CDY34291.1|  BnaA01g13940D                                        90.1    3e-17   
gb|KFK28990.1|  hypothetical protein AALP_AA7G074400                  90.1    3e-17   
ref|XP_010444523.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  89.7    3e-17   
ref|XP_010484360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  89.7    3e-17   
ref|XP_010240068.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  89.7    4e-17   
ref|NP_201348.1|  ubiquitin-specific protease 17                      88.2    1e-16   
ref|XP_006413414.1|  hypothetical protein EUTSA_v10024307mg           88.2    1e-16   
gb|EPS68694.1|  hypothetical protein M569_06073                       88.2    1e-16   
emb|CDY08792.1|  BnaA06g24320D                                        87.8    1e-16   
emb|CDY14564.1|  BnaC03g48950D                                        87.8    2e-16   
ref|XP_009150635.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.8    2e-16   
gb|AAG42757.1|AF302666_1  ubiquitin-specific protease 16              87.8    2e-16   
ref|NP_567705.1|  ubiquitin carboxyl-terminal hydrolase 16            87.8    2e-16   
ref|XP_002867659.1|  ubiquitin-specific protease 16                   87.4    3e-16   
ref|XP_010463054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.0    3e-16   
ref|XP_010448548.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.0    4e-16   
ref|XP_010439011.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.0    4e-16   
ref|XP_010433753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  86.3    5e-16   
ref|XP_001771280.1|  predicted protein                                83.2    7e-16   
ref|XP_001758249.1|  predicted protein                                79.7    3e-14   
gb|EAZ07363.1|  hypothetical protein OsI_29613                        80.9    4e-14   
ref|XP_006342461.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  78.2    2e-13   
ref|XP_010314797.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  77.8    3e-13   
ref|XP_002509019.1|  predicted protein                                71.6    2e-11   
ref|XP_002872343.1|  hypothetical protein ARALYDRAFT_911001           69.3    2e-11   
emb|CAG04439.1|  unnamed protein product                              68.6    7e-11   
ref|XP_006418757.1|  hypothetical protein EUTSA_v10002775mg           69.7    1e-10   
ref|NP_001243823.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  68.6    3e-10   
ref|XP_004046713.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.8    3e-10   
ref|NP_001243789.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  68.2    3e-10   
ref|NP_001243788.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  68.2    3e-10   
ref|NP_001243783.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  68.2    4e-10   
ref|XP_003310296.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  66.2    4e-10   
ref|XP_009234205.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  66.6    4e-10   
ref|XP_008301807.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  68.2    5e-10   
ref|XP_004046711.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.8    5e-10   
gb|EAW92671.1|  hCG1807742                                            66.6    6e-10   
ref|XP_006710304.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  66.2    6e-10   
ref|XP_009094882.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.8    6e-10   
ref|XP_003061744.1|  predicted protein                                67.0    7e-10   
ref|XP_005372438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.0    8e-10   
ref|XP_008070649.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.0    9e-10   
ref|XP_007606438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    9e-10   
ref|XP_003973109.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.4    1e-09   
ref|XP_006726474.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  65.9    1e-09   
ref|XP_010733623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  67.4    1e-09   
emb|CBN80949.1|  Ubiquitin carboxyl-terminal hydrolase 48             67.4    1e-09   
sp|Q6QN14.2|U17L6_HUMAN  RecName: Full=Ubiquitin carboxyl-termina...  66.2    1e-09   
gb|AAS59847.1|  deubiquitinating enzyme DUB4                          66.2    1e-09   
ref|XP_001175011.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.9    1e-09   
ref|NP_958804.2|  ubiquitin carboxyl-terminal hydrolase 17            66.6    1e-09   
ref|XP_005562623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  66.2    2e-09   
ref|XP_005562625.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  66.2    2e-09   
gb|AAQ11741.1|  deubiquitinating enzyme DUB1                          66.2    2e-09   
emb|CAF94665.1|  unnamed protein product                              67.0    2e-09   
ref|NP_001243784.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  66.2    2e-09   
ref|NP_001243792.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  66.2    2e-09   
ref|NP_001243786.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  66.2    2e-09   
ref|XP_010879236.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  66.2    2e-09   
gb|AAQ11742.1|  deubiquitinating enzyme DUB2                          65.9    2e-09   
ref|XP_004046661.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.9    2e-09   
ref|NP_001243782.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|XP_006991849.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.9    2e-09   
ref|NP_001229255.1|  ubiquitin specific peptidase 17-like family ...  65.9    2e-09   
ref|NP_001229258.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|NP_001243790.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
gb|KFO52666.1|  Ubiquitin carboxyl-terminal hydrolase 42              65.1    2e-09   
gb|AAO38845.1|  deubiquitinating enzyme 3                             65.9    2e-09   
ref|NP_001243791.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|XP_004046718.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    2e-09   
ref|XP_010879235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  66.2    2e-09   
ref|XP_006991847.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.9    2e-09   
ref|XP_009238035.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  65.9    2e-09   
ref|NP_001243781.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|XP_005508434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.9    3e-09   
ref|XP_002187377.2|  PREDICTED: uncharacterized protein LOC100225609  65.9    3e-09   
ref|XP_009438375.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    3e-09   
ref|XP_003271501.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    3e-09   
ref|XP_003271421.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    3e-09   
ref|XP_008971387.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  63.9    3e-09   
sp|C9J2P7.1|U17LF_HUMAN  RecName: Full=Ubiquitin carboxyl-termina...  65.5    3e-09   
ref|XP_004046717.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.1    3e-09   
ref|XP_003462100.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.1    3e-09   
gb|AAR91701.1|  deubiquitinating enzyme 3                             65.1    3e-09   
ref|NP_001243800.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.1    4e-09   
gb|EGW13659.1|  Ubiquitin carboxyl-terminal hydrolase DUB-1           63.9    4e-09   
ref|XP_001082678.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.1    4e-09   
ref|XP_007633624.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  64.7    5e-09   
ref|XP_009037330.1|  hypothetical protein AURANDRAFT_64568            64.3    5e-09   
gb|AAB95194.1|  hematopoietic-specific IL-2 deubiquitinating enzyme   64.7    6e-09   
gb|AAB94636.1|  hematopoietic-specific IL-2 deubiquitinating enzyme   64.7    6e-09   
ref|NP_034219.3|  deubiquitinating enzyme 2                           64.7    6e-09   
ref|XP_002806114.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    6e-09   
ref|XP_004916402.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    6e-09   
ref|XP_004992408.1|  hypothetical protein PTSG_07000                  64.7    7e-09   
ref|XP_007896003.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    7e-09   
ref|XP_005848077.1|  hypothetical protein CHLNCDRAFT_145319           64.7    7e-09   
emb|CDQ74510.1|  unnamed protein product                              64.7    7e-09   
gb|AAK84135.1|AF393637_1  deubiquitinating enzyme 2A                  64.3    7e-09   
gb|KFP75253.1|  Ubiquitin carboxyl-terminal hydrolase 42              64.7    7e-09   
ref|XP_009067978.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    7e-09   
ref|NP_001001559.2|  deubiquitinating enzyme 2a                       64.3    8e-09   
gb|AAK77003.1|  deubiquitinating enzyme 2A                            64.3    8e-09   
gb|ETE59661.1|  Ubiquitin carboxyl-terminal hydrolase 42              64.7    8e-09   
ref|XP_001738248.1|  ubiquitin carboxyl-terminal hydrolase DUB-1      64.3    8e-09   
ref|XP_007607798.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.5    8e-09   
ref|XP_007662335.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    8e-09   
ref|XP_007662334.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    8e-09   
gb|EMP34977.1|  Ubiquitin carboxyl-terminal hydrolase 42              64.3    8e-09   
ref|XP_001084204.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    8e-09   
ref|XP_003227691.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    8e-09   
ref|XP_006805393.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    9e-09   
ref|XP_008772857.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    9e-09   
gb|KFU93877.1|  Ubiquitin carboxyl-terminal hydrolase 42              64.7    9e-09   
ref|XP_008758066.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    9e-09   
ref|XP_008772907.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    9e-09   
ref|XP_008772019.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    9e-09   
ref|XP_010001626.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    9e-09   
ref|XP_005304763.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    1e-08   
ref|XP_007060712.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  64.3    1e-08   
ref|XP_007425215.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    1e-08   
gb|ABC24689.1|  ubiquitin-specific peptidase 48                       60.8    1e-08   
ref|XP_007667480.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    1e-08   



>ref|XP_003596211.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=983

 Score =   154 bits (390),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 80/150 (53%), Positives = 91/150 (61%), Gaps = 49/150 (33%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  704  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYVLYAVVVHLDTLNASFSGHYVSYVKD  763

Query  365  MQGNWFRIDDTKVKFYIKLYCFCFSNCRGKIQTel**lgklneekGI*klllmcalslls  186
            +QGNWFRIDDT+V     L C                                       
Sbjct  764  LQGNWFRIDDTEVML---LPCL--------------------------------------  782

Query  185  gktglsk*QVEQVPMSRVMTEGAYILFYMR  96
                    QV+ V +++VM+EGAYILFY R
Sbjct  783  --------QVQPVLVNQVMSEGAYILFYTR  804



>ref|XP_007022154.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
 gb|EOY13679.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
Length=851

 Score =   152 bits (384),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFRIDDTKV  327
            +QGNWFRIDDT+V
Sbjct  740  LQGNWFRIDDTEV  752



>ref|XP_007022155.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
 gb|EOY13680.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
Length=990

 Score =   152 bits (384),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  674  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  733

Query  365  MQGNWFRIDDTKV  327
            +QGNWFRIDDT+V
Sbjct  734  LQGNWFRIDDTEV  746



>ref|XP_007022153.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
 gb|EOY13678.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
Length=1000

 Score =   152 bits (384),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFRIDDTKV  327
            +QGNWFRIDDT+V
Sbjct  740  LQGNWFRIDDTEV  752



>ref|XP_007149328.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
 gb|ESW21322.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
Length=978

 Score =   151 bits (381),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  672  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  731

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDDT+V+
Sbjct  732  LQGNWFRIDDTEVQ  745



>emb|CDP06086.1| unnamed protein product [Coffea canephora]
Length=936

 Score =   150 bits (378),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGTDD+PPLYMLYAVVVHLDTLNASFSGHYI+Y+KD
Sbjct  617  QEGRYGKINKCITFPDMLDMVPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYIAYIKD  676

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDDT+V+
Sbjct  677  LQGNWFRIDDTEVQ  690



>ref|XP_011077821.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Sesamum 
indicum]
Length=979

 Score =   150 bits (378),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGTDD+PPLYMLY VVVHLDT NASFSGHYISYVKD
Sbjct  673  QEGNYGKINKCITFPEMLDMIPFMTGTDDIPPLYMLYGVVVHLDTSNASFSGHYISYVKD  732

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFR+DDT+V+
Sbjct  733  LQGNWFRVDDTEVQ  746



>gb|AES66462.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=948

 Score =   149 bits (377),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  677  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYVLYAVVVHLDTLNASFSGHYVSYVKD  736

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDDT+V+
Sbjct  737  LQGNWFRIDDTEVQ  750



>ref|XP_010092717.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
 gb|EXB52062.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
Length=1009

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  701  QEGRYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYAVVVHLDTLNASFSGHYVSYVKD  760

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDDT+V+
Sbjct  761  LQGNWFRIDDTEVQ  774



>gb|KHN47474.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=986

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  740  LQGNWFRIDDIEVQ  753



>ref|XP_006594689.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=989

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  683  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  742

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  743  LQGNWFRIDDIEVQ  756



>ref|XP_003541793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006594688.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=990

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  684  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  743

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  744  LQGNWFRIDDIEVQ  757



>ref|XP_006598163.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=988

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  681  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  740

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  741  LQGNWFRIDDAEVQ  754



>ref|XP_006598161.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006598162.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=989

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  682  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  741

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  742  LQGNWFRIDDAEVQ  755



>gb|KHN29845.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=989

 Score =   148 bits (374),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  682  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  741

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDD +V+
Sbjct  742  LQGNWFRIDDAEVQ  755



>gb|KHG25224.1| Ubiquitin carboxyl-terminal hydrolase 15 -like protein [Gossypium 
arboreum]
Length=954

 Score =   148 bits (373),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  643  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  702

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  703  LRGNWFRIDDTEVR  716



>gb|EYU28912.1| hypothetical protein MIMGU_mgv1a001776mg [Erythranthe guttata]
Length=760

 Score =   146 bits (369),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGTDD+PPLY+LYAVVVHLD+ NASFSGHYISYVKD
Sbjct  501  QEGNYGKINKCITFPEMLDMIPFMTGTDDIPPLYVLYAVVVHLDSYNASFSGHYISYVKD  560

Query  365  MQGNWFRIDDTKVK  324
            + GNWFR+DDT+V+
Sbjct  561  LHGNWFRVDDTEVQ  574



>ref|XP_010324419.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Solanum lycopersicum]
Length=954

 Score =   147 bits (371),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 2/75 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  642  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  701

Query  365  --MQGNWFRIDDTKV  327
              ++GNWFRIDDT+V
Sbjct  702  LHLRGNWFRIDDTEV  716



>ref|XP_009609977.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Nicotiana 
tomentosiformis]
Length=996

 Score =   147 bits (372),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 2/76 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MT TDD+PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  673  QEGSYGKINKCITFPDMLDMIPFMTATDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  732

Query  365  M--QGNWFRIDDTKVK  324
            +  QGNWFRIDDT+V+
Sbjct  733  LHRQGNWFRIDDTEVQ  748



>ref|XP_006348364.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348365.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Solanum tuberosum]
Length=966

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 2/75 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  654  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  713

Query  365  --MQGNWFRIDDTKV  327
              ++GNWFRIDDT+V
Sbjct  714  LHLRGNWFRIDDTEV  728



>ref|XP_004244319.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Solanum lycopersicum]
Length=966

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 2/75 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  654  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  713

Query  365  --MQGNWFRIDDTKV  327
              ++GNWFRIDDT+V
Sbjct  714  LHLRGNWFRIDDTEV  728



>gb|KJB12847.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
 gb|KJB12848.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
Length=988

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  668  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  727

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDDT+V
Sbjct  728  LRGNWFRIDDTEV  740



>gb|KJB12846.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
Length=994

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  674  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  733

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDDT+V
Sbjct  734  LRGNWFRIDDTEV  746



>gb|KJB45884.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
 gb|KJB45885.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
Length=984

 Score =   146 bits (369),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  671  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  730

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDDT+V
Sbjct  731  LRGNWFRIDDTEV  743



>gb|KJB45883.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
 gb|KJB45886.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
Length=985

 Score =   146 bits (369),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  672  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  731

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDDT+V
Sbjct  732  LRGNWFRIDDTEV  744



>gb|KHF97895.1| Ubiquitin carboxyl-terminal hydrolase 15 -like protein [Gossypium 
arboreum]
Length=988

 Score =   146 bits (369),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  668  QEGKYGKINKCITFPDMLDMVPFMTGTCDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  727

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDDT+V
Sbjct  728  LRGNWFRIDDTEV  740



>ref|XP_010694568.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Beta vulgaris 
subsp. vulgaris]
Length=939

 Score =   146 bits (368),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT+D PPLYMLY VVVH+DTLNASFSGHY+SYVKD
Sbjct  649  QEGNYGKINKCITFPEMLDMVPFMTGTNDSPPLYMLYGVVVHVDTLNASFSGHYVSYVKD  708

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFRIDDT V+
Sbjct  709  LQGNWFRIDDTVVQ  722



>ref|XP_009776208.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Nicotiana 
sylvestris]
Length=996

 Score =   146 bits (368),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 2/76 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI FP+MLDMIP+MTGTDD PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  673  QEGSYGKINKCIAFPDMLDMIPFMTGTDDSPPLYMLYAVVVHLDTLNASFSGHYISYVKD  732

Query  365  M--QGNWFRIDDTKVK  324
            +  QGNWFRIDDT+V+
Sbjct  733  LHRQGNWFRIDDTEVQ  748



>ref|XP_010539169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Tarenaya 
hassleriana]
Length=901

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM P+MTGT D+PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  632  QEGRYGKINKCITFPEMLDMTPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  691

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  692  LRGNWFRIDDSEI  704



>ref|XP_011465545.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X3 
[Fragaria vesca subsp. vesca]
Length=936

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAVVVHLDT NASFSGHYI+YVKD
Sbjct  679  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  738

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  739  MRGNWFRIDDTEVQ  752



>ref|XP_011465544.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Fragaria vesca subsp. vesca]
Length=937

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAVVVHLDT NASFSGHYI+YVKD
Sbjct  680  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  739

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  740  MRGNWFRIDDTEVQ  753



>ref|XP_011465542.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011465543.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Fragaria vesca subsp. vesca]
Length=938

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAVVVHLDT NASFSGHYI+YVKD
Sbjct  681  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  740

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  741  MRGNWFRIDDTEVQ  754



>ref|XP_011044935.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Populus euphratica]
Length=700

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  463  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  522

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDDT+V
Sbjct  523  LQGSWFRIDDTEV  535



>ref|XP_011044933.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Populus euphratica]
Length=830

 Score =   144 bits (364),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  593  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  652

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDDT+V
Sbjct  653  LQGSWFRIDDTEV  665



>ref|XP_011044931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
 ref|XP_011044932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
Length=831

 Score =   144 bits (364),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  594  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  653

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDDT+V
Sbjct  654  LQGSWFRIDDTEV  666



>ref|XP_002317364.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
 gb|EEE97976.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
Length=831

 Score =   144 bits (363),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  594  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  653

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDDT+V
Sbjct  654  LQGSWFRIDDTEV  666



>ref|XP_011044934.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Populus euphratica]
Length=803

 Score =   144 bits (363),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  566  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  625

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDDT+V
Sbjct  626  LQGSWFRIDDTEV  638



>ref|XP_010644793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Vitis vinifera]
Length=997

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVH+DTLNASFSGHY++YVKD
Sbjct  683  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  742

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFR+DD +V+
Sbjct  743  LQGNWFRVDDAEVQ  756



>emb|CAN68406.1| hypothetical protein VITISV_035043 [Vitis vinifera]
Length=945

 Score =   144 bits (363),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVH+DTLNASFSGHY++YVKD
Sbjct  631  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  690

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFR+DD +V+
Sbjct  691  LQGNWFRVDDAEVQ  704



>ref|XP_010540128.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Tarenaya 
hassleriana]
Length=888

 Score =   143 bits (361),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT DVPPLY+LYAVVVHLDTLNASFSGHYISYVKD
Sbjct  631  QEGRYGKINKCITFPEMLDMIPFMTGTGDVPPLYVLYAVVVHLDTLNASFSGHYISYVKD  690

Query  365  MQGNWFRIDDTKV  327
            ++G+WFRIDD+++
Sbjct  691  LRGSWFRIDDSEI  703



>ref|XP_004488653.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Cicer 
arietinum]
Length=936

 Score =   144 bits (362),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPE LDMIP+MTGT D+PPLY LYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  669  QEGRYGKINKCITFPENLDMIPFMTGTGDIPPLYALYAVVVHLDTLNASFSGHYVSYVKD  728

Query  365  MQGNWFRIDDTKVK  324
            + GNWFRIDDT+V+
Sbjct  729  LHGNWFRIDDTEVQ  742



>emb|CDX96790.1| BnaA08g23330D [Brassica napus]
Length=835

 Score =   143 bits (361),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  589  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  648

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  649  LRGNWFRIDDSEI  661



>ref|XP_010459276.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Camelina sativa]
Length=921

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  643  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  702

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  703  LRGNWYRIDDSEI  715



>ref|XP_010498051.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Camelina 
sativa]
Length=926

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  648  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  707

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  708  LRGNWYRIDDSEI  720



>ref|XP_010459274.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
 ref|XP_010459275.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
Length=931

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  653  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  712

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  713  LRGNWYRIDDSEI  725



>emb|CDY48465.1| BnaC05g13250D [Brassica napus]
Length=876

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  611  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  670

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  671  LRGNWFRIDDSEI  683



>ref|XP_009149147.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Brassica 
rapa]
 ref|XP_009149148.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Brassica 
rapa]
Length=877

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  615  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  674

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  675  LRGNWFRIDDSEI  687



>emb|CDY65125.1| BnaA06g38410D [Brassica napus]
Length=877

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  614  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  673

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  674  LRGNWFRIDDSEI  686



>ref|XP_010476845.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Camelina sativa]
 ref|XP_010476846.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Camelina sativa]
Length=931

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  653  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  712

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  713  LRGNWYRIDDSEI  725



>emb|CBI33027.3| unnamed protein product [Vitis vinifera]
Length=894

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVH+DTLNASFSGHY++YVKD
Sbjct  621  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  680

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFR+DD +V+
Sbjct  681  LQGNWFRVDDAEVQ  694



>ref|XP_006306123.1| hypothetical protein CARUB_v10011568mg [Capsella rubella]
 gb|EOA39021.1| hypothetical protein CARUB_v10011568mg [Capsella rubella]
Length=938

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  656  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  715

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  716  LRGNWYRIDDSEI  728



>ref|XP_009110426.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
 ref|XP_009110427.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
Length=892

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  626  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  685

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  686  LRGNWFRIDDSEI  698



>ref|XP_006416743.1| hypothetical protein EUTSA_v10006749mg [Eutrema salsugineum]
 gb|ESQ35096.1| hypothetical protein EUTSA_v10006749mg [Eutrema salsugineum]
Length=900

 Score =   143 bits (361),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  636  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  695

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  696  LRGNWFRIDDSEI  708



>ref|XP_006477933.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X5 [Citrus sinensis]
Length=1013

 Score =   143 bits (361),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  689  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  748

Query  365  MQGNWFRIDDTKV  327
            MQG WFRIDDT+V
Sbjct  749  MQGTWFRIDDTQV  761



>ref|XP_006477929.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Citrus sinensis]
 ref|XP_006477931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Citrus sinensis]
Length=1015

 Score =   143 bits (361),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFRIDDTKV  327
            MQG WFRIDDT+V
Sbjct  751  MQGTWFRIDDTQV  763



>ref|XP_006442255.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 ref|XP_006442256.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55495.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55496.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
Length=1016

 Score =   143 bits (361),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFRIDDTKV  327
            MQG WFRIDDT+V
Sbjct  751  MQGTWFRIDDTQV  763



>ref|XP_010476847.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Camelina sativa]
Length=919

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  641  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  700

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  701  LRGNWYRIDDSEI  713



>emb|CDX83925.1| BnaC08g17200D [Brassica napus]
Length=847

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  581  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  640

Query  365  MQGNWFRIDDTKV  327
            ++GNWFRIDD+++
Sbjct  641  LRGNWFRIDDSEI  653



>ref|XP_011045595.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Populus euphratica]
Length=922

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  644  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  703

Query  365  MQGNWFRIDDTKV  327
            ++G+WF+IDDT+V
Sbjct  704  LRGSWFKIDDTEV  716



>ref|XP_008781931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782004.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782081.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782141.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782218.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782299.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782368.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782443.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782523.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782596.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
Length=966

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  671  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  730

Query  365  MQGNWFRIDDTKVK  324
            +QG WFRIDD++V+
Sbjct  731  LQGTWFRIDDSEVQ  744



>ref|XP_008782751.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Phoenix dactylifera]
Length=797

 Score =   142 bits (357),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  502  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  561

Query  365  MQGNWFRIDDTKVK  324
            +QG WFRIDD++V+
Sbjct  562  LQGTWFRIDDSEVQ  575



>gb|AAD50020.1|AC007651_15 Unknown protein [Arabidopsis thaliana]
Length=891

 Score =   142 bits (357),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  618  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  677

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  678  LRGNWYRIDDSEI  690



>ref|XP_011045594.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Populus euphratica]
Length=937

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  644  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  703

Query  365  MQGNWFRIDDTKV  327
            ++G+WF+IDDT+V
Sbjct  704  LRGSWFKIDDTEV  716



>gb|AAG42756.1|AF302665_1 ubiquitin-specific protease 15 [Arabidopsis thaliana]
Length=924

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  651  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  710

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  711  LRGNWYRIDDSEI  723



>ref|NP_564014.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
 sp|Q9FPS9.2|UBP15_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 15; AltName: 
Full=Deubiquitinating enzyme 15; Short=AtUBP15; AltName: 
Full=Ubiquitin thioesterase 15; AltName: Full=Ubiquitin-specific-processing 
protease 15 [Arabidopsis thaliana]
 gb|AEE29542.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
Length=924

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  651  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  710

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  711  LRGNWYRIDDSEI  723



>gb|KDO45638.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
 gb|KDO45639.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
 gb|KDO45640.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
Length=762

 Score =   141 bits (356),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFRIDDTK  330
            MQG WFRIDDT+
Sbjct  751  MQGTWFRIDDTQ  762



>ref|XP_002892935.1| ubiquitin-specific protease 15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69194.1| ubiquitin-specific protease 15 [Arabidopsis lyrata subsp. lyrata]
Length=926

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  655  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  714

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  715  LRGNWYRIDDSEI  727



>ref|NP_001185019.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
 gb|AEE29543.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
Length=928

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV+VHLDTLNASFSGHYISYVKD
Sbjct  655  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  714

Query  365  MQGNWFRIDDTKV  327
            ++GNW+RIDD+++
Sbjct  715  LRGNWYRIDDSEI  727



>gb|AFW65941.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=90

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  8    QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  67

Query  365  MQGNWFRIDDTKVKFYIK  312
            MQG W RIDD++V+F  +
Sbjct  68   MQGTWLRIDDSEVRFTTR  85



>ref|XP_008782673.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Phoenix dactylifera]
Length=888

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLDTLNASFSGHYISYVKD
Sbjct  593  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  652

Query  365  MQGNWFRIDDTKVK  324
            +QG WFRIDD++V+
Sbjct  653  LQGTWFRIDDSEVQ  666



>ref|XP_010279646.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279647.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279650.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279651.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=1013

 Score =   142 bits (357),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D PPLYMLY VVVHLDTLNASFSGHY+SYVKD
Sbjct  689  QKGKYGKINKCITFPDMLDMIPFMTGTGDSPPLYMLYGVVVHLDTLNASFSGHYVSYVKD  748

Query  365  MQGNWFRIDDTKVK  324
            M G W RIDDT+V+
Sbjct  749  MHGTWLRIDDTEVQ  762



>gb|KDO45637.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
Length=818

 Score =   140 bits (354),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  747  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  806

Query  365  MQGNWFRIDDTK  330
            MQG WFRIDDT+
Sbjct  807  MQGTWFRIDDTQ  818



>ref|XP_002530131.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32247.1| conserved hypothetical protein [Ricinus communis]
Length=870

 Score =   141 bits (355),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK ITFP+MLDMIPYMTGT D+PPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  581  QEGKHGKINKYITFPDMLDMIPYMTGTIDIPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  640

Query  365  MQGNWFRIDDTKVK  324
            +QGNWFR+DDT+V+
Sbjct  641  LQGNWFRVDDTEVR  654



>ref|XP_006477932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Citrus sinensis]
Length=1015

 Score =   141 bits (355),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+VVVHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFRIDDTKV  327
            MQG WFRIDD +V
Sbjct  751  MQGTWFRIDDMQV  763



>ref|XP_002298917.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
 gb|EEE83722.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
Length=665

 Score =   139 bits (350),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTG  DVPPLYMLYAVVVHLDTLNASFSGHY++YVKD
Sbjct  564  QEGKYGKINKCITFPDMLDMIPFMTGMGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  623

Query  365  MQGNWFRIDDTKV  327
            ++G+WF+IDDT+V
Sbjct  624  LRGSWFKIDDTEV  636



>ref|XP_010062748.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X5 
[Eucalyptus grandis]
Length=947

 Score =   140 bits (353),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAVVVHLDT NASFSGHY+SYV++
Sbjct  620  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  679

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  680  LRGNWFRIDDTEVQ  693



>ref|XP_010062747.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X4 
[Eucalyptus grandis]
 gb|KCW69874.1| hypothetical protein EUGRSUZ_F03211 [Eucalyptus grandis]
Length=965

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAVVVHLDT NASFSGHY+SYV++
Sbjct  638  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  697

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  698  LRGNWFRIDDTEVQ  711



>ref|XP_008226235.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Prunus mume]
Length=1002

 Score =   140 bits (354),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAVVVHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  742  MRGNWFRIDDTQVQ  755



>ref|XP_010062746.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X3 
[Eucalyptus grandis]
 gb|KCW69873.1| hypothetical protein EUGRSUZ_F03211 [Eucalyptus grandis]
Length=966

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAVVVHLDT NASFSGHY+SYV++
Sbjct  639  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  698

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  699  LRGNWFRIDDTEVQ  712



>ref|XP_008226232.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
 ref|XP_008226233.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
 ref|XP_008226234.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
Length=1003

 Score =   140 bits (354),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAVVVHLDT NASFSGHY++YVKD
Sbjct  683  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  742

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  743  MRGNWFRIDDTQVQ  756



>ref|XP_010062745.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Eucalyptus grandis]
Length=970

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAVVVHLDT NASFSGHY+SYV++
Sbjct  643  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  702

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  703  LRGNWFRIDDTEVQ  716



>ref|XP_010062743.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Eucalyptus grandis]
Length=972

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAVVVHLDT NASFSGHY+SYV++
Sbjct  645  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  704

Query  365  MQGNWFRIDDTKVK  324
            ++GNWFRIDDT+V+
Sbjct  705  LRGNWFRIDDTEVQ  718



>ref|XP_007211338.1| hypothetical protein PRUPE_ppa000901mg [Prunus persica]
 gb|EMJ12537.1| hypothetical protein PRUPE_ppa000901mg [Prunus persica]
Length=966

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAVVVHLDT NASFSGHY++YVKD
Sbjct  646  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  705

Query  365  MQGNWFRIDDTKVK  324
            M+GNWFRIDDT+V+
Sbjct  706  MRGNWFRIDDTQVQ  719



>ref|XP_010915558.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Elaeis 
guineensis]
Length=952

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  670  QTGKYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  729

Query  365  MQGNWFRIDDTKVK  324
            +QG W RIDD++V+
Sbjct  730  LQGTWLRIDDSEVQ  743



>ref|XP_008382966.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Malus domestica]
Length=1008

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  688  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008783949.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Phoenix 
dactylifera]
Length=954

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLDTLNASFSGHY+SYVKD
Sbjct  665  QTGKYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  724

Query  365  MQGNWFRIDDTKVK  324
            +QG W RIDD +V+
Sbjct  725  LQGTWLRIDDCEVQ  738



>ref|XP_009354862.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Pyrus x bretschneideri]
Length=1004

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009367759.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Pyrus x bretschneideri]
Length=1009

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  688  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_009354860.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Pyrus x bretschneideri]
Length=1010

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008382965.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Malus domestica]
Length=1032

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  712  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  771

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  772  MRGDWFRIDDTEV  784



>ref|XP_009354861.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Pyrus x bretschneideri]
Length=1010

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009354859.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Pyrus x bretschneideri]
Length=1016

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008356196.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Malus domestica]
Length=1004

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  681  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  740

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  741  MRGDWFRIDDTEV  753



>ref|XP_008356195.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Malus domestica]
Length=1005

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_008356197.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Malus domestica]
Length=990

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009367758.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Pyrus x bretschneideri]
Length=1032

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  711  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  770

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  771  MRGDWFRIDDTEV  783



>ref|XP_009354863.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X5 [Pyrus x bretschneideri]
Length=1001

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY VVVHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFRIDDTKV  327
            M+G+WFRIDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_010925671.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
15-like [Elaeis guineensis]
Length=908

 Score =   139 bits (349),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAVVVHLD LNASFSGHY+SYVKD
Sbjct  615  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDNLNASFSGHYVSYVKD  674

Query  365  MQGNWFRIDDTKVK  324
            ++G WFRIDD++V+
Sbjct  675  LEGTWFRIDDSEVQ  688



>ref|XP_010274759.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010274766.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=998

 Score =   139 bits (349),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTG  D PPLY+LYAVVVHLDTLNASFSGHY++YVKD
Sbjct  686  QTGKYGKINKCITFPDMLDMIPFMTGIGDSPPLYLLYAVVVHLDTLNASFSGHYVAYVKD  745

Query  365  MQGNWFRIDDTKVK  324
            +QG W RIDDT+V+
Sbjct  746  LQGIWLRIDDTEVQ  759



>ref|XP_009390669.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
15-like [Musa acuminata subsp. malaccensis]
Length=960

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT D PPLY+LYAVVVHLD  NASFSGHY+SYVKD
Sbjct  666  QTGKYGKINKCVTFPDMLDMIPFMTGTADNPPLYLLYAVVVHLDAFNASFSGHYVSYVKD  725

Query  365  MQGNWFRIDDTKVK  324
            ++G WF+IDD++V+
Sbjct  726  LEGTWFKIDDSEVQ  739



>ref|XP_006840775.1| hypothetical protein AMTR_s00096p00170210 [Amborella trichopoda]
 gb|ERN02450.1| hypothetical protein AMTR_s00096p00170210 [Amborella trichopoda]
Length=765

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  533  YGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKDMQGN  354
            YGK+NKC+TFP+MLDMIPYMTGT D PPLYMLY VVVHLD+ NASFSGHY+SYVKD+QG 
Sbjct  474  YGKLNKCVTFPDMLDMIPYMTGTGDSPPLYMLYGVVVHLDSSNASFSGHYVSYVKDLQGA  533

Query  353  WFRIDDTKVK  324
            WFRIDDT+V+
Sbjct  534  WFRIDDTEVE  543



>ref|XP_010234088.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Brachypodium distachyon]
Length=940

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFPEMLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  617  QTGKYGKINKCVTFPEMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  676

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++VK
Sbjct  677  MQGTWLRIDDSEVK  690



>ref|XP_003571975.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Brachypodium distachyon]
Length=971

 Score =   134 bits (338),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFPEMLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  648  QTGKYGKINKCVTFPEMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  707

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++VK
Sbjct  708  MQGTWLRIDDSEVK  721



>gb|AFW71122.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=821

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  567  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  626

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  627  MQGTWLRIDDSEVQ  640



>gb|AFW71123.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=890

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  567  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  626

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  627  MQGTWLRIDDSEVQ  640



>ref|XP_008645575.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Zea 
mays]
Length=973

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>ref|XP_002453597.1| hypothetical protein SORBIDRAFT_04g008750 [Sorghum bicolor]
 gb|EES06573.1| hypothetical protein SORBIDRAFT_04g008750 [Sorghum bicolor]
Length=966

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>gb|EEE56641.1| hypothetical protein OsJ_06049 [Oryza sativa Japonica Group]
Length=897

 Score =   132 bits (333),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  562  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  621

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  622  MQGTWLRIDDSEVQ  635



>ref|XP_008679796.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Zea 
mays]
Length=970

 Score =   132 bits (333),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>gb|AFW65940.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=489

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  169  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  228

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  229  MQGTWLRIDDSEVQ  242



>gb|EEC72815.1| hypothetical protein OsI_06524 [Oryza sativa Indica Group]
Length=808

 Score =   132 bits (331),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  487  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  546

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  547  MQGTWLRIDDSEVQ  560



>dbj|BAJ87234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=979

 Score =   132 bits (332),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  656  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  715

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++VK
Sbjct  716  MQGTWLRIDDSEVK  729



>ref|XP_006647115.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Oryza 
brachyantha]
Length=973

 Score =   132 bits (331),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  651  QSGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  710

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  711  MQGTWLRIDDSEVQ  724



>ref|NP_001046415.1| Os02g0244300 [Oryza sativa Japonica Group]
 dbj|BAF08329.1| Os02g0244300 [Oryza sativa Japonica Group]
Length=975

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  654  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  713

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  714  MQGTWLRIDDSEVQ  727



>dbj|BAD28270.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
Length=919

 Score =   131 bits (329),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  598  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  657

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  658  MQGTWLRIDDSEVQ  671



>gb|EMS59305.1| Ubiquitin carboxyl-terminal hydrolase 15 [Triticum urartu]
Length=962

 Score =   131 bits (330),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  587  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  646

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++VK
Sbjct  647  MQGTWLRIDDSEVK  660



>ref|XP_004951331.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Setaria italica]
 ref|XP_004951332.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Setaria italica]
Length=976

 Score =   131 bits (329),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  654  KTGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  713

Query  365  MQGNWFRIDDTKVK  324
            MQG W RIDD++V+
Sbjct  714  MQGTWLRIDDSEVQ  727



>gb|EMT09965.1| Ubiquitin carboxyl-terminal hydrolase 15 [Aegilops tauschii]
Length=664

 Score =   129 bits (323),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAVVVH+DT NASFSGHYISYVKD
Sbjct  584  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  643

Query  365  MQGNWFRIDDTKV  327
            MQG W RIDD++V
Sbjct  644  MQGTWLRIDDSEV  656



>ref|XP_006841208.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
 gb|ERN02883.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
Length=1083

 Score =   116 bits (290),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYMTG  D  PLY LYAVVVHLD +NASFSGHY+ YV+ 
Sbjct  745  QSGKFGKLNKSVRFPETLDLSPYMTGESDKSPLYKLYAVVVHLDIMNASFSGHYVCYVRS  804

Query  365  MQGNWFRIDDTKVK  324
            +QG W++IDD+KVK
Sbjct  805  LQGKWYKIDDSKVK  818



>ref|XP_003613074.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=1096

 Score =   115 bits (287),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 22/154 (14%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+G  D  P Y LYAVVVHLD +NASFSGHY+ YVK+
Sbjct  746  QSGNFEKLNKSVQFPEVLDMTPYMSGRKDKSPFYSLYAVVVHLDIMNASFSGHYVCYVKN  805

Query  365  MQGNWFRIDDTKVKFYIKLYCFC---FSNCRGKIQTel**lgklneekGI*klllmcals  195
            +QG WFR DD++V+ +  ++      FS    K++                   L     
Sbjct  806  IQGEWFRTDDSRVRTFKHIFFVSEGLFSLLPPKMR-------------------LYKLKK  846

Query  194  llsgktglsk*QVEQVPMSRVMTEGAYILFYMRY  93
            L   +  L    VE V +SRV++E AY+L Y R+
Sbjct  847  LWHYRDALKATCVEPVELSRVLSESAYMLLYARH  880



>ref|XP_007158378.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
 gb|ESW30372.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
Length=925

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+GT D  PLY LYAVVVHLD +NA+FSGHY+ YVK+
Sbjct  615  QSGNFEKLNKSVQFPEVLDMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYVCYVKN  674

Query  365  MQGNWFRIDDTKVK  324
            +QG WFR DD++V+
Sbjct  675  IQGEWFRTDDSRVE  688



>emb|CBI19252.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   113 bits (282),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAVVVHLD +NA+FSGHY+ YVK+
Sbjct  683  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  742

Query  365  MQGNWFRIDDTKVK  324
            +Q  WF+IDD+ VK
Sbjct  743  IQNKWFKIDDSTVK  756



>ref|XP_010916668.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Elaeis guineensis]
Length=1022

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  PLY LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  731  QSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRLYAVVVHLDVMNAAFSGHYVCYVKS  790

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  791  TQGKWYKTDDSMVK  804



>ref|XP_010664385.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Vitis vinifera]
Length=1207

 Score =   113 bits (282),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAVVVHLD +NA+FSGHY+ YVK+
Sbjct  855  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  914

Query  365  MQGNWFRIDDTKVK  324
            +Q  WF+IDD+ VK
Sbjct  915  IQNKWFKIDDSTVK  928



>ref|XP_010664383.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 ref|XP_010664384.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 emb|CAN74012.1| hypothetical protein VITISV_003549 [Vitis vinifera]
Length=1225

 Score =   113 bits (282),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAVVVHLD +NA+FSGHY+ YVK+
Sbjct  873  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  932

Query  365  MQGNWFRIDDTKVK  324
            +Q  WF+IDD+ VK
Sbjct  933  IQNKWFKIDDSTVK  946



>gb|KHN14516.1| Ubiquitin carboxyl-terminal hydrolase 17 [Glycine soja]
Length=874

 Score =   112 bits (280),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAVVVHLD +NA+FSGHY+ YVK+
Sbjct  569  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYVCYVKN  628

Query  365  MQGNWFRIDDTKVK  324
            +QG WFR DD++V+
Sbjct  629  IQGEWFRTDDSRVE  642



>gb|KJB64168.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=914

 Score =   112 bits (280),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  862

Query  365  MQGNWFRIDDTKVKFYIKLYCFCFS  291
             Q  WF+IDD+KV + I + C  +S
Sbjct  863  AQNKWFKIDDSKVMYSIIIICIFWS  887



>gb|AES96032.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=943

 Score =   112 bits (279),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+G  D  P Y LYAVVVHLD +NASFSGHY+ YVK+
Sbjct  634  QSGNFEKLNKSVQFPEVLDMTPYMSGRKDKSPFYSLYAVVVHLDIMNASFSGHYVCYVKN  693

Query  365  MQGNWFRIDDTKVK  324
            +QG WFR DD++V+
Sbjct  694  IQGEWFRTDDSRVE  707



>ref|XP_002514028.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48611.1| conserved hypothetical protein [Ricinus communis]
Length=1060

 Score =   112 bits (279),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NASFSGHY+ YVK+
Sbjct  735  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYVKN  794

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  795  VQNKWFKIDDSTV  807



>ref|XP_001772702.1| predicted protein [Physcomitrella patens]
 gb|EDQ62416.1| predicted protein, partial [Physcomitrella patens]
Length=428

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFP+ LDM PYM+GT+D  PLY LYAVVVH+D LNASF GHYI YVKD
Sbjct  336  QSGKFGKLNKRVTFPKTLDMSPYMSGTNDDSPLYGLYAVVVHVDLLNASFFGHYICYVKD  395

Query  365  MQGNWFRIDDTKVK  324
              G W++IDD+KVK
Sbjct  396  SNGVWYKIDDSKVK  409



>ref|XP_010277575.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=742

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+L++ PYM  T D  P+Y LYAVVVHLD +NA+FSGHYI Y+K+
Sbjct  381  QTGKFGKLNKLVRFPEVLNLTPYMNATSDKSPVYTLYAVVVHLDIMNAAFSGHYICYIKN  440

Query  365  MQGNWFRIDDTKVK  324
             QG WF+IDD+ VK
Sbjct  441  FQGKWFKIDDSMVK  454



>ref|XP_008795170.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X4 [Phoenix dactylifera]
Length=1019

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  728  QSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  787

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  788  TQGKWYKTDDSMVK  801



>ref|XP_008795169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X3 [Phoenix dactylifera]
Length=1024

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  733  QSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  792

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  793  TQGKWYKTDDSMVK  806



>ref|XP_008802270.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Phoenix 
dactylifera]
Length=1046

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE LD+  YM+GTDD  P+Y LYAVVVHLD +NASFSGHY+ YV+D
Sbjct  721  QSGKFGKLNKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVRD  780

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  781  TQGKWYKTDDSTVK  794



>ref|XP_010916667.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Elaeis guineensis]
Length=1027

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  PLY LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  736  KSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRLYAVVVHLDVMNAAFSGHYVCYVKS  795

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  796  TQGKWYKTDDSMVK  809



>ref|XP_004489806.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=936

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAVVVHLD +NA+FSGHYI YVK+
Sbjct  633  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYICYVKN  692

Query  365  MQGNWFRIDDTKVK  324
             +G WFR DD+KV+
Sbjct  693  NRGEWFRTDDSKVE  706



>ref|XP_010939750.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Elaeis guineensis]
Length=1046

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK I FPE LD+  YM+GTDD  P+Y LYAVVVHLD +NASFSGHY+ YVKD
Sbjct  728  QSDKFGKLNKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVKD  787

Query  365  MQGNWFRIDDTKVK  324
             QG W++IDD+ VK
Sbjct  788  TQGKWYKIDDSMVK  801



>ref|XP_009387155.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=1015

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM G++D  P+Y LYAVVVHLD +NASFSGHY+ YVK+
Sbjct  695  QSGKFGKLNKAVCFPEYLDLAPYMHGSNDKSPMYKLYAVVVHLDVMNASFSGHYVCYVKN  754

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  755  RQGKWYKTDDSTVK  768



>ref|XP_002970813.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
 gb|EFJ28139.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
Length=419

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LDM+PYM+GT D PP Y LYAVVVH+D LNAS+ GHY+ YV+ 
Sbjct  327  QGGKFGKINKKVTFPEELDMVPYMSGTVDTPPAYKLYAVVVHVDMLNASYFGHYVCYVRA  386

Query  365  MQGNWFRIDDTKVK  324
              G WF++DD+KVK
Sbjct  387  GNGAWFKVDDSKVK  400



>ref|XP_011013097.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Populus euphratica]
Length=1103

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  779  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  838

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  839  IQNKWFKIDDSTV  851



>ref|XP_011013096.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Populus euphratica]
Length=1127

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  862

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  863  IQNKWFKIDDSTV  875



>ref|XP_011016915.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Populus euphratica]
Length=1137

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  811  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  870

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  871  IQNKWFKIDDSTV  883



>ref|XP_011016914.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Populus euphratica]
Length=1139

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  813  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  872

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  873  IQNKWFKIDDSTV  885



>ref|XP_002301091.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
 gb|EEE80364.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
Length=1141

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  874

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  875  IQNKWFKIDDSTV  887



>ref|XP_002307344.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
 gb|EEE94340.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
Length=1125

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  862

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  863  IQNKWFKIDDSTV  875



>gb|KHG13290.1| Ubiquitin carboxyl-terminal hydrolase 16 -like protein [Gossypium 
arboreum]
Length=1070

 Score =   110 bits (275),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  804  QSGKFGKLNKAIQFPEILNLAPYMSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  863

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+KV
Sbjct  864  AQNKWFKIDDSKV  876



>ref|XP_001774704.1| predicted protein [Physcomitrella patens]
 gb|EDQ60519.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE+LDM PYM+G +D P LY LYAVVVH+D LNASF GHYI +VKD
Sbjct  330  QSGKFGKLNKRVTFPEVLDMSPYMSGANDHPLLYRLYAVVVHVDMLNASFFGHYICFVKD  389

Query  365  MQGNWFRIDDTKV-KFYIKLYC  303
              G W++IDD KV + Y++  C
Sbjct  390  SNGVWYKIDDRKVQRHYLRAVC  411



>gb|KDP41469.1| hypothetical protein JCGZ_15876 [Jatropha curcas]
Length=1103

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PY++GT D  P+Y LY VVVHLD +NASFSGHY+ Y+K+
Sbjct  794  QSGKFGKLNKSIRFPEILDLAPYISGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYIKN  853

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  854  IQNKWFKIDDSTV  866



>ref|XP_008795168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Phoenix dactylifera]
Length=1024

 Score =   109 bits (273),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  733  KSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  792

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  793  TQGKWYKTDDSMVK  806



>ref|XP_008795167.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Phoenix dactylifera]
Length=1029

 Score =   109 bits (273),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  738  KSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  797

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  798  TQGKWYKTDDSMVK  811



>ref|XP_009761470.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nicotiana 
sylvestris]
Length=1175

 Score =   109 bits (273),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  847  QSGKFGKLNKTIKFPEILNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  906

Query  365  MQGNWFRIDDTKVK  324
             Q  WF++DD+ VK
Sbjct  907  FQNRWFKVDDSSVK  920



>emb|CDP11495.1| unnamed protein product [Coffea canephora]
Length=1177

 Score =   109 bits (273),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V+VHLD +NA+FSGHY+ YVK+
Sbjct  834  QSGKFGKLNKTIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDIMNAAFSGHYVCYVKN  893

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+ V
Sbjct  894  TQNKWFKIDDSMV  906



>ref|XP_004301361.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Fragaria 
vesca subsp. vesca]
Length=1140

 Score =   109 bits (273),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILNLAPYMSGTSDKSPIYKLYGVVVHLDVMNAAFSGHYVCYVKN  875

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  876  LQNKWFKVDDSTV  888



>ref|XP_010646974.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=857

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+M PYM+GTDD  P+Y LYAVVVHLD +NA+FSGHY+ +VK+
Sbjct  606  QSSNFGKLNKSVRFPETLNMTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  665

Query  365  MQGNWFRIDDTKV  327
              G+WFRIDD+ V
Sbjct  666  FLGDWFRIDDSTV  678



>ref|XP_002969545.1| hypothetical protein SELMODRAFT_91996, partial [Selaginella moellendorffii]
 gb|EFJ29633.1| hypothetical protein SELMODRAFT_91996, partial [Selaginella moellendorffii]
Length=374

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LDM+PYM+GT D PP Y LYAVVVH+D LNAS+ GHY+ YV+ 
Sbjct  296  QGGKFGKINKKVTFPEELDMVPYMSGTVDTPPAYELYAVVVHVDMLNASYFGHYVCYVRA  355

Query  365  MQGNWFRIDDTKVKFYIKL  309
              G WF++DD+KV    K 
Sbjct  356  GNGAWFKVDDSKVSRRWKF  374



>ref|XP_007018207.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
 gb|EOY15432.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
Length=1138

 Score =   109 bits (272),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  809  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  868

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  869  VQNKWFKIDDSTV  881



>ref|XP_007018208.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
 gb|EOY15433.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
Length=1139

 Score =   109 bits (272),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  809  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  868

Query  365  MQGNWFRIDDTKV  327
            +Q  WF+IDD+ V
Sbjct  869  VQNKWFKIDDSTV  881



>ref|XP_007137649.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
 gb|ESW09643.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
Length=1125

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLDT+NA+FSGHY+SYVK+
Sbjct  803  QHGKFGKLNKPIQFPEILNLAPFMSGTSDKSPVYRLYGVVVHLDTMNAAFSGHYVSYVKN  862

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  863  IQNRWFKVDDSVV  875



>ref|XP_010942663.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Elaeis 
guineensis]
Length=1046

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE LD+  YM+GTDD   +Y LYAVVVHLD +NASFSGHY+ YVKD
Sbjct  720  QSGKFGKLNKSIRFPEYLDLARYMSGTDDKFAVYRLYAVVVHLDIMNASFSGHYVCYVKD  779

Query  365  MQGNWFRIDDTKVK  324
             QG W++ DD+ VK
Sbjct  780  TQGKWYKTDDSMVK  793



>gb|KDO81148.1| hypothetical protein CISIN_1g0011341mg, partial [Citrus sinensis]
Length=375

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK 
Sbjct  28   QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYVKS  87

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  88   TQNKWFKVDDSTV  100



>ref|XP_006472486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Citrus 
sinensis]
Length=1128

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK 
Sbjct  798  QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYVKS  857

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  858  TQNKWFKVDDSTV  870



>ref|XP_008219286.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Prunus mume]
Length=1109

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  875

Query  365  MQGNWFRIDDTKV  327
                WF+IDD+ V
Sbjct  876  SHNKWFKIDDSTV  888



>ref|XP_007225419.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
 gb|EMJ26618.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
Length=1114

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  875

Query  365  MQGNWFRIDDTKV  327
                WF+IDD+ V
Sbjct  876  SHNKWFKIDDSTV  888



>ref|XP_003635052.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=942

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L++ PYM+GTDD  P+Y LYAVVVHLD +NA+FSGHY+ +VK+
Sbjct  607  QSSNFGKLNKSVRFPETLNLTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  666

Query  365  MQGNWFRIDDTKV  327
              G+WFRIDD+ V
Sbjct  667  FLGDWFRIDDSTV  679



>gb|KJB64167.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=1042

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  776  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  835

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+KV
Sbjct  836  AQNKWFKIDDSKV  848



>gb|KJB64166.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=1069

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  862

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+KV
Sbjct  863  AQNKWFKIDDSKV  875



>gb|KJB29358.1| hypothetical protein B456_005G096600 [Gossypium raimondii]
Length=878

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  794  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYLCYVKN  853

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+ V
Sbjct  854  AQNKWFKIDDSMV  866



>ref|XP_004237986.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Solanum 
lycopersicum]
Length=1158

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  846  QSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  905

Query  365  MQGNWFRIDDTKVK  324
             Q  W+++DD+ VK
Sbjct  906  FQNKWYKVDDSSVK  919



>ref|XP_006338134.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Solanum 
tuberosum]
Length=1165

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  839  QSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  898

Query  365  MQGNWFRIDDTKVK  324
             Q  W+++DD+ VK
Sbjct  899  FQNKWYKVDDSSVK  912



>ref|XP_006433843.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
 gb|ESR47083.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
Length=1145

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ Y+K 
Sbjct  798  QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYIKS  857

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  858  TQNKWFKVDDSTV  870



>gb|KJB29359.1| hypothetical protein B456_005G096600 [Gossypium raimondii]
Length=1070

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  794  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYLCYVKN  853

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+ V
Sbjct  854  AQNKWFKIDDSMV  866



>ref|XP_003519843.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Glycine 
max]
Length=938

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVH--LDTLNASFSGHYISYV  372
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAVVVH  LD +NA+FSGHY+ YV
Sbjct  624  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDLDIMNAAFSGHYVCYV  683

Query  371  KDMQGNWFRIDDTKVK  324
            K++QG WFR DD++V+
Sbjct  684  KNIQGEWFRTDDSRVE  699



>ref|XP_004501631.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=1129

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LY VVVHLD +NASFSGHY+ Y+K+
Sbjct  799  QSGKFGKLNKPIQFPEILDLAPFMSGTSDKTPIYRLYGVVVHLDIMNASFSGHYVCYLKN  858

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  859  IQNKWFKVDDSVV  871



>ref|XP_010525922.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
 ref|XP_010525923.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
Length=603

 Score =   106 bits (264),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I+FPE LD+ PY +G  D   +YMLYAV+VHLD LNASF GHYI Y+KD
Sbjct  386  QGGRFGKLNKKISFPETLDLSPYSSGGGDSTDVYMLYAVIVHLDMLNASFFGHYICYIKD  445

Query  365  MQGNWFRIDDTKVK  324
             +GNW+RIDD++V+
Sbjct  446  FRGNWYRIDDSEVE  459



>ref|XP_009609184.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Nicotiana 
tomentosiformis]
Length=1175

 Score =   107 bits (267),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  847  QSGKFGKLNKTIKFPEILNLAPYMSGTRDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  906

Query  365  MQGNWFRIDDTKVK  324
             Q  WF+++D+ VK
Sbjct  907  FQNRWFKVNDSSVK  920



>emb|CBI18698.3| unnamed protein product [Vitis vinifera]
Length=669

 Score =   106 bits (264),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L++ PYM+GTDD  P+Y LYAVVVHLD +NA+FSGHY+ +VK+
Sbjct  577  QSSNFGKLNKSVRFPETLNLTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  636

Query  365  MQGNWFRIDDTKV  327
              G+WFRIDD+ V
Sbjct  637  FLGDWFRIDDSTV  649



>ref|XP_007047805.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91962.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
Length=941

 Score =   106 bits (265),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +  PE+LD+ PYM+GT D   +Y LYAVVVHLD +NA+FSGHY+ YVK 
Sbjct  642  QSGNFGKLNKSVQIPEVLDLAPYMSGTSDKAAVYNLYAVVVHLDVMNAAFSGHYVCYVKS  701

Query  365  MQGNWFRIDDTKV  327
              G WFRIDD+ V
Sbjct  702  FHGEWFRIDDSTV  714



>ref|XP_010928622.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Elaeis 
guineensis]
Length=928

 Score =   106 bits (265),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PYM+G  D   LY LYAVVVHLD LNASF GHY+ Y KD
Sbjct  394  QSGRFGKLNKRITFPENLDLTPYMSGNGDGTDLYSLYAVVVHLDMLNASFFGHYVCYTKD  453

Query  365  MQGNWFRIDDTKV  327
              G W+RIDD KV
Sbjct  454  YDGQWYRIDDCKV  466



>emb|CAN77546.1| hypothetical protein VITISV_025214 [Vitis vinifera]
Length=1043

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+  PYM+GTDD  P+Y LYAVVVHLD +NA+FSGHY+ +VK+
Sbjct  551  QSSNFGKLNKSVRFPETLNXTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  610

Query  365  MQGNWFRIDDTKV  327
              G+WFRIDD+ V
Sbjct  611  FLGDWFRIDDSTV  623



>ref|XP_008789702.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Phoenix 
dactylifera]
Length=892

 Score =   106 bits (264),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 60/92 (65%), Gaps = 11/92 (12%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PYM+G  D   LY LYAVVVHLD LNASF GHY+ Y KD
Sbjct  394  QSGRFGKLNKRITFPENLDLTPYMSGNGDGTDLYSLYAVVVHLDMLNASFFGHYVCYTKD  453

Query  365  MQGNWFRIDDTKV-----------KFYIKLYC  303
              G+W+RIDD KV             Y+ LYC
Sbjct  454  YHGHWYRIDDCKVLNVEVEEVLAQGAYMLLYC  485



>ref|XP_008378636.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Malus 
domestica]
Length=425

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  126  QSGKFGKINKPIRFPEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  185

Query  365  MQGNWFRIDDTKV  327
                WF++DD+ V
Sbjct  186  SHNKWFKVDDSTV  198



>ref|XP_002980323.1| hypothetical protein SELMODRAFT_420048 [Selaginella moellendorffii]
 gb|EFJ18583.1| hypothetical protein SELMODRAFT_420048 [Selaginella moellendorffii]
Length=924

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE L++ PYM+G  D PPLY LYAVVVH+D LNASF GHYI YV+D
Sbjct  445  QSGKFGKLNKRVTFPEALNISPYMSGEGDKPPLYRLYAVVVHVDMLNASFFGHYICYVRD  504

Query  365  MQGNWFRID--DTKVKFYIKLYCFCFSNCRGK  276
            M G W+++   DT+     K Y   +S    +
Sbjct  505  MTGTWYKVKEVDTEKVMSQKAYMLMYSRSSAR  536



>gb|EMT11184.1| Ubiquitin carboxyl-terminal hydrolase 16 [Aegilops tauschii]
Length=692

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE L++  YM+ TDD  P+Y LYAVVVH D +N+S SGHY+ YVKD
Sbjct  400  QSGMFGKINKAIRFPEYLNLSSYMSTTDDCSPVYRLYAVVVHRDVMNSSVSGHYVCYVKD  459

Query  365  MQGNWFRIDDTKVK  324
             QG W+ +DD++VK
Sbjct  460  SQGKWYEMDDSQVK  473



>ref|XP_003523774.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Glycine max]
Length=1063

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_006578260.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X3 [Glycine max]
Length=1080

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_004973705.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Setaria italica]
Length=978

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKINK I FPE L+M+ YM   TDD  P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  657  QSGKFGKINKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVK  716

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  717  DTQGKWFKADDSQVK  731



>gb|KHN08238.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1138

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_006578259.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Glycine max]
Length=1138

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_004973704.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Setaria italica]
Length=993

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKINK I FPE L+M+ YM   TDD  P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKINKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>emb|CBI35523.3| unnamed protein product [Vitis vinifera]
Length=723

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+M PYM+GTDD  P+Y LYAVVVHLD +NA+FSGHY+ +VK+
Sbjct  576  QSSNFGKLNKSVRFPETLNMTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  635

Query  365  MQGNWFRIDD  336
              G+WFRIDD
Sbjct  636  FLGDWFRIDD  645



>ref|XP_011100001.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Sesamum 
indicum]
Length=868

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -2

Query  527  KINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKDMQGNWF  348
            K+NK + FPE+L++ PYM+G +D  P+Y LYAVVVHL  +NA++SGHY+SYVKD QG+WF
Sbjct  652  KLNKIVQFPEVLNLAPYMSGMNDKYPVYDLYAVVVHLGAMNAAYSGHYVSYVKDFQGDWF  711

Query  347  RIDDTKV  327
            RIDD++V
Sbjct  712  RIDDSRV  718



>ref|XP_003602929.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
 gb|AES73180.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1116

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ P+++GT D  P+Y LY VVVHLD +NASFSGHY+ Y+K+
Sbjct  796  QSGKFGKLNKPVQFPEILDLAPFVSGTSDKTPIYRLYGVVVHLDVMNASFSGHYVCYLKN  855

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  856  IQNKWFKVDDSVV  868



>gb|KEH35732.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1146

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ P+++GT D  P+Y LY VVVHLD +NASFSGHY+ Y+K+
Sbjct  826  QSGKFGKLNKPVQFPEILDLAPFVSGTSDKTPIYRLYGVVVHLDVMNASFSGHYVCYLKN  885

Query  365  MQGNWFRIDDTKV  327
            +Q  WF++DD+ V
Sbjct  886  IQNKWFKVDDSVV  898



>ref|XP_009376247.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1126

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+GT D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  818  QSGKFGKINKPIRFPEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  877

Query  365  MQGNWFRIDDTKV  327
                WF++DD+ V
Sbjct  878  SHNKWFKVDDSTV  890



>ref|XP_010266094.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=1113

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FP +LD+ PYM+ T+D  P+Y LYAVVVHLD +NA+FSGHY+ Y+K+
Sbjct  761  QSGKFGKLNKVVRFPRVLDLAPYMSTTNDKSPVYTLYAVVVHLDVMNAAFSGHYVCYIKN  820

Query  365  MQGNWFRIDDTKVK  324
             Q  W++IDD+ V+
Sbjct  821  FQEKWYKIDDSTVE  834



>gb|EPS72742.1| hypothetical protein M569_02015, partial [Genlisea aurea]
Length=404

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PY++G +D   +Y LYAV+VH+D LNASF GHYI Y+KD
Sbjct  295  QSGRFGKLNKRITFPETLDLRPYVSGLEDKNNIYKLYAVIVHVDMLNASFFGHYICYIKD  354

Query  365  MQGNWFRIDDTKV  327
             +GNW+R+DD KV
Sbjct  355  FRGNWYRVDDCKV  367



>ref|XP_007223115.1| hypothetical protein PRUPE_ppa005433mg [Prunus persica]
 gb|EMJ24314.1| hypothetical protein PRUPE_ppa005433mg [Prunus persica]
Length=461

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+ T D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  377  QSGRFGKINKRVTFPETLDLNPYMSETGDGANIYKLYAVVVHVDMLNASFFGHYICYTKD  436

Query  365  MQGNWFRIDDTKVK  324
              GNW+RIDD KV+
Sbjct  437  FGGNWYRIDDCKVR  450



>gb|EYU30946.1| hypothetical protein MIMGU_mgv1a004116mg [Erythranthe guttata]
Length=543

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G   K+NK + FPE+L++ PYM+GT+D  P+Y LYAVVVHL  + A++SGHY+SYVKD
Sbjct  324  RSGNLEKLNKLVQFPEVLNLSPYMSGTNDKYPVYHLYAVVVHLGVMGAAYSGHYVSYVKD  383

Query  365  MQGNWFRIDDTKV  327
            +QG+WFRIDD++V
Sbjct  384  LQGDWFRIDDSRV  396



>ref|XP_009396938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Musa 
acuminata subsp. malaccensis]
Length=902

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE L++ PYM+G+ D   LY LYAVVVH+D LNASF GHYI Y KD
Sbjct  401  QSGRFGKLNKRVTFPENLNLTPYMSGSSDGTDLYTLYAVVVHVDMLNASFFGHYICYTKD  460

Query  365  MQGNWFRIDDTKV  327
             QG W++IDD KV
Sbjct  461  YQGRWYKIDDCKV  473



>ref|XP_009401442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=857

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G YGK+NK + FPE L++  YM+G DD   +Y LYAV+VH D +NASFSGHY+ YVKD
Sbjct  538  QSGKYGKLNKAVRFPEYLNLAHYMSG-DDASSMYQLYAVIVHKDVMNASFSGHYVCYVKD  596

Query  365  MQGNWFRIDDTKVK  324
             QG W++IDD++VK
Sbjct  597  TQGKWYKIDDSEVK  610



>ref|NP_565576.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 sp|Q9SJA1.2|UBP19_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 19; AltName: 
Full=Deubiquitinating enzyme 19; Short=AtUBP19; AltName: 
Full=Ubiquitin thioesterase 19; AltName: Full=Ubiquitin-specific-processing 
protease 19 [Arabidopsis thaliana]
 gb|AAK26025.1|AF360315_1 putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAL07252.1| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAD23896.2| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AEC07607.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=672

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I+FPE  D+ PYM+G  +   +Y LYAV+VHLD LNASF GHYI YVKD
Sbjct  387  QGGRFGKLNKRISFPETFDLGPYMSGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKD  446

Query  365  MQGNWFRIDDTKVK  324
             +GNW+RIDD++V+
Sbjct  447  FRGNWYRIDDSEVE  460



>ref|XP_011044972.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=725

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFRIDDTKV  327
             +GNW RIDD+KV
Sbjct  454  FRGNWHRIDDSKV  466



>gb|KGN60255.1| hypothetical protein Csa_3G890110 [Cucumis sativus]
Length=978

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P++ GT D  P+Y LY VVVHLD +N+SFSGHY+ YVK+
Sbjct  750  QSGNFGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKN  809

Query  365  MQGNWFRIDDTKV  327
             +  WF+IDD+ V
Sbjct  810  AKNKWFKIDDSTV  822



>ref|XP_008466167.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
16-like [Cucumis melo]
Length=1030

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P++ GT D  P+Y LY VVVHLD +N+SFSGHY+ YVK+
Sbjct  749  QSGNFGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKN  808

Query  365  MQGNWFRIDDTKV  327
             +  WF+IDD+ V
Sbjct  809  AKNKWFKIDDSTV  821



>ref|XP_006355189.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Solanum 
tuberosum]
Length=782

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+ T D   +Y LYAV+VH+D LNASF GHYI Y+KD
Sbjct  376  QSGRFGKLNKRVTFPETLDLHPYMSETGDGNDIYKLYAVIVHVDMLNASFFGHYICYIKD  435

Query  365  MQGNWFRIDDTKV  327
             +G+W+RIDD KV
Sbjct  436  FRGSWYRIDDCKV  448



>ref|XP_003518257.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
Length=1036

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  718  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHLDIMNAAFSGHYVCYVKN  776

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  777  FQSRWFKVDDSVV  789



>ref|XP_003544242.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN25065.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1045

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY VVVHLD +NA+FSGHY+ YVK+
Sbjct  719  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHLDIMNAAFSGHYVCYVKN  777

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  778  FQSRWFKVDDSVV  790



>ref|XP_008377533.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Malus 
domestica]
Length=569

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  334  QSGRFGKINKRVTFPETLDLNPYMSEAGDGTNIYKLYAVVVHIDMLNASFFGHYICYTKD  393

Query  365  MQGNWFRIDDTKV  327
              GNW+RIDD KV
Sbjct  394  FSGNWYRIDDCKV  406



>ref|XP_010548553.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Tarenaya 
hassleriana]
Length=604

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GK+NK I+FPE LD+ PYM+ G  D   +Y LYAV+VHLD LNASF GHYI YVK
Sbjct  383  QGGRFGKLNKKISFPEKLDLSPYMSDGRGDGTDIYKLYAVIVHLDMLNASFFGHYICYVK  442

Query  368  DMQGNWFRIDDTKVK  324
            D++GNW+RIDD++V+
Sbjct  443  DLRGNWYRIDDSEVE  457



>ref|XP_009410122.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Musa 
acuminata subsp. malaccensis]
Length=1050

 Score =   103 bits (258),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE L++ PYM+G DD  P+Y LYAV+VH+D +NASFSGHY+ YVKD
Sbjct  727  QSGKFGKLNKDVRFPEYLNLAPYMSG-DDKSPVYRLYAVIVHIDVMNASFSGHYVCYVKD  785

Query  365  MQGNWFRIDDTKVK  324
             QG W+  +D++VK
Sbjct  786  TQGKWYETNDSEVK  799



>ref|XP_008220608.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Prunus 
mume]
Length=700

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+ T D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  377  QSGRFGKINKRVTFPETLDLNPYMSETGDGANIYKLYAVVVHVDMLNASFFGHYICYTKD  436

Query  365  MQGNWFRIDDTKV  327
              GNW+RIDD KV
Sbjct  437  FGGNWYRIDDCKV  449



>ref|XP_002308728.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
 gb|EEE92251.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
Length=633

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPEMLD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFRIDDTKV  327
              GNW RIDD KV
Sbjct  454  FHGNWHRIDDCKV  466



>ref|XP_002324377.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
 gb|EEF02942.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
Length=726

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFRIDDTKV  327
              GNW RIDD+KV
Sbjct  454  FHGNWHRIDDSKV  466



>gb|ACF84178.1| unknown [Zea mays]
 tpg|DAA48488.1| TPA: putative ubiquitin carboxyl-terminal hydrolase superfamily 
protein [Zea mays]
Length=370

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  69   QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  128

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  129  DTQGKWFKADDSQVK  143



>gb|KDP33469.1| hypothetical protein JCGZ_07040 [Jatropha curcas]
Length=703

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PY +   D   LY LYAVVVH+D LNASF GHYI YVKD
Sbjct  388  QSGRFGKLNKRVTFPETLDISPYTSEEGDGTDLYKLYAVVVHVDMLNASFFGHYICYVKD  447

Query  365  MQGNWFRIDDTKVK  324
             +GNW+R+DD KV+
Sbjct  448  FRGNWYRVDDCKVQ  461



>ref|XP_003527871.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN09020.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1125

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY VVVHLD +NASFSGHY+ YVK+
Sbjct  812  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDVMNASFSGHYVCYVKN  871

Query  365  MQGNWFRIDDTKV  327
            +Q  W ++DD+ V
Sbjct  872  IQNKWSKVDDSVV  884



>ref|XP_004498826.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Cicer 
arietinum]
Length=729

 Score =   103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE L++ PYM+   D   +Y LYAVVVH+D LNAS+ GHYI Y+KD
Sbjct  392  QSGKFGKLNKRVAFPETLNLSPYMSKAGDGSDIYKLYAVVVHIDMLNASYFGHYICYIKD  451

Query  365  MQGNWFRIDDTKV  327
             QGNW+RIDD+KV
Sbjct  452  FQGNWYRIDDSKV  464



>ref|XP_007011632.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 ref|XP_007011633.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 gb|EOY29251.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 gb|EOY29252.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
Length=727

 Score =   102 bits (255),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ++FPE LD+ PYM+   D   +Y LYAVVVHLD LNASF GHYI Y+KD
Sbjct  368  QSGRFGKLNKRVSFPETLDLTPYMSEDGDDSNVYKLYAVVVHLDMLNASFFGHYICYIKD  427

Query  365  MQGNWFRIDDTKV  327
              GNW+RIDD KV
Sbjct  428  FCGNWYRIDDCKV  440



>ref|XP_003615274.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=1050

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK I FPE+LD+ P+M+GT D+  +Y LY VVVHLDT+NA+FSGHY+ YVK+
Sbjct  754  RSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNAAFSGHYVGYVKN  812

Query  365  MQGNWFRIDDTKVK  324
             Q +WF++DD+ V+
Sbjct  813  FQNSWFKVDDSVVR  826



>gb|KHN26130.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1054

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY VVVH+D +NA+FSGHY+ YVK+
Sbjct  736  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHMDIMNAAFSGHYVCYVKN  794

Query  365  MQGNWFRIDDTKV  327
             Q  WF++DD+ V
Sbjct  795  FQSRWFKVDDSVV  807



>ref|XP_009373969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1050

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+ T D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  816  QSGKFGKINKPIRFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  875

Query  365  MQGNWFRIDDTKV  327
             Q  WF +DD+ V
Sbjct  876  SQNKWFMVDDSTV  888



>ref|XP_009363067.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Pyrus 
x bretschneideri]
Length=716

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNAS+ GHYI Y KD
Sbjct  390  QSGRFGKINKRVTFPETLDLNPYMSEAGDSTNIYKLYAVVVHIDMLNASYFGHYICYTKD  449

Query  365  MQGNWFRIDDTKV  327
              GNW++IDD+KV
Sbjct  450  FSGNWYKIDDSKV  462



>tpg|DAA48490.1| TPA: putative ubiquitin carboxyl-terminal hydrolase superfamily 
protein [Zea mays]
Length=973

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>ref|NP_001189593.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 dbj|BAH57217.1| AT2G24640 [Arabidopsis thaliana]
 gb|AEC07608.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=502

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I+FPE  D+ PYM+G  +   +Y LYAV+VHLD LNASF GHYI YVKD
Sbjct  217  QGGRFGKLNKRISFPETFDLGPYMSGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKD  276

Query  365  MQGNWFRIDDTKVK  324
             +GNW+RIDD++V+
Sbjct  277  FRGNWYRIDDSEVE  290



>ref|XP_008352731.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Malus 
domestica]
Length=266

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+ T D  P+Y LY VVVHLD +N++FSGHY+ YV++
Sbjct  32   QSGKFGKINKPIRFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNSAFSGHYVCYVRN  91

Query  365  MQGNWFRIDDTKV  327
             Q  WF +DD+ V
Sbjct  92   SQNKWFMVDDSTV  104



>ref|XP_008664540.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
17-like [Zea mays]
Length=998

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>ref|XP_008452810.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Cucumis 
melo]
Length=718

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y+KD
Sbjct  402  QSGRFGKLNKKVTFPETLDLSPYMSEAGDRMDVYRLYAVVVHVDMLNASFFGHYICYIKD  461

Query  365  MQGNWFRIDDTKV  327
              GNW+RIDD KV
Sbjct  462  FSGNWYRIDDCKV  474



>ref|XP_010060095.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Eucalyptus 
grandis]
 gb|KCW66624.1| hypothetical protein EUGRSUZ_F00414 [Eucalyptus grandis]
Length=1065

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY++GT D  P+Y LY V+VHLD +NA+ SGHY+ YVK+
Sbjct  742  QSGKFGKLNKLIRFPEILNLAPYISGTSDKSPIYRLYGVIVHLDVMNAAVSGHYVCYVKN  801

Query  365  MQGNWFRIDDTKV  327
             Q  WF+IDD+ V
Sbjct  802  PQNKWFKIDDSTV  814



>ref|XP_008359211.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Malus 
domestica]
Length=839

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  533  YGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKDMQGN  354
            + K+NK I FPE+L+M PYM  T D  PLY LYAVVVHLD +NA++SGHY+ YVK+ QG 
Sbjct  584  FEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVHLDIMNAAYSGHYVCYVKNNQGE  643

Query  353  WFRIDDTKVK  324
            WF+IDD+ V+
Sbjct  644  WFKIDDSSVE  653



>ref|XP_008385675.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Malus domestica]
Length=839

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  533  YGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKDMQGN  354
            + K+NK I FPE+L+M PYM  T D  PLY LYAVVVHLD +NA++SGHY+ YVK+ QG 
Sbjct  584  FEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVHLDIMNAAYSGHYVCYVKNNQGE  643

Query  353  WFRIDDTKVK  324
            WF+IDD+ V+
Sbjct  644  WFKIDDSSVE  653



>gb|KEH39885.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=831

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE L++ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y+KD
Sbjct  394  QSGRFGKLNKRVAFPETLNLSPYMSEAGDGSDIYNLYAVVVHIDMLNASFFGHYICYIKD  453

Query  365  MQGNWFRIDDTKV  327
             +GNW+RIDD+KV
Sbjct  454  FRGNWYRIDDSKV  466



>ref|XP_006483493.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X2 [Citrus sinensis]
Length=713

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI YVKD
Sbjct  393  QSGRFGKLNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKD  452

Query  365  MQGNWFRIDDTKV  327
             +G+W+R+DD KV
Sbjct  453  FRGHWYRVDDCKV  465



>gb|KHG26104.1| Ubiquitin carboxyl-terminal hydrolase 17 [Gossypium arboreum]
Length=960

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ PYM+G+     +Y LYAVVVHLD ++ +FSGHY+ YVK+
Sbjct  673  QSGNFGKLNKSVQFPEVLDLAPYMSGSSSKAVIYNLYAVVVHLDVMDTAFSGHYVCYVKN  732

Query  365  MQGNWFRIDDTKV  327
             +G WFRIDD+ V
Sbjct  733  FRGEWFRIDDSTV  745



>gb|AES98232.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1048

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK I FPE+LD+ P+M+GT D+  +Y LY VVVHLDT+NA+FSGHY+ YVK+
Sbjct  754  RSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNAAFSGHYVGYVKN  812

Query  365  MQGNWFRIDDTKV  327
             Q +WF++DD+ V
Sbjct  813  FQNSWFKVDDSVV  825



>gb|KHG26103.1| Ubiquitin carboxyl-terminal hydrolase 17 [Gossypium arboreum]
Length=992

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ PYM+G+     +Y LYAVVVHLD ++ +FSGHY+ YVK+
Sbjct  705  QSGNFGKLNKSVQFPEVLDLAPYMSGSSSKAVIYNLYAVVVHLDVMDTAFSGHYVCYVKN  764

Query  365  MQGNWFRIDDTKV  327
             +G WFRIDD+ V
Sbjct  765  FRGEWFRIDDSTV  777



>gb|KDO60602.1| hypothetical protein CISIN_1g039539mg [Citrus sinensis]
Length=484

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE+L+M PYM+ T D  P+Y LYAVVVHLD  NA+FSGHY+ YVK+
Sbjct  173  ESGNFGKLNKSVWFPEVLNMAPYMSRTGDGSPMYSLYAVVVHLDVTNATFSGHYVCYVKN  232

Query  365  MQGNWFRIDDTKV  327
                WFRIDD+ V
Sbjct  233  SHEEWFRIDDSTV  245



>gb|KDO67336.1| hypothetical protein CISIN_1g004724mg [Citrus sinensis]
Length=733

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI YVKD
Sbjct  393  QSGRFGKLNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKD  452

Query  365  MQGNWFRIDDTKV  327
             +G+W+R+DD KV
Sbjct  453  FRGHWYRVDDCKV  465



>gb|ACF83022.1| unknown [Zea mays]
Length=495

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAVVVH D +NA+FSGHY+ YVK
Sbjct  194  QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  253

Query  368  DMQGNWFRIDDTKVK  324
            D QG WF+ DD++VK
Sbjct  254  DTQGKWFKADDSQVK  268



>ref|XP_004245303.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Solanum 
lycopersicum]
Length=777

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+ T D   +Y LYAV+VH+D LNASF GHYI Y+KD
Sbjct  376  QSGRFGKLNKRVTFPETLDLHPYMSETGDGNDIYKLYAVIVHVDMLNASFFGHYICYIKD  435

Query  365  MQGNWFRIDDTKV  327
             +G+W RIDD KV
Sbjct  436  FRGSWHRIDDCKV  448



>ref|XP_011074220.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Sesamum 
indicum]
 ref|XP_011074221.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Sesamum 
indicum]
Length=1033

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+L++ PYM+GT D  P+Y LY +VVHLD +N++ SGHY+ Y+K+
Sbjct  793  QLGTFGKLNKAVKFPEVLNLAPYMSGTSDKCPIYQLYGIVVHLDVMNSAVSGHYVCYIKN  852

Query  365  MQGNWFRIDDTKVK  324
             +G WF+ DD+ V+
Sbjct  853  NEGRWFKADDSMVR  866



>ref|NP_001063411.2| Os09g0464400 [Oryza sativa Japonica Group]
 dbj|BAF25325.2| Os09g0464400 [Oryza sativa Japonica Group]
Length=918

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAVVVH D +NA+FSGHY+ YVKD
Sbjct  607  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  666

Query  365  MQGNWFRIDDTKVK  324
             QG W ++DD++VK
Sbjct  667  TQGKWHKMDDSQVK  680



>gb|EEC84719.1| hypothetical protein OsI_31685 [Oryza sativa Indica Group]
Length=927

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAVVVH D +NA+FSGHY+ YVKD
Sbjct  594  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  653

Query  365  MQGNWFRIDDTKVK  324
             QG W ++DD++VK
Sbjct  654  TQGKWHKMDDSQVK  667



>ref|XP_003523663.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like isoform 
X1 [Glycine max]
 ref|XP_006578106.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like isoform 
X2 [Glycine max]
Length=742

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI Y+KD
Sbjct  391  QSGRFGKLNKRVTFPETLDLSPYMSEVGDGSDIYKLYAVVVHIDMLNASFFGHYICYIKD  450

Query  365  MQGNWFRIDDTKV  327
              GNW+RIDD KV
Sbjct  451  FCGNWYRIDDWKV  463



>dbj|BAD33960.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
 gb|EEE69864.1| hypothetical protein OsJ_29670 [Oryza sativa Japonica Group]
Length=940

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAVVVH D +NA+FSGHY+ YVKD
Sbjct  607  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  666

Query  365  MQGNWFRIDDTKVK  324
             QG W ++DD++VK
Sbjct  667  TQGKWHKMDDSQVK  680



>ref|XP_006466293.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Citrus sinensis]
Length=904

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE+L+M PYM+ T D  P+Y LYAVVVHLD  NA+FSGHY+ YVK+
Sbjct  593  ESGNFGKLNKSVWFPEVLNMAPYMSRTGDGSPMYSLYAVVVHLDVTNATFSGHYVCYVKN  652

Query  365  MQGNWFRIDDTKV  327
                WFRIDD+ V
Sbjct  653  SHEEWFRIDDSTV  665



>gb|KJB18261.1| hypothetical protein B456_003G043300 [Gossypium raimondii]
Length=724

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ PYM+G+     +Y LYAVVVHLD ++ +FSGHY+ YVK 
Sbjct  632  QSGNFGKLNKSVQFPEVLDLAPYMSGSSSKAVIYNLYAVVVHLDVMDTAFSGHYVCYVKS  691

Query  365  MQGNWFRIDDTKV  327
             +G WFRIDD+ V
Sbjct  692  FRGEWFRIDDSTV  704



>ref|XP_003545417.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Glycine 
max]
Length=729

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I+FPE L++ PYM+   D   +Y LY VVVH+D LNASF GHYI Y+KD
Sbjct  396  QSGRFGKLNKRISFPETLNLSPYMSEAGDGSDIYKLYGVVVHIDMLNASFFGHYICYIKD  455

Query  365  MQGNWFRIDDTKVKF-----------YIKLYCFCFSNCRG-KIQT  267
             QGNW+RIDD KV             Y+ LY  C +   G +IQT
Sbjct  456  FQGNWYRIDDWKVMTVEVEEVLSQGAYMLLYSRCSARPSGLQIQT  500



>ref|XP_011031394.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=633

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPEMLD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVAVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFRIDDTKV  327
              GNW RIDD KV
Sbjct  454  FHGNWHRIDDCKV  466



>ref|XP_010675222.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Beta vulgaris 
subsp. vulgaris]
Length=1084

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM G  D  P+Y LY VVVHLD +NA+FSGHY+ YV++
Sbjct  756  QSGKFGKLNKTIRFPEILNLAPYMRGGSDKTPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  815

Query  365  MQGNWFRIDDTKVK  324
                W++IDD+ VK
Sbjct  816  AHNKWYKIDDSTVK  829



>ref|XP_006483492.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X1 [Citrus sinensis]
Length=733

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  545  QCGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVVVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAVVVH+D LNASF GHYI YVKD
Sbjct  393  QSGRFGKLNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKD  452

Query  365  MQGNWFRIDDTKV  327
             +G+W+R+DD KV
Sbjct  453  FRGHWYRVDDCKV  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840