BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007C07 658 bp,

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10566.1|  unnamed protein product                                328   3e-107   Coffea canephora [robusta coffee]
ref|XP_009595093.1|  PREDICTED: fasciclin-like arabinogalactan pr...    327   6e-107   Nicotiana tomentosiformis
ref|XP_009783700.1|  PREDICTED: fasciclin-like arabinogalactan pr...    327   6e-107   Nicotiana sylvestris
ref|XP_004249393.1|  PREDICTED: fasciclin-like arabinogalactan pr...    324   8e-106   Solanum lycopersicum
gb|KDP36078.1|  hypothetical protein JCGZ_08722                         323   2e-105   Jatropha curcas
ref|XP_011077777.1|  PREDICTED: fasciclin-like arabinogalactan pr...    323   2e-105   Sesamum indicum [beniseed]
ref|XP_006339181.1|  PREDICTED: fasciclin-like arabinogalactan pr...    323   2e-105   Solanum tuberosum [potatoes]
ref|XP_011094205.1|  PREDICTED: fasciclin-like arabinogalactan pr...    323   2e-105   Sesamum indicum [beniseed]
ref|XP_009794483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    322   3e-105   Nicotiana sylvestris
ref|XP_009587619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    322   4e-105   Nicotiana tomentosiformis
ref|XP_002524094.1|  conserved hypothetical protein                     322   6e-105   Ricinus communis
ref|XP_010263095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    320   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_004303393.1|  PREDICTED: fasciclin-like arabinogalactan pr...    318   1e-103   Fragaria vesca subsp. vesca
ref|XP_010110455.1|  hypothetical protein L484_006448                   318   2e-103   Morus notabilis
ref|XP_011042549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    318   2e-103   Populus euphratica
ref|XP_002270321.1|  PREDICTED: fasciclin-like arabinogalactan pr...    317   5e-103   Vitis vinifera
ref|XP_002322769.2|  hypothetical protein POPTR_0016s06680g             317   6e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010516793.1|  PREDICTED: fasciclin-like arabinogalactan pr...    316   7e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002879581.1|  predicted protein                                  316   8e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_010543842.1|  PREDICTED: fasciclin-like arabinogalactan pr...    317   8e-103   Tarenaya hassleriana [spider flower]
ref|XP_010509549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    316   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002270606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    316   2e-102   Vitis vinifera
gb|EYU18152.1|  hypothetical protein MIMGU_mgv1a003573mg                319   2e-102   Erythranthe guttata [common monkey flower]
gb|EYU38707.1|  hypothetical protein MIMGU_mgv1a006053mg                315   2e-102   Erythranthe guttata [common monkey flower]
gb|AGN92422.1|  putative fasciclin-like arabinogalactan protein 2       315   3e-102   Centaurium erythraea
ref|XP_006294220.1|  hypothetical protein CARUB_v10023217mg             314   3e-102   Capsella rubella
emb|CDY23209.1|  BnaA04g05500D                                          314   3e-102   Brassica napus [oilseed rape]
ref|XP_009139464.1|  PREDICTED: fasciclin-like arabinogalactan pr...    314   4e-102   Brassica rapa
ref|XP_006348432.1|  PREDICTED: fasciclin-like arabinogalactan pr...    314   4e-102   Solanum tuberosum [potatoes]
ref|NP_850253.1|  fasciclin-like arabinogalactan protein 16             314   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204352.1|  hypothetical protein PRUPE_ppa005721mg             314   4e-102   Prunus persica
ref|XP_010938934.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    315   5e-102   Elaeis guineensis
emb|CDX95333.1|  BnaC04g28250D                                          313   6e-102   Brassica napus [oilseed rape]
ref|XP_008803482.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    314   7e-102   Phoenix dactylifera
ref|XP_006291159.1|  hypothetical protein CARUB_v10017276mg             313   7e-102   Capsella rubella
gb|AAD21471.1|  unknown protein                                         314   8e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505110.1|  PREDICTED: fasciclin-like arabinogalactan pr...    315   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_004228680.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   9e-102   Solanum lycopersicum
ref|XP_008442961.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   1e-101   Cucumis melo [Oriental melon]
gb|KFK36481.1|  hypothetical protein AALP_AA4G130300                    313   1e-101   Arabis alpina [alpine rockcress]
ref|XP_011047143.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   1e-101   Populus euphratica
ref|NP_190805.1|  fasciclin-like arabinogalactan protein 15             312   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534382.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   2e-101   Tarenaya hassleriana [spider flower]
ref|XP_008798695.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   2e-101   Phoenix dactylifera
ref|XP_006410756.1|  hypothetical protein EUTSA_v10016656mg             312   2e-101   Eutrema salsugineum
ref|XP_004136532.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   2e-101   Cucumis sativus [cucumbers]
ref|XP_004167872.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   3e-101   
ref|XP_008241098.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   3e-101   Prunus mume [ume]
emb|CDX79631.1|  BnaC03g19670D                                          312   4e-101   Brassica napus [oilseed rape]
ref|XP_010557991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    312   4e-101   Tarenaya hassleriana [spider flower]
ref|XP_006481636.1|  PREDICTED: fasciclin-like arabinogalactan pr...    311   4e-101   Citrus sinensis [Valencia orange]
ref|XP_006430020.1|  hypothetical protein CICLE_v10011703mg             311   4e-101   Citrus clementina
ref|XP_010045160.1|  PREDICTED: fasciclin-like arabinogalactan pr...    313   4e-101   Eucalyptus grandis [rose gum]
ref|XP_002309262.1|  hypothetical protein POPTR_0006s21460g             312   5e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009387789.1|  PREDICTED: fasciclin-like arabinogalactan pr...    312   6e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403811.1|  hypothetical protein EUTSA_v10010381mg             311   8e-101   Eutrema salsugineum
ref|XP_002876139.1|  beta-Ig-H3 domain-containing protein               310   1e-100   Arabidopsis lyrata subsp. lyrata
emb|CDY32082.1|  BnaC04g44840D                                          310   1e-100   Brassica napus [oilseed rape]
emb|CDX84594.1|  BnaA03g16360D                                          310   1e-100   Brassica napus [oilseed rape]
ref|XP_010515698.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   1e-100   Camelina sativa [gold-of-pleasure]
emb|CDY40429.1|  BnaA04g20880D                                          310   1e-100   Brassica napus [oilseed rape]
ref|XP_009133050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   1e-100   Brassica rapa
ref|XP_004154697.1|  PREDICTED: fasciclin-like arabinogalactan pr...    308   2e-100   
ref|XP_010248022.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010553413.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   2e-100   Tarenaya hassleriana [spider flower]
gb|KFK34484.1|  hypothetical protein AALP_AA5G151600                    309   2e-100   Arabis alpina [alpine rockcress]
ref|XP_009388984.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    309   3e-100   Brassica rapa
gb|KEH29726.1|  fasciclin-like arabinogalactan protein 16 precursor     310   4e-100   Medicago truncatula
ref|XP_010525828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    310   4e-100   Tarenaya hassleriana [spider flower]
ref|XP_009362660.1|  PREDICTED: fasciclin-like arabinogalactan pr...    309   4e-100   Pyrus x bretschneideri [bai li]
ref|XP_010503981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    308   5e-100   Camelina sativa [gold-of-pleasure]
ref|XP_004139069.1|  PREDICTED: fasciclin-like arabinogalactan pr...    309   6e-100   
ref|XP_009348615.1|  PREDICTED: fasciclin-like arabinogalactan pr...    309   6e-100   Pyrus x bretschneideri [bai li]
ref|XP_007028043.1|  FASCICLIN-like arabinogalactan protein 17 pr...    309   9e-100   Theobroma cacao [chocolate]
gb|KJB36232.1|  hypothetical protein B456_006G147500                    308   9e-100   Gossypium raimondii
gb|KHG03559.1|  Fasciclin-like arabinogalactan protein 17               308   1e-99    Gossypium arboreum [tree cotton]
ref|XP_010426853.1|  PREDICTED: fasciclin-like arabinogalactan pr...    308   1e-99    Camelina sativa [gold-of-pleasure]
gb|KJB36230.1|  hypothetical protein B456_006G147500                    308   1e-99    Gossypium raimondii
ref|XP_002463768.1|  hypothetical protein SORBIDRAFT_01g005770          309   1e-99    Sorghum bicolor [broomcorn]
ref|NP_001130335.1|  uncharacterized protein LOC100191430 precursor     308   1e-99    Zea mays [maize]
gb|KCW90413.1|  hypothetical protein EUGRSUZ_A02551                     308   2e-99    Eucalyptus grandis [rose gum]
ref|XP_002315410.2|  hypothetical protein POPTR_0010s25110g             307   2e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010058812.1|  PREDICTED: fasciclin-like arabinogalactan pr...    307   3e-99    Eucalyptus grandis [rose gum]
gb|KCW90412.1|  hypothetical protein EUGRSUZ_A02551                     307   3e-99    Eucalyptus grandis [rose gum]
ref|XP_008387142.1|  PREDICTED: fasciclin-like arabinogalactan pr...    307   3e-99    Malus domestica [apple tree]
ref|XP_008450315.1|  PREDICTED: fasciclin-like arabinogalactan pr...    307   4e-99    Cucumis melo [Oriental melon]
ref|XP_003559349.1|  PREDICTED: fasciclin-like arabinogalactan pr...    307   6e-99    Brachypodium distachyon [annual false brome]
gb|KDO48671.1|  hypothetical protein CISIN_1g013434mg                   306   7e-99    Citrus sinensis [Valencia orange]
ref|XP_006445815.1|  hypothetical protein CICLE_v10015097mg             306   9e-99    Citrus clementina
gb|EPS67882.1|  hypothetical protein M569_06891                         306   1e-98    Genlisea aurea
ref|XP_011032963.1|  PREDICTED: fasciclin-like arabinogalactan pr...    306   1e-98    Populus euphratica
ref|XP_011024125.1|  PREDICTED: fasciclin-like arabinogalactan pr...    305   2e-98    Populus euphratica
gb|ABI95416.1|  fasciclin-like protein FLA26                            305   2e-98    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003521503.1|  PREDICTED: fasciclin-like arabinogalactan pr...    305   2e-98    Glycine max [soybeans]
gb|KEH24284.1|  fasciclin-like arabinogalactan protein 16 precursor     304   3e-98    Medicago truncatula
ref|XP_004506247.1|  PREDICTED: fasciclin-like arabinogalactan pr...    305   3e-98    Cicer arietinum [garbanzo]
ref|XP_004494272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    304   3e-98    
ref|XP_007010508.1|  FASCICLIN-like arabinogalactan protein 16 pr...    304   6e-98    Theobroma cacao [chocolate]
ref|XP_004494271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    304   6e-98    
gb|ABV27486.1|  fasciclin-like arabinogalactan protein 15               303   9e-98    Gossypium hirsutum [American cotton]
gb|ABV27485.1|  fasciclin-like arabinogalactan protein 14               303   9e-98    Gossypium hirsutum [American cotton]
ref|XP_006379436.1|  hypothetical protein POPTR_0008s013101g            303   9e-98    Populus trichocarpa [western balsam poplar]
gb|KHG10334.1|  Fasciclin-like arabinogalactan protein 17               303   1e-97    Gossypium arboreum [tree cotton]
ref|XP_006379435.1|  hypothetical protein POPTR_0008s013101g            303   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_003554480.1|  PREDICTED: fasciclin-like arabinogalactan pr...    303   1e-97    Glycine max [soybeans]
ref|XP_009130939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    303   1e-97    Brassica rapa
ref|XP_006287712.1|  hypothetical protein CARUB_v10000921mg             303   2e-97    Capsella rubella
gb|ABI95417.1|  fasciclin-like protein FLA27                            303   2e-97    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008392004.1|  PREDICTED: fasciclin-like arabinogalactan pr...    302   2e-97    Malus domestica [apple tree]
gb|ACG39696.1|  fasciclin domain                                        303   2e-97    Zea mays [maize]
ref|XP_009122246.1|  PREDICTED: fasciclin-like arabinogalactan pr...    302   2e-97    Brassica rapa
gb|KJB73326.1|  hypothetical protein B456_011G228300                    304   3e-97    Gossypium raimondii
emb|CDX81004.1|  BnaC03g02580D                                          303   4e-97    Brassica napus [oilseed rape]
tpg|DAA51813.1|  TPA: LOW QUALITY PROTEIN: fasciclin domain protein     302   4e-97    Zea mays [maize]
ref|XP_004955500.1|  PREDICTED: fasciclin-like arabinogalactan pr...    303   4e-97    Setaria italica
ref|NP_001051504.1|  Os03g0788600                                       302   5e-97    
ref|XP_004296276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    301   6e-97    Fragaria vesca subsp. vesca
ref|NP_196257.2|  fasciclin-like arabinogalactan protein 17 precu...    301   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001159324.1|  uncharacterized protein LOC100304417 precursor     301   6e-97    Zea mays [maize]
dbj|BAJ97817.1|  predicted protein                                      301   7e-97    Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ98684.1|  predicted protein                                      301   7e-97    Hordeum vulgare subsp. vulgare [barley]
gb|ABI95415.1|  fasciclin-like protein FLA25                            301   9e-97    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010423345.1|  PREDICTED: fasciclin-like arabinogalactan pr...    301   1e-96    Camelina sativa [gold-of-pleasure]
gb|ABV27487.1|  fasciclin-like arabinogalactan protein 16               301   1e-96    Gossypium hirsutum [American cotton]
dbj|BAB08961.1|  unnamed protein product                                301   1e-96    Arabidopsis thaliana [mouse-ear cress]
gb|KHG00930.1|  Fasciclin-like arabinogalactan protein 17               300   1e-96    Gossypium arboreum [tree cotton]
dbj|BAE71191.1|  hypothetical protein                                   300   1e-96    Trifolium pratense [peavine clover]
emb|CDX98919.1|  BnaC09g49160D                                          300   1e-96    Brassica napus [oilseed rape]
emb|CDY55758.1|  BnaA03g55350D                                          300   1e-96    Brassica napus [oilseed rape]
gb|KJB78512.1|  hypothetical protein B456_013G003200                    300   2e-96    Gossypium raimondii
ref|XP_010452564.1|  PREDICTED: fasciclin-like arabinogalactan pr...    300   2e-96    Camelina sativa [gold-of-pleasure]
emb|CDY57989.1|  BnaA10g30360D                                          300   2e-96    Brassica napus [oilseed rape]
ref|XP_004981498.1|  PREDICTED: fasciclin-like arabinogalactan pr...    300   2e-96    Setaria italica
ref|XP_009399002.1|  PREDICTED: fasciclin-like arabinogalactan pr...    300   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399110.1|  hypothetical protein EUTSA_v10013481mg             299   3e-96    Eutrema salsugineum
ref|XP_003557575.1|  PREDICTED: fasciclin-like arabinogalactan pr...    300   4e-96    Brachypodium distachyon [annual false brome]
ref|XP_006399111.1|  hypothetical protein EUTSA_v10013481mg             299   5e-96    Eutrema salsugineum
gb|EAZ38767.1|  hypothetical protein OsJ_23169                          298   7e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058941.1|  Os07g0160600                                       299   9e-96    
gb|EEC81554.1|  hypothetical protein OsI_24980                          299   1e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_010491197.1|  PREDICTED: fasciclin-like arabinogalactan pr...    298   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002871217.1|  beta-Ig-H3 domain-containing protein               297   3e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_009121226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    297   4e-95    Brassica rapa
ref|XP_007132513.1|  hypothetical protein PHAVU_011G100600g             296   4e-95    Phaseolus vulgaris [French bean]
ref|XP_003543398.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   6e-95    Glycine max [soybeans]
ref|XP_006297639.1|  hypothetical protein CARUB_v10013670mg             296   7e-95    Capsella rubella
ref|XP_010486838.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006592365.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   8e-95    Glycine max [soybeans]
ref|XP_010464900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010497995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010685474.1|  PREDICTED: fasciclin-like arabinogalactan pr...    295   2e-94    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KDP42957.1|  hypothetical protein JCGZ_23899                         295   2e-94    Jatropha curcas
ref|XP_003527510.1|  PREDICTED: fasciclin-like arabinogalactan pr...    295   2e-94    Glycine max [soybeans]
ref|XP_006407421.1|  hypothetical protein EUTSA_v10020679mg             295   2e-94    Eutrema salsugineum
emb|CDY08502.1|  BnaA05g27380D                                          295   2e-94    Brassica napus [oilseed rape]
ref|XP_002882744.1|  beta-Ig-H3 domain-containing protein               295   3e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_003540278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    294   3e-94    Glycine max [soybeans]
ref|XP_007150000.1|  hypothetical protein PHAVU_005G117500g             294   4e-94    Phaseolus vulgaris [French bean]
ref|XP_006826417.1|  hypothetical protein AMTR_s00004p00159330          294   4e-94    Amborella trichopoda
gb|AAF02137.1|AC009918_9  unknown protein                               292   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566398.1|  FASCICLIN-like arabinogalactan protein 18 precu...    293   1e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDY01050.1|  BnaC05g41500D                                          292   2e-93    Brassica napus [oilseed rape]
ref|XP_009146690.1|  PREDICTED: fasciclin-like arabinogalactan pr...    290   1e-92    Brassica rapa
ref|XP_002515862.1|  conserved hypothetical protein                     284   4e-90    Ricinus communis
ref|XP_010090522.1|  hypothetical protein L484_017146                   283   8e-90    Morus notabilis
ref|XP_002461483.1|  hypothetical protein SORBIDRAFT_02g003410          283   1e-89    Sorghum bicolor [broomcorn]
ref|XP_007163001.1|  hypothetical protein PHAVU_001G197900g             277   8e-88    Phaseolus vulgaris [French bean]
ref|XP_010677585.1|  PREDICTED: fasciclin-like arabinogalactan pr...    273   3e-86    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004487436.1|  PREDICTED: fasciclin-like arabinogalactan pr...    273   8e-86    Cicer arietinum [garbanzo]
gb|AAT75258.1|  expressed protein                                       273   8e-86    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051505.1|  Os03g0788700                                       273   2e-85    
gb|AAO24903.1|  putative arabinogalactan-protein                        273   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EAY92117.1|  hypothetical protein OsI_13824                          272   4e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_011076879.1|  PREDICTED: fasciclin-like arabinogalactan pr...    271   4e-85    Sesamum indicum [beniseed]
ref|XP_006651891.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    270   8e-85    
ref|XP_010685475.1|  PREDICTED: fasciclin-like arabinogalactan pr...    266   3e-83    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003596932.1|  Fasciclin-like arabinogalactan protein             265   8e-83    Medicago truncatula
ref|XP_006487826.1|  PREDICTED: fasciclin-like arabinogalactan pr...    262   1e-81    Citrus sinensis [Valencia orange]
ref|XP_010917919.1|  PREDICTED: fasciclin-like arabinogalactan pr...    264   2e-81    Elaeis guineensis
ref|XP_008790162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    263   4e-81    Phoenix dactylifera
gb|KJB73327.1|  hypothetical protein B456_011G228300                    258   2e-80    Gossypium raimondii
ref|XP_010908912.1|  PREDICTED: fasciclin-like arabinogalactan pr...    255   1e-79    Elaeis guineensis
gb|EPS68119.1|  hypothetical protein M569_06649                         244   6e-76    Genlisea aurea
gb|ABK25415.1|  unknown                                                 246   2e-75    Picea sitchensis
gb|AEN82905.1|  AT5G06390-like protein                                  231   4e-73    Capsella rubella
gb|AEN82899.1|  AT5G06390-like protein                                  231   4e-73    Capsella grandiflora
ref|XP_006424052.1|  hypothetical protein CICLE_v10030024mg             238   2e-72    Citrus clementina
gb|EYU19863.1|  hypothetical protein MIMGU_mgv1a006599mg                232   3e-70    Erythranthe guttata [common monkey flower]
ref|XP_006388929.1|  hypothetical protein POPTR_0073s00210g             230   3e-70    Populus trichocarpa [western balsam poplar]
ref|XP_006388223.1|  hypothetical protein POPTR_0276s00200g             225   2e-69    Populus trichocarpa [western balsam poplar]
emb|CDY47922.1|  BnaAnng09540D                                          223   2e-69    Brassica napus [oilseed rape]
ref|XP_006651890.1|  PREDICTED: fasciclin-like arabinogalactan pr...    222   8e-67    Oryza brachyantha
gb|KDO48944.1|  hypothetical protein CISIN_1g043668mg                   221   2e-66    Citrus sinensis [Valencia orange]
ref|XP_006658293.1|  PREDICTED: fasciclin-like arabinogalactan pr...    217   1e-64    
ref|XP_010516833.1|  PREDICTED: fasciclin-like arabinogalactan pr...    211   3e-63    Camelina sativa [gold-of-pleasure]
gb|KJB36231.1|  hypothetical protein B456_006G147500                    210   5e-63    Gossypium raimondii
ref|XP_002448333.1|  hypothetical protein SORBIDRAFT_06g025350          204   2e-61    Sorghum bicolor [broomcorn]
ref|XP_002444260.1|  hypothetical protein SORBIDRAFT_07g019123          200   4e-61    Sorghum bicolor [broomcorn]
gb|KHN36515.1|  Fasciclin-like arabinogalactan protein 16               201   4e-59    Glycine soja [wild soybean]
tpg|DAA51812.1|  TPA: hypothetical protein ZEAMMB73_870378              200   6e-59    Zea mays [maize]
ref|XP_006495395.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   3e-58    Citrus sinensis [Valencia orange]
emb|CBI39116.3|  unnamed protein product                                188   2e-56    Vitis vinifera
ref|XP_006487827.1|  PREDICTED: fasciclin-like arabinogalactan pr...    171   2e-49    
gb|ABK25995.1|  unknown                                                 163   1e-46    Picea sitchensis
gb|KHN17997.1|  Fasciclin-like arabinogalactan protein 16               159   2e-45    Glycine soja [wild soybean]
ref|XP_002974338.1|  hypothetical protein SELMODRAFT_54466              165   3e-45    Selaginella moellendorffii
ref|XP_002990854.1|  hypothetical protein SELMODRAFT_44414              163   2e-44    Selaginella moellendorffii
gb|ACF84712.1|  unknown                                                 156   4e-44    Zea mays [maize]
gb|KHN43596.1|  Fasciclin-like arabinogalactan protein 15               152   6e-41    Glycine soja [wild soybean]
gb|KHN41248.1|  Fasciclin-like arabinogalactan protein 16               150   9e-41    Glycine soja [wild soybean]
ref|XP_002454878.1|  hypothetical protein SORBIDRAFT_03g000685          142   1e-38    Sorghum bicolor [broomcorn]
dbj|BAH20344.1|  AT3G52370                                              138   2e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001784356.1|  predicted protein                                  144   3e-37    Physcomitrella patens
gb|KDO70682.1|  hypothetical protein CISIN_1g019153mg                   125   9e-37    Citrus sinensis [Valencia orange]
ref|XP_010495088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   6e-35    Camelina sativa [gold-of-pleasure]
emb|CBI39118.3|  unnamed protein product                                130   1e-33    Vitis vinifera
ref|XP_002992031.1|  hypothetical protein SELMODRAFT_23020              133   2e-33    Selaginella moellendorffii
ref|XP_001766851.1|  predicted protein                                  132   7e-33    Physcomitrella patens
ref|XP_002964493.1|  hypothetical protein SELMODRAFT_64323              130   5e-32    Selaginella moellendorffii
gb|EMT22481.1|  hypothetical protein F775_14603                         106   6e-24    Aegilops tauschii
ref|XP_010431275.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   8e-23    Camelina sativa [gold-of-pleasure]
gb|ABI95409.1|  fasciclin-like protein FLA19                          98.2    2e-20    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ87361.1|  predicted protein                                    97.1    9e-20    Hordeum vulgare subsp. vulgare [barley]
ref|XP_006663458.1|  PREDICTED: uncharacterized protein LOC102717475  87.4    1e-16    
tpg|DAA51811.1|  TPA: hypothetical protein ZEAMMB73_870378            77.0    2e-14    Zea mays [maize]
ref|NP_196184.1|  uncharacterized protein                             65.1    3e-10    Arabidopsis thaliana [mouse-ear cress]
emb|CDY35502.1|  BnaA01g24100D                                        59.7    6e-09    Brassica napus [oilseed rape]
gb|AFG49337.1|  hypothetical protein 0_16121_01                       56.6    4e-07    Pinus taeda
gb|AEW07983.1|  hypothetical protein 0_16121_01                       55.8    7e-07    Pinus radiata
gb|AFG49330.1|  hypothetical protein 0_16121_01                       55.8    8e-07    Pinus taeda
gb|AFG49328.1|  hypothetical protein 0_16121_01                       55.8    8e-07    Pinus taeda



>emb|CDP10566.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+VRPDG+IHGIERVLIPKSVQQDFN+RRSLR+ISAVLP GAPEVDPRTHRLKKPA+P P
Sbjct  183  DIVRPDGIIHGIERVLIPKSVQQDFNSRRSLRAISAVLPEGAPEVDPRTHRLKKPASPAP  242

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPIYDAMAPGP+LAPAPAPGPGG HHHFDGE+Q+KDFIQTLLHYGGYNELADIL
Sbjct  243  AGSPPALPIYDAMAPGPSLAPAPAPGPGGPHHHFDGEAQIKDFIQTLLHYGGYNELADIL  302

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYHLIPEYQTEE
Sbjct  303  VNLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHLIPEYQTEE  362

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHKVVAEEA
Sbjct  363  SMYNAVRRFGKVRYDTLRLPHKVVAEEA  390



>ref|XP_009595093.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=454

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++PDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLP GAPEVDPRTHRLKKPA    
Sbjct  169  DIIKPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPA  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDA+APGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADIL
Sbjct  229  GAPPVLP-VYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVAEEA
Sbjct  348  SMYNAVRRFGKVKYDTLRLPHKVVAEEA  375



>ref|XP_009783700.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=454

 Score =   327 bits (837),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++PDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLP GAPEVDPRTHRLKKPA    
Sbjct  169  DIIKPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPA  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDA+APGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADIL
Sbjct  229  GAPPVLP-VYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVAEEA
Sbjct  348  SMYNAVRRFGKVKYDTLRLPHKVVAEEA  375



>ref|XP_004249393.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=449

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+V+PDG+IHGIERVLIPKSVQQDFN RRSLRSISAVLP GAPEVDPRTHRLKKP +   
Sbjct  168  DIVKPDGIIHGIERVLIPKSVQQDFNNRRSLRSISAVLPEGAPEVDPRTHRLKKPVSVPA  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDA+APGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADIL
Sbjct  228  GAPPVLP-VYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADIL  286

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  287  VNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  346

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKI YDTLRLPHKVVAEEA
Sbjct  347  SMYNSVRRFGKINYDTLRLPHKVVAEEA  374



>gb|KDP36078.1| hypothetical protein JCGZ_08722 [Jatropha curcas]
Length=466

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  175  DVIRPDGVIHGIERLLIPQSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPAAPVP  234

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDA+APGP+LAPAPAPGPGG HH FDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  235  AGAPPVLPIYDALAPGPSLAPAPAPGPGGPHHKFDGESQVKDFIQTLLHYGGYNEMADIL  294

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  295  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  354

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI+YDTLRLPHKVVA+EA
Sbjct  355  SMYNAVRRFGKIKYDTLRLPHKVVAQEA  382



>ref|XP_011077777.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=463

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D++RPDG+IHGIER+L+PKSVQQDFN RRSLR+ SAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  174  DIIRPDGIIHGIERLLVPKSVQQDFNARRSLRATSAVLPEGAPEVDPRTHRLKKPAPPVP  233

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LP++DAMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  234  VGAPPVLPVFDAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNEMADIL  293

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  294  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  353

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVAEEA
Sbjct  354  SMYNAVRRFGKVKYDTLRLPHKVVAEEA  381



>ref|XP_006339181.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Solanum 
tuberosum]
Length=453

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+V+PDG+IHGIERVLIPKSVQQDFN RRSLRSISAV+P GAPEVDPRTHRLKKP     
Sbjct  168  DIVKPDGIIHGIERVLIPKSVQQDFNNRRSLRSISAVIPEGAPEVDPRTHRLKKPVAVPA  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDA+APGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADIL
Sbjct  228  GAPPVLP-VYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADIL  286

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  287  VNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  346

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKI YDTLRLPHKVVAEEA
Sbjct  347  SMYNSVRRFGKINYDTLRLPHKVVAEEA  374



>ref|XP_011094205.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=465

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D++RPDG+IHGIER+LIPKSVQQDFN RRSLR+ SAVLP GAP VDPRTHRLKKPA PVP
Sbjct  175  DIIRPDGIIHGIERLLIPKSVQQDFNARRSLRATSAVLPEGAPVVDPRTHRLKKPAPPVP  234

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADIL
Sbjct  235  VGAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADIL  294

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  295  VNLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  354

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPHKVVAEEA
Sbjct  355  SMYNSVRRFGKVKYDTLRLPHKVVAEEA  382



>ref|XP_009794483.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=449

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++PDG+IHGIERVLIPKSVQQDFNTRRSLRSISAVLP GAPEVDPRT+RLKK      
Sbjct  167  DIIKPDGIIHGIERVLIPKSVQQDFNTRRSLRSISAVLPEGAPEVDPRTNRLKKKPTIPV  226

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  IY AMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADI
Sbjct  227  PAGAPPVLPIYSAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADI  286

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE
Sbjct  287  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  346

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK++YDTLRLPHKVVAEEA
Sbjct  347  ESMYNAVRRFGKVKYDTLRLPHKVVAEEA  375



>ref|XP_009587619.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=449

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++PDG+IHGIERVLIPKSVQQDFNTRRSLRSISAVLP GAPEVDPRT+RLKK      
Sbjct  167  DIIKPDGIIHGIERVLIPKSVQQDFNTRRSLRSISAVLPEGAPEVDPRTNRLKKKPTIPV  226

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  IY AMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNELADI
Sbjct  227  PAGEPPVLPIYSAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADI  286

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE
Sbjct  287  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  346

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK++YDTLRLPHKVVAEEA
Sbjct  347  ESMYNAVRRFGKVKYDTLRLPHKVVAEEA  375



>ref|XP_002524094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38304.1| conserved hypothetical protein [Ricinus communis]
Length=462

 Score =   322 bits (825),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  170  DVIRPDGVIHGIERLLIPQSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAAPVP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  230  VGAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVA+EA
Sbjct  350  SMYNAVRRFGKVKYDTLRLPHKVVAQEA  377



>ref|XP_010263095.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Nelumbo 
nucifera]
Length=470

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA P PA
Sbjct  173  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPPSPA  232

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDA+APGP++APAPAPGPGG HH FDGESQVKDFIQTLL YGGYNE+ADILV
Sbjct  233  GSPPALPIYDALAPGPSIAPAPAPGPGGPHHWFDGESQVKDFIQTLLLYGGYNEMADILV  292

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  293  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  352

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAV+RFGK+RYDTLRLPHKVVA+EA
Sbjct  353  MYNAVKRFGKVRYDTLRLPHKVVAQEA  379



>ref|XP_004303393.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIERVLIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  172  DVIRPDGLIHGIERVLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  231

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDA+APGP+LAPAPAPGPGG  HHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  232  AGAPPVLPIYDALAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIHTLLHYGGYNEMADIL  291

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  292  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  351

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPH+VVA+EA
Sbjct  352  SMYNSVRRFGKVQYDTLRLPHRVVAQEA  379



>ref|XP_010110455.1| hypothetical protein L484_006448 [Morus notabilis]
 gb|EXC26397.1| hypothetical protein L484_006448 [Morus notabilis]
Length=460

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  170  DVVRPDGVIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPAAPVP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDA+APGP+LAPAPAPGPGG H HFDG +QVKDFIQTLLHYGGYNE+ADIL
Sbjct  230  AGAPPVLPIYDALAPGPSLAPAPAPGPGGPHGHFDGMAQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  350  SMYNAVRRFGKVRYDTLRLPHKVVAQEA  377



>ref|XP_011042549.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011042550.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=466

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKP  PV 
Sbjct  173  DVTRPDGVIHGIERLLVPQSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVR  232

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALP+YDAM+PGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  233  AGSPPALPVYDAMSPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNEMADIL  292

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  293  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  352

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI YDTLRLPHKVVA+EA
Sbjct  353  SMYNAVRRFGKIGYDTLRLPHKVVAQEA  380



>ref|XP_002270321.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+LIP+SV++DFN RRSLRSISAVLP GAPEVDPRTHRLKKP +    
Sbjct  176  VLRPDGVIHGIERLLIPRSVEEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPVSVPAG  235

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
              P    IYDAMAPGP+LAPAPAPGPGG   HFDGESQVKDFIQTLLHYGGYNE+ADILV
Sbjct  236  APPVLP-IYDAMAPGPSLAPAPAPGPGGPRGHFDGESQVKDFIQTLLHYGGYNEMADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHL+PEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLVPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  355  MYNAVRRFGKVRYDTLRLPHKVVAQEA  381



>ref|XP_002322769.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
 gb|EEF04530.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
Length=466

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKP  PV 
Sbjct  173  DVTRPDGVIHGIERLLVPQSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVR  232

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LP+YDAM+PGP+LAPAPAPGPGG HHHFDGESQVKDFIQTL+HYGGYNE+ADIL
Sbjct  233  AGSPPVLPVYDAMSPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLVHYGGYNEMADIL  292

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  293  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  352

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI YDTLRLPHKVVA+EA
Sbjct  353  SMYNAVRRFGKIGYDTLRLPHKVVAQEA  380



>ref|XP_010516793.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>ref|XP_002879581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55840.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   316 bits (810),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>ref|XP_010543842.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SVQ+DFN RRSLRSISAVLPTGAPEVDPRTHRLKKP+    
Sbjct  177  DVTRPDGVIHGIERLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPSAAAV  236

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  IYDAMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFIQTLLHYGGYNE+ADI
Sbjct  237  PAGAPPVLPIYDAMAPGPSLAPAPAPGPGGRHHHFDGEAQVKDFIQTLLHYGGYNEMADI  296

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTE
Sbjct  297  LVNLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTE  356

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK+RYDTLR PHKVVA+EA
Sbjct  357  ESMYNAVRRFGKVRYDTLRFPHKVVAKEA  385



>ref|XP_010509549.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>ref|XP_002270606.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +VRPDGVIHGIER+LIP SV++DFN RRSLRSISAVLP GAPEVDPRTHRLKK       
Sbjct  176  IVRPDGVIHGIERLLIPLSVEEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKVLPVPAG  235

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
              P    IYDAMAPGP+LAPAPAPGPGG   HFDGESQVKDFIQTLLHYGGYNE+ADILV
Sbjct  236  APPVLP-IYDAMAPGPSLAPAPAPGPGGPRGHFDGESQVKDFIQTLLHYGGYNEMADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHL+PEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLVPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  355  MYNAVRRFGKVRYDTLRLPHKVVAQEA  381



>gb|EYU18152.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
 gb|EYU18153.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
Length=576

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+VRPDGVIHGIER+LIPKSVQQDFN RRSL + SAV+P GAPEVDPRTHRLKKPA PV 
Sbjct  291  DIVRPDGVIHGIERLLIPKSVQQDFNARRSLAATSAVIPEGAPEVDPRTHRLKKPAPPVS  350

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPPALPIYDAM+PGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  351  AGAPPALPIYDAMSPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNEMADIL  410

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPE+IMYYH+IPEYQTEE
Sbjct  411  VNLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPERIMYYHMIPEYQTEE  470

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLP+KVVAEEA
Sbjct  471  SMYNSVRRFGKVKYDTLRLPYKVVAEEA  498



>gb|EYU38707.1| hypothetical protein MIMGU_mgv1a006053mg [Erythranthe guttata]
Length=459

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D++RPDG+IHGIER+L+PKSVQQ+FN RRSLR+ SAV+P GAPEVDPRT+RLKKPA PV 
Sbjct  170  DIIRPDGIIHGIERLLVPKSVQQEFNARRSLRATSAVIPEGAPEVDPRTNRLKKPAPPVA  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY+A+APGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  230  AGAPPVLPIYNALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPH+VVAEEA
Sbjct  350  SMYNSVRRFGKVKYDTLRLPHQVVAEEA  377



>gb|AGN92422.1| putative fasciclin-like arabinogalactan protein 2 [Centaurium 
erythraea]
Length=461

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIPKSVQQDFN+RRSLRSISAV+P GAPE+DPRTHRLKKPA+PVP
Sbjct  168  DVIRPDGIIHGIERLLIPKSVQQDFNSRRSLRSISAVIPQGAPEIDPRTHRLKKPASPVP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LP+YDA+APGP LAPAPAPGPGG HHHF+GE+QVKDFI+TLLHYGGYNELADIL
Sbjct  228  VGAPPVLPVYDALAPGPGLAPAPAPGPGGPHHHFNGEAQVKDFIETLLHYGGYNELADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA+EMGRLVSEGY +TVLAPNDEAMAKLTT+QLSEPGAPEQI+YYHLIPEYQTEE
Sbjct  288  VNLTSLASEMGRLVSEGYKITVLAPNDEAMAKLTTEQLSEPGAPEQIVYYHLIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHKV AEEA
Sbjct  348  SMYNAVRRFGKVRYDTLRLPHKVSAEEA  375



>ref|XP_006294220.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
 gb|EOA27118.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
Length=445

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPSVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPI+DAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIFDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>emb|CDY23209.1| BnaA04g05500D [Brassica napus]
Length=440

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKK   PVP
Sbjct  154  DVTRPDGIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVP  213

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  214  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  273

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  274  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  333

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  334  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  361



>ref|XP_009139464.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brassica 
rapa]
Length=440

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKK   PVP
Sbjct  154  DVTRPDGIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVP  213

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  214  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  273

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  274  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  333

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  334  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  361



>ref|XP_006348432.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Solanum 
tuberosum]
Length=436

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++ DG+IHGI++VLIPKSVQQ FN RR+LRSISAVLP GAPE+DPRT+RLKK   PVP
Sbjct  148  DIIKSDGIIHGIKKVLIPKSVQQSFNNRRNLRSISAVLPEGAPEIDPRTNRLKKKPKPVP  207

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY AMAPGP+LAPAPAPGPGGHHHHFDGE+QVKDFIQTLLHYGGYNELADIL
Sbjct  208  AGAPPVLPIYSAMAPGPSLAPAPAPGPGGHHHHFDGETQVKDFIQTLLHYGGYNELADIL  267

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  268  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  327

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPHKVVAEEA
Sbjct  328  SMYNSVRRFGKVKYDTLRLPHKVVAEEA  355



>ref|NP_850253.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
 sp|Q8RWC5.1|FLA16_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM13188.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31934.1| At2g35860 [Arabidopsis thaliana]
 gb|AEC09172.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
Length=445

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKP+  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGDAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>ref|XP_007204352.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
 gb|EMJ05551.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
Length=447

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SV+ DFN RR+LR+ISA+LP GAPEVDPRTHRLKKPA PVP
Sbjct  155  DVTRPDGVIHGIERLLIPRSVEDDFNRRRNLRTISAILPEGAPEVDPRTHRLKKPAAPVP  214

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDA+APGP+LAPAPAPGPGG HHHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  215  AGAPPVLPVYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIHTLLHYGGYNEMADIL  274

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  275  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  334

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYDTLRLPHKVVA+EA
Sbjct  335  SMYNSVRRFGKVRYDTLRLPHKVVAQEA  362



>ref|XP_010938934.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Elaeis guineensis]
Length=468

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL SISA+LPTGAPEVDPRTHRLKKPA P P 
Sbjct  176  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLASISAILPTGAPEVDPRTHRLKKPAPPCPR  235

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDAMAPGP++APAPAPGPG   H FDGESQVKDFI TLL YGGYNELADILV
Sbjct  236  GSPPALPIYDAMAPGPSIAPAPAPGPGSGKHWFDGESQVKDFIHTLLLYGGYNELADILV  295

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT DQLSEPGAPEQI+YYHLIPEYQTEES
Sbjct  296  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTADQLSEPGAPEQIVYYHLIPEYQTEES  355

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  356  MYNAVRRFGKVRYDTLRLPHKVVAREA  382



>emb|CDX95333.1| BnaC04g28250D [Brassica napus]
Length=440

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKK   PVP
Sbjct  154  DVTRPDGIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVP  213

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  214  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  273

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  274  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  333

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  334  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  361



>ref|XP_008803482.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Phoenix dactylifera]
Length=465

 Score =   314 bits (805),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL SISA+LPTGAPEVDPRTHRLKKPA P PA
Sbjct  173  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLASISAILPTGAPEVDPRTHRLKKPAPPAPA  232

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDAMAPGP+LAPAPAPGPG   H FDGESQVKDFIQTLL YGGYNELADILV
Sbjct  233  GSPPALPIYDAMAPGPSLAPAPAPGPGSGKHWFDGESQVKDFIQTLLLYGGYNELADILV  292

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPND+AMAKLT DQLSEPGAPEQI+YYHL+PEYQTEES
Sbjct  293  NLTSLATEMGRLVSEGYVLTVLAPNDDAMAKLTADQLSEPGAPEQIVYYHLVPEYQTEES  352

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  353  MYNAVRRFGKVRYDTLRLPHKVVAREA  379



>ref|XP_006291159.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
 gb|EOA24057.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
Length=437

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKK   PVP
Sbjct  151  DLTRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKKPVPVP  210

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  211  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  270

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  271  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  330

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYD+LR PHKV A+EA
Sbjct  331  SMYNSVRRFGKVRYDSLRFPHKVDAQEA  358



>gb|AAD21471.1| unknown protein [Arabidopsis thaliana]
Length=475

 Score =   314 bits (805),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKP+  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGDAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  337

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  338  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  365



>ref|XP_010505110.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=492

 Score =   315 bits (807),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  205  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  264

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  265  AGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  324

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  325  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  384

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  385  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  412



>ref|XP_004228680.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=439

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+++ DG+IHGI++VLIPKSVQQ FN RR+LRSISAVLP GAPE+DPRT+RLKK   PVP
Sbjct  153  DIIKSDGIIHGIQKVLIPKSVQQSFNNRRNLRSISAVLPQGAPEIDPRTNRLKKNPKPVP  212

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY AMAPGP+LAPAPAPGPGG+HHHFDGE+QVKDFIQTLLHYGGYNELADIL
Sbjct  213  AGAPPVLPIYSAMAPGPSLAPAPAPGPGGNHHHFDGETQVKDFIQTLLHYGGYNELADIL  272

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE
Sbjct  273  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  332

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPHKVVAEEA
Sbjct  333  SMYNSVRRFGKLKYDTLRLPHKVVAEEA  360



>ref|XP_008442961.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Cucumis 
melo]
Length=465

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGIER+LIP+SVQ+DFN RR+L+SISAVLP GAPEVDPRTHRLKKPA  VP
Sbjct  174  DVVRPDGVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPSVP  233

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGA P LPIYDA+APGP++APAPAPGPGG HHHFDGE QVKDFIQTLLHYGGYNE+ADIL
Sbjct  234  AGASPVLPIYDALAPGPSIAPAPAPGPGGPHHHFDGERQVKDFIQTLLHYGGYNEMADIL  293

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  294  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEE  353

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RY TLRLPH V+A+EA
Sbjct  354  SMYNAVRRFGKVRYQTLRLPHAVMAQEA  381



>gb|KFK36481.1| hypothetical protein AALP_AA4G130300 [Arabis alpina]
Length=447

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKP+ PVP
Sbjct  159  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPPVP  218

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LPIYDAM+PGP+LAPAPAPGPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  219  AGSPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  278

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  279  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  338

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  339  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  366



>ref|XP_011047143.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Populus 
euphratica]
Length=466

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKP  PV 
Sbjct  173  DVTRPDGVIHGIERLLVPQSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVR  232

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LPIYDAMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLL YGGYNE+ADIL
Sbjct  233  AGSPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLLYGGYNEMADIL  292

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  293  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  352

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI YDTLRLPHKVVA+EA
Sbjct  353  SMYNAVRRFGKIGYDTLRLPHKVVAQEA  380



>ref|NP_190805.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
 sp|Q9FT45.1|FLA15_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 15; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC07928.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42264.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|ABG48483.1| At3g52370 [Arabidopsis thaliana]
 gb|AEE78939.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
Length=436

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   P+P
Sbjct  150  DLTRPDGIIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPIP  209

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  210  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  269

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  270  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  329

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  330  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  357



>ref|XP_010534382.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SVQ+ FN RRSLRSISAVLPTGAPEVDPRTHRLKKP+    
Sbjct  173  DVTRPDGVIHGIERLLIPRSVQESFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPSAASV  232

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  IYDAMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFIQTLLHYGGYNE+ADI
Sbjct  233  PAGAPPVLPIYDAMAPGPSLAPAPAPGPGGRHHHFNGEAQVKDFIQTLLHYGGYNEMADI  292

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTE
Sbjct  293  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTE  352

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK++YDTLR PHKV+A+EA
Sbjct  353  ESMYNSVRRFGKVKYDTLRFPHKVLAQEA  381



>ref|XP_008798695.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Phoenix 
dactylifera]
Length=464

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL SISAVLP GAPEVDPRTHRLKK A P PA
Sbjct  172  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLASISAVLPVGAPEVDPRTHRLKKLAPPAPA  231

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDA+APGPALAPAPAPGPG   H FDGESQVKDFIQ LL YGGYNELADILV
Sbjct  232  GSPPALPIYDAIAPGPALAPAPAPGPGSGKHWFDGESQVKDFIQILLLYGGYNELADILV  291

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT DQLSEPGAPEQI+YYHLIPEYQTEES
Sbjct  292  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTADQLSEPGAPEQIVYYHLIPEYQTEES  351

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  352  MYNAVRRFGKVRYDTLRLPHKVVAREA  378



>ref|XP_006410756.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
 gb|ESQ52209.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
Length=446

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  159  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPPVP  218

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  219  AGSPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  278

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  279  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  338

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  339  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  366



>ref|XP_004136532.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN59239.1| hypothetical protein Csa_3G783850 [Cucumis sativus]
Length=465

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGIER+LIP+SVQ+DFN RR+L+SISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  174  DVVRPDGVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPPVP  233

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             G  P LPIYDA+APGP++APAPAPGPGG HHHFDGE QVKDFIQTLLHYGGYNE+ADIL
Sbjct  234  VGTSPVLPIYDALAPGPSIAPAPAPGPGGPHHHFDGERQVKDFIQTLLHYGGYNEMADIL  293

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  294  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEE  353

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RY TLRLPH V+A+EA
Sbjct  354  SMYNAVRRFGKVRYQTLRLPHAVMAQEA  381



>ref|XP_004167872.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
Length=465

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGIER+LIP+SVQ+DFN RR+L+SISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  174  DVVRPDGVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPPVP  233

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             G  P LPIYDA+APGP++APAPAPGPGG HHHFDGE QVKDFIQTLLHYGGYNE+ADIL
Sbjct  234  VGTSPVLPIYDALAPGPSIAPAPAPGPGGPHHHFDGERQVKDFIQTLLHYGGYNEMADIL  293

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  294  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEE  353

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RY TLRLPH V+A+EA
Sbjct  354  SMYNAVRRFGKVRYQTLRLPHAVMAQEA  381



>ref|XP_008241098.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Prunus 
mume]
Length=483

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SV+ DFN RR+LR+ISA+LP GAPEVDPRTHRLKKPA PVP
Sbjct  191  DVTRPDGVIHGIERLLIPRSVEDDFNRRRNLRTISAILPEGAPEVDPRTHRLKKPAAPVP  250

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDA+A     APA APGPGG HHHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  251  AGAPPVLPLYDALAXXXXXAPARAPGPGGPHHHFDGESQVKDFIHTLLHYGGYNEMADIL  310

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  311  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  370

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYDTLRLPHKVVA+EA
Sbjct  371  SMYNSVRRFGKVRYDTLRLPHKVVAQEA  398



>emb|CDX79631.1| BnaC03g19670D [Brassica napus]
Length=446

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN+RRSLRSISAVLP GAPEVDPRT+RLKKP  PVP
Sbjct  159  DVIRPDGIIHGIERLLIPRSVQEDFNSRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVP  218

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY AM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  219  AGAPPVLPIYSAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  278

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  279  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  338

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  339  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  366



>ref|XP_010557991.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=469

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SVQ DFN RRSLR ISAVLPTGAPEVDPRTHRLKKP++   
Sbjct  178  DVTRPDGVIHGIERLLIPRSVQADFNRRRSLREISAVLPTGAPEVDPRTHRLKKPSSAAV  237

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  IYDAMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFIQTLLHYGGYNE+ADI
Sbjct  238  PSGAPPVLPIYDAMAPGPSLAPAPAPGPGGRHHHFDGEAQVKDFIQTLLHYGGYNEMADI  297

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTE
Sbjct  298  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTE  357

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRF K+RYDTLR PHKVVAEEA
Sbjct  358  ESMYNAVRRFRKVRYDTLRFPHKVVAEEA  386



>ref|XP_006481636.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=451

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  162  DITRPDGVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVP  221

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG H HF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  222  AGAPPILPIYDAMAPGPSLAPAPAPGPGGAHRHFNGERQVKDFIHTLLHYGGYNEMADIL  281

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  282  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  341

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPHKV A+EA
Sbjct  342  SMYNSVRRFGKVKYDTLRLPHKVTAQEA  369



>ref|XP_006430020.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 ref|XP_006430021.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43260.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43261.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
Length=451

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  162  DITRPDGVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVP  221

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG H HF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  222  AGAPPILPIYDAMAPGPSLAPAPAPGPGGAHRHFNGERQVKDFIHTLLHYGGYNEMADIL  281

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  282  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  341

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK++YDTLRLPHKV A+EA
Sbjct  342  SMYNSVRRFGKVKYDTLRLPHKVTAQEA  369



>ref|XP_010045160.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Eucalyptus 
grandis]
 gb|KCW87313.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
 gb|KCW87314.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
Length=480

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQ DFN RRSLRSI+AV P GAPEVDPRTHRLKKPA P  A
Sbjct  190  VARPDGVIHGIERLLIPQSVQDDFNRRRSLRSITAVKPEGAPEVDPRTHRLKKPAPPAKA  249

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALPIYDAMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADILV
Sbjct  250  GSAPALPIYDAMAPGPSLAPAPAPGPGGPHHHFDGEAQVKDFIHTLLHYGGYNEMADILV  309

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  310  NLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  369

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK++YDTLRLPHK+VA+EA
Sbjct  370  MYNAVRRFGKVKYDTLRLPHKMVAQEA  396



>ref|XP_002309262.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
 gb|EEE92785.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
Length=466

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKP  PV 
Sbjct  173  DVTRPDGVIHGIERLLVPQSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVR  232

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LPIYDAMAPGP+LAPAPAPGPGG HHHFDGESQVKDFIQTLL YGGYNE+ADIL
Sbjct  233  AGSPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLLYGGYNEMADIL  292

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  293  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  352

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI YDTLRLPHKV A+EA
Sbjct  353  SMYNAVRRFGKIGYDTLRLPHKVAAQEA  380



>ref|XP_009387789.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVPA
Sbjct  172  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPA  231

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPG   H FDGESQVKDFIQTLL YGGYNE ADILV
Sbjct  232  GAPPVLPIYDAMAPGPSLAPAPAPGPGSGKHWFDGESQVKDFIQTLLLYGGYNEFADILV  291

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTS+ATEMGRLVSEGYVLTVLAPND+AMA+LTTDQLSEPGAPE IMYYHLIPEYQTEES
Sbjct  292  NLTSMATEMGRLVSEGYVLTVLAPNDDAMARLTTDQLSEPGAPETIMYYHLIPEYQTEES  351

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLR+PHKVVA EA
Sbjct  352  MYNAVRRFGKVRYDTLRVPHKVVAREA  378



>ref|XP_006403811.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
 gb|ESQ45264.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
Length=441

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKK   PVP
Sbjct  154  DLTRPDGIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVP  213

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  214  AGAPPILPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  273

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  274  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  333

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  334  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  361



>ref|XP_002876139.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52398.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   P+P
Sbjct  149  DLTRPDGIIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPIP  208

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  209  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  268

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  269  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  328

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYD+LR PHKV A+EA
Sbjct  329  SMYNSVRRFGKVRYDSLRFPHKVEAQEA  356



>emb|CDY32082.1| BnaC04g44840D [Brassica napus]
Length=444

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA    
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPA  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  GAPPVLP-VYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  276

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  277  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  336

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  337  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  364



>emb|CDX84594.1| BnaA03g16360D [Brassica napus]
Length=446

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRT+RLKKP  PVP
Sbjct  159  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVP  218

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY AM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  219  AGAPPVLPIYSAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  278

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  279  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  338

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  339  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  366



>ref|XP_010515698.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVP
Sbjct  149  DLTRPDGVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPVP  208

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  209  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  268

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  269  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  328

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYD+LR PHKV A+EA
Sbjct  329  SMYNSVRRFGKVRYDSLRFPHKVEAQEA  356



>emb|CDY40429.1| BnaA04g20880D [Brassica napus]
Length=443

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA    
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPA  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  GAPPVLP-VYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  276

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  277  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  336

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  337  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  364



>ref|XP_009133050.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=446

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRT+RLKKP  PVP
Sbjct  159  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVP  218

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIY AM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  219  AGAPPVLPIYSAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  278

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  279  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  338

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  339  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  366



>ref|XP_004154697.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Cucumis sativus]
Length=399

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIHGIER+LIP+SVQ DFN RR+L++I+AV P GAPEVDPRTHRLKKPA P   
Sbjct  108  ITRPDGVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAPEVDPRTHRLKKPAPPAEP  167

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALPIYDA+APGP+LAPAPAPGPGG HHHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  168  GSAPALPIYDALAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIHTLLHYGGYNEMADILV  227

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  228  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  287

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKIRYDTLRLPHKVVA+EA
Sbjct  288  MYNAVRRFGKIRYDTLRLPHKVVAQEA  314



>ref|XP_010248022.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nelumbo 
nucifera]
Length=469

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+LIP+SVQ+DFN RRSL SISAV P GAPEVD RTHRLKK A P P 
Sbjct  173  VVRPDGVIHGIERLLIPRSVQEDFNRRRSLSSISAVRPEGAPEVDTRTHRLKKAAPPAPP  232

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP+LPIY+AMA  P  AP PAPGPGG HH FDGESQVKDFIQTLLHYGGYNELADILV
Sbjct  233  GSPPSLPIYEAMASAPGSAPVPAPGPGGPHHWFDGESQVKDFIQTLLHYGGYNELADILV  292

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  293  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  352

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  353  MYNAVRRFGKVRYDTLRLPHKVVALEA  379



>ref|XP_010553413.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Tarenaya 
hassleriana]
Length=464

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+R DG+IHGIE++LIP+SVQ+DFN RRSLRSISAVLPTGAPEVDPRTHRLKKPA PVP
Sbjct  172  DVIRTDGIIHGIEKLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPAPPVP  231

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFIQTL+HYGGYNE+ADIL
Sbjct  232  AGAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIQTLVHYGGYNEMADIL  291

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPG+PEQI+YYH+IPEYQTEE
Sbjct  292  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIVYYHIIPEYQTEE  351

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++Y+TLR PH+V+A+EA
Sbjct  352  SMYNAVRRFGKVKYETLRFPHRVLAQEA  379



>gb|KFK34484.1| hypothetical protein AALP_AA5G151600 [Arabis alpina]
Length=430

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGI+R+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKK   P+ 
Sbjct  144  DITRPDGIIHGIDRLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPGPIA  203

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDA++PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  204  AGAPPVLPIYDAISPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  263

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  264  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  323

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGKIRYD+LR PHKV A+EA
Sbjct  324  SMYNSVRRFGKIRYDSLRFPHKVEAQEA  351



>ref|XP_009388984.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388985.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVPA
Sbjct  174  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPA  233

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPG   H FDGESQVKDFIQTLL YGGYNE ADILV
Sbjct  234  GAPPVLPIYDAMAPGPSLAPAPAPGPGSGKHWFDGESQVKDFIQTLLLYGGYNEFADILV  293

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPND+AMA+LT DQLSEPGAPE IMYYHLIPEYQTEES
Sbjct  294  NLTSLATEMGRLVSEGYVLTVLAPNDDAMARLTADQLSEPGAPEAIMYYHLIPEYQTEES  353

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV+A EA
Sbjct  354  MYNAVRRFGKVRYDTLRLPHKVMAREA  380



>ref|XP_009141525.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=443

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRTHRLKKPA+   
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPASVPA  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    +YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  GAPPVLP-VYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  276

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  277  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  336

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YD+LR PHKV+A+EA
Sbjct  337  SMYNAVRRFGKVKYDSLRFPHKVLAQEA  364



>gb|KEH29726.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=466

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SVQ DFN RRSL SI+A+ P GAPEVDPRTHRLKKP  P  
Sbjct  170  DVTRPDGVIHGIERLLIPRSVQDDFNRRRSLVSIAAIKPEGAPEVDPRTHRLKKPPPPQN  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             G+PPALPI+DA+APGP+LAPAPAPGPGG HHHF+GE+QVKDFIQTL+HYGGYNE+ADIL
Sbjct  230  PGSPPALPIFDALAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIQTLIHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEM RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPG+PEQIMYYHLIPEYQTEE
Sbjct  290  VNLTSLATEMSRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIMYYHLIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHKV AEEA
Sbjct  350  SMYNAVRRFGKVRYDTLRLPHKVDAEEA  377



>ref|XP_010525828.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Tarenaya 
hassleriana]
Length=464

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGI+++LIP+SVQ+DFN RRSLRSISAVLPTGAPEVDPRTHRLKKPA PVP
Sbjct  173  DVIRPDGIIHGIQKLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPAPPVP  232

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFIQTLLHYGGYNE+ADIL
Sbjct  233  AGAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIQTLLHYGGYNEMADIL  292

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTT+QLSEPG+PEQI+YYH+I EYQTEE
Sbjct  293  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGSPEQIVYYHIITEYQTEE  352

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++Y+TLR PH+V+AEEA
Sbjct  353  SMYNAVRRFGKVKYETLRFPHRVMAEEA  380



>ref|XP_009362660.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=457

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKKPA PVP
Sbjct  165  DVTRPDGVIHGIERLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPPVP  224

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LP+YDA+APGP+LAPAPAPGPGG  HHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  225  VGAPPVLPVYDALAPGPSLAPAPAPGPGGPKHHFDGESQVKDFIHTLLHYGGYNEMADIL  284

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  285  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  344

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+V+RFGK+RYDTLRLPHKVVA+EA
Sbjct  345  SMYNSVKRFGKVRYDTLRLPHKVVAQEA  372



>ref|XP_010503981.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVP
Sbjct  149  DLTRPDGVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVP  208

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  209  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  268

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATE+GRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  269  VNLTSLATEIGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  328

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYD+LR PHKV A+EA
Sbjct  329  SMYNSVRRFGKVRYDSLRFPHKVEAQEA  356



>ref|XP_004139069.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN66568.1| hypothetical protein Csa_1G629740 [Cucumis sativus]
Length=466

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIHGIER+LIP+SVQ DFN RR+L++I+AV P GAPEVDPRTHRLKKPA P   
Sbjct  175  ITRPDGVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAPEVDPRTHRLKKPAPPAEP  234

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALPIYDA+APGP+LAPAPAPGPGG HHHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  235  GSAPALPIYDALAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIHTLLHYGGYNEMADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKIRYDTLRLPHKVVA+EA
Sbjct  355  MYNAVRRFGKIRYDTLRLPHKVVAQEA  381



>ref|XP_009348615.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=452

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIER+LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKKPA PVP
Sbjct  165  DVTRPDGVIHGIERLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPPVP  224

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LPIYDA+APGP+LAPAPAPGPGG  HHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  225  VGAPPVLPIYDALAPGPSLAPAPAPGPGGPKHHFDGESQVKDFIHTLLHYGGYNEMADIL  284

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  285  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  344

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+V+RFGK+RYDTLRL HKVVA+EA
Sbjct  345  SMYNSVKRFGKVRYDTLRLAHKVVAQEA  372



>ref|XP_007028043.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
 gb|EOY08545.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
Length=463

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA    
Sbjct  175  DVIRPDGVIHGIQQLLIPRSVIEDFNKRRNLRSISAVLPEGAPEVDPRTHRLKKPAPVPV  234

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG HHHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  235  GAPPVLP-IYEAMAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIHTLLHYGGYNEMADIL  293

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  294  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  353

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  354  SMYNAVRRFGKVRYDTLRLPHKVVAQEA  381



>gb|KJB36232.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=460

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSI+AVLP GAPEVDPRTHRLKKPA    
Sbjct  171  DVIRPDGVIHGIQQLLIPRSVIEDFNRRRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPV  230

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG  HHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  231  GAPPVLP-IYEAMAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVA+EA
Sbjct  350  SMYNAVRRFGKVKYDTLRLPHKVVAQEA  377



>gb|KHG03559.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=459

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 191/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSI+AVLP GAPEVDPRTHRLK PA    
Sbjct  171  DVIRPDGVIHGIQQLLIPRSVIEDFNRRRNLRSITAVLPEGAPEVDPRTHRLKNPAPVPV  230

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDAMAPGP+LAPAPAPGPGG  HHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  231  GAPPVLP-IYDAMAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVA+EA
Sbjct  350  SMYNAVRRFGKVKYDTLRLPHKVVAQEA  377



>ref|XP_010426853.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVP
Sbjct  149  DLTRPDGVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVP  208

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LP+YDAM+PGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  209  AGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADIL  268

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGA EQI+YYH+IPEYQTEE
Sbjct  269  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGASEQIVYYHIIPEYQTEE  328

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+RYD+LR PHKV A+EA
Sbjct  329  SMYNSVRRFGKVRYDSLRFPHKVEAQEA  356



>gb|KJB36230.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=459

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSI+AVLP GAPEVDPRTHRLKKPA    
Sbjct  171  DVIRPDGVIHGIQQLLIPRSVIEDFNRRRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPV  230

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG  HHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  231  GAPPVLP-IYEAMAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLPHKVVA+EA
Sbjct  350  SMYNAVRRFGKVKYDTLRLPHKVVAQEA  377



>ref|XP_002463768.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
 gb|EER90766.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
Length=474

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  177  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLP  236

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  237  GAPPVLPIWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  296

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  297  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  356

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  357  MYNAVRRFGKVRYDTLRLPHKVVAREA  383



>ref|NP_001130335.1| uncharacterized protein LOC100191430 precursor [Zea mays]
 gb|ACF78522.1| unknown [Zea mays]
 gb|ACL52516.1| unknown [Zea mays]
 gb|ACL54364.1| unknown [Zea mays]
 gb|ACL54392.1| unknown [Zea mays]
 gb|ACL54585.1| unknown [Zea mays]
 gb|ACL54630.1| unknown [Zea mays]
 gb|ACL54654.1| unknown [Zea mays]
Length=465

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  168  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  228  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  347

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  348  MYNAVRRFGKVRYDTLRLPHKVVAREA  374



>gb|KCW90413.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=462

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGI+R+LIP++VQ+DFN RRSLRSI+AV+P GAPEVDPRTHRLKKPA P P
Sbjct  168  DVVRPDGVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+ PALPIYDAMAPGP+LAPAPAPGP G   HF GE+ VKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGSAPALPIYDAMAPGPSLAPAPAPGPDGPRGHFHGEALVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLAVEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHK+VA+EA
Sbjct  348  SMYNAVRRFGKVRYDTLRLPHKMVAQEA  375



>ref|XP_002315410.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
 gb|EEF01581.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
Length=439

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRTHRLKKPA P   
Sbjct  167  VERPDGVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTHRLKKPAPPAKP  226

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  227  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIETLLLYGGYNEMADILV  286

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  287  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  346

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+AEEA
Sbjct  347  MYNAVRRFGKISYDTLRLPHKVLAEEA  373



>ref|XP_010058812.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Eucalyptus 
grandis]
 gb|KCW90414.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
 gb|KCW90415.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=439

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGI+R+LIP++VQ+DFN RRSLRSI+AV+P GAPEVDPRTHRLKKPA P P
Sbjct  168  DVVRPDGVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+ PALPIYDAMAPGP+LAPAPAPGP G   HF GE+ VKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGSAPALPIYDAMAPGPSLAPAPAPGPDGPRGHFHGEALVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLAVEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHK+VA+EA
Sbjct  348  SMYNAVRRFGKVRYDTLRLPHKMVAQEA  375



>gb|KCW90412.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=463

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGI+R+LIP++VQ+DFN RRSLRSI+AV+P GAPEVDPRTHRLKKPA P P
Sbjct  168  DVVRPDGVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+ PALPIYDAMAPGP+LAPAPAPGP G   HF GE+ VKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGSAPALPIYDAMAPGPSLAPAPAPGPDGPRGHFHGEALVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLAVEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLRLPHK+VA+EA
Sbjct  348  SMYNAVRRFGKVRYDTLRLPHKMVAQEA  375



>ref|XP_008387142.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=455

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIE +LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKKPA PVP
Sbjct  164  DVTRPDGVIHGIEGLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPPVP  223

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LP+YDA+APGP+LAPAPAPGPGG  HHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  224  VGAPPVLPVYDALAPGPSLAPAPAPGPGGPKHHFDGESQVKDFIHTLLHYGGYNEMADIL  283

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  284  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  343

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+V+RFGK+RYDTLRLPHKVVA+EA
Sbjct  344  SMYNSVKRFGKVRYDTLRLPHKVVAQEA  371



>ref|XP_008450315.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
 ref|XP_008450316.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
Length=466

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIHGIER+LIP+SVQ DFN RR+L++I+AV P GAPEVDPRTHRLKKPA P   
Sbjct  175  ITRPDGVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAPEVDPRTHRLKKPAPPAEP  234

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDA+APGP+LAPAPAPGPGG HHHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  235  GSPPALPIYDALAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIHTLLHYGGYNEMADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYN VRRFGKIRYDTLRLPHKVVA+EA
Sbjct  355  MYNTVRRFGKIRYDTLRLPHKVVAQEA  381



>ref|XP_003559349.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brachypodium 
distachyon]
Length=483

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  184  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLP  243

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGP     HFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  244  GAPPVLPVWDAMAPGPSIAPAPAPGPNSGKLHFDGHSQVKDFIQTLVLYGGYNELADILV  303

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  304  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  363

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  364  MYNAVRRFGKVRYDTLRLPHKVVAREA  390



>gb|KDO48671.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
 gb|KDO48672.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
Length=443

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RR+LRSISAV P GAPEVDPRT+RLKKP      
Sbjct  182  VDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKP  241

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALP+Y AMAPGP+LAPAPAPGPGG HHHF+GE QVKDFIQTLLHYGGYNE+ADILV
Sbjct  242  GSSPALPVYYAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIQTLLHYGGYNEMADILV  301

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  302  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  361

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+A+EA
Sbjct  362  MYNAVRRFGKISYDTLRLPHKVLAQEA  388



>ref|XP_006445815.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
 ref|XP_006485518.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
 gb|ESR59055.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
Length=476

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RR+LRSISAV P GAPEVDPRT+RLKKP      
Sbjct  182  VDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKP  241

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALP+Y AMAPGP+LAPAPAPGPGG HHHF+GE QVKDFIQTLLHYGGYNE+ADILV
Sbjct  242  GSSPALPVYYAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIQTLLHYGGYNEMADILV  301

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  302  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  361

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+A+EA
Sbjct  362  MYNAVRRFGKISYDTLRLPHKVLAQEA  388



>gb|EPS67882.1| hypothetical protein M569_06891, partial [Genlisea aurea]
Length=475

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDG+IHGIER+L+PKSV+Q+FN RRSL S +AV+P GAPE+DPRTHRLKKPA  VP
Sbjct  188  DVVRPDGIIHGIERILVPKSVEQEFNARRSLTSTAAVIPQGAPEIDPRTHRLKKPAPTVP  247

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPP LPIYDA+APGPALAPAPAPGPGG HHHFDGE+QVKDFI+TLLHYGGYNELADIL
Sbjct  248  VGAPPVLPIYDALAPGPALAPAPAPGPGGPHHHFDGETQVKDFIKTLLHYGGYNELADIL  307

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA+EMG+LVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYHLIPEYQTEE
Sbjct  308  VNLTSLASEMGKLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHLIPEYQTEE  367

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLP++V+AEEA
Sbjct  368  SMYNAVRRFGKVKYDTLRLPYRVIAEEA  395



>ref|XP_011032963.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=463

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRTHRLKKPA P   
Sbjct  171  VERPDGVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTHRLKKPAPPAKP  230

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  231  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIETLLLYGGYNEMADILV  290

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  291  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  350

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+A+EA
Sbjct  351  MYNAVRRFGKISYDTLRLPHKVLAQEA  377



>ref|XP_011024125.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011024126.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=459

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRTHRLKKPA P   
Sbjct  167  VERPDGVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTHRLKKPAPPAKP  226

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  227  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIETLLLYGGYNEMADILV  286

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  287  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  346

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFG+I YDTLRLPHKV+AEEA
Sbjct  347  MYNAVRRFGEISYDTLRLPHKVLAEEA  373



>gb|ABI95416.1| fasciclin-like protein FLA26 [Triticum aestivum]
Length=460

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RP+GVIHGIER+L+P+SVQ+DFN RRSL  ISAVLPTGAPEVDPRTHRLKKP  PV  
Sbjct  163  VLRPEGVIHGIERILVPRSVQEDFNRRRSLAEISAVLPTGAPEVDPRTHRLKKPEPPVLP  222

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  223  GAPPVLPVWDAMAPGPSIAPAPAPGPGNGKHHFDGHSQVKDFIQTLVLYGGYNELADILV  282

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  283  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  342

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  343  MYNAVRRFGKVRYDTLRLPHKVVAREA  369



>ref|XP_003521503.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
Length=453

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 189/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER+++P+SVQ+DFN RR+L +ISAVLP GAPEVDPRTHRLKKPA    
Sbjct  166  DVLRPDGVIHGIERLIVPRSVQEDFNRRRNLAAISAVLPEGAPEVDPRTHRLKKPAPVPA  225

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDA+APGP++APAPAPGPGG  HHF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  226  GAPPVLP-IYDALAPGPSIAPAPAPGPGGPKHHFNGERQVKDFIHTLLHYGGYNEMADIL  284

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  285  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  344

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+ YDTLRLPHKV+A+E+
Sbjct  345  SMYNAVRRFGKVSYDTLRLPHKVLAQES  372



>gb|KEH24284.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=448

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+R++IP+SVQ+DFN RR+LR ISA+LP GAPEVDPRT+RLKKPA    
Sbjct  157  DVIRPDGVIHGIQRLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPA  216

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDA+APGP+LAPAPAPGPGG  HHF+GE QVKDFIQTLLHYGGYNE+ADIL
Sbjct  217  GAPPVLP-IYDALAPGPSLAPAPAPGPGGPRHHFNGERQVKDFIQTLLHYGGYNEMADIL  275

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  276  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  335

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI YDTLRLPHKVVA+E+
Sbjct  336  SMYNAVRRFGKISYDTLRLPHKVVAQES  363



>ref|XP_004506247.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Cicer 
arietinum]
Length=459

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQ DFN RRSL SI+A+ P GAPEVDPRTHRLKKPA P  A
Sbjct  163  VTRPDGVIHGIERLLIPRSVQDDFNRRRSLISIAAIKPEGAPEVDPRTHRLKKPAPPQEA  222

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP LPIYDA+APGP+LAPAPAPGPGG HHHF+GE+QVKDFIQTL+HYGGYNE+ADILV
Sbjct  223  GSPPVLPIYDALAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIQTLIHYGGYNEMADILV  282

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEM RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPG+PEQIMYYHLIPEYQTEES
Sbjct  283  NLTSLATEMSRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIMYYHLIPEYQTEES  342

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV A+EA
Sbjct  343  MYNAVRRFGKVRYDTLRLPHKVEAQEA  369



>ref|XP_004494272.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Cicer arietinum]
Length=453

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER++IP+SVQ+DFN RR+LR ISA+LP GAPEVDPRT+RLKKPA    
Sbjct  164  DVIRPDGVIHGIERLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPA  223

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG  HHF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  224  GAPPVLP-IYNAMAPGPSLAPAPAPGPGGARHHFNGERQVKDFIHTLLHYGGYNEMADIL  282

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  283  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  342

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+ YDTLRLPHKVVAEE+
Sbjct  343  SMYNAVRRFGKVSYDTLRLPHKVVAEES  370



>ref|XP_007010508.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 ref|XP_007010509.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19318.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19319.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
Length=454

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN RRSLRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  165  VDRPDGVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVLP  224

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTLL YGGYNE+ADILV
Sbjct  225  GAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLLQYGGYNEMADILV  284

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  285  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  344

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHKV+A+EA
Sbjct  345  MYNAVRRFGKVSYDTLRLPHKVLAQEA  371



>ref|XP_004494271.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Cicer arietinum]
Length=467

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER++IP+SVQ+DFN RR+LR ISA+LP GAPEVDPRT+RLKKPA    
Sbjct  164  DVIRPDGVIHGIERLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPA  223

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG  HHF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  224  GAPPVLP-IYNAMAPGPSLAPAPAPGPGGARHHFNGERQVKDFIHTLLHYGGYNEMADIL  282

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  283  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  342

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+ YDTLRLPHKVVAEE+
Sbjct  343  SMYNAVRRFGKVSYDTLRLPHKVVAEES  370



>gb|ABV27486.1| fasciclin-like arabinogalactan protein 15 [Gossypium hirsutum]
Length=460

 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN RRSLRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  171  VDRPDGVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  230

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  231  GAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  290

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  291  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  350

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHKV+A+EA
Sbjct  351  MYNAVRRFGKVSYDTLRLPHKVLAQEA  377



>gb|ABV27485.1| fasciclin-like arabinogalactan protein 14 [Gossypium hirsutum]
Length=459

 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSI+AVLP GAPEVDPRTHRLK PA    
Sbjct  171  DVIRPDGVIHGIQQLLIPRSVIEDFNRRRNLRSITAVLPEGAPEVDPRTHRLKNPAPIPV  230

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDAMAPGP+LAPAPAPGPGG  HHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  231  GAPPVLP-IYDAMAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++YDTLRLP KVVA+EA
Sbjct  350  SMYNAVRRFGKVKYDTLRLPRKVVAQEA  377



>ref|XP_006379436.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_006379437.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_002311924.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57233.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57234.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|EEE89291.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=439

 Score =   303 bits (775),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRT RLKKPA P   
Sbjct  171  VERPDGVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTQRLKKPAPPAKP  230

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  231  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIETLLLYGGYNEMADILV  290

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  291  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  350

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+A+EA
Sbjct  351  MYNAVRRFGKISYDTLRLPHKVLAQEA  377



>gb|KHG10334.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=468

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN RRSLRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  170  VDRPDGVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  229

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  230  GAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  289

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  290  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  349

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHKV+A+EA
Sbjct  350  MYNAVRRFGKVSYDTLRLPHKVLAQEA  376



>ref|XP_006379435.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57232.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=440

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRT RLKKPA P   
Sbjct  171  VERPDGVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTQRLKKPAPPAKP  230

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  231  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIETLLLYGGYNEMADILV  290

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  291  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHVIPEYQTEES  350

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGKI YDTLRLPHKV+A+EA
Sbjct  351  MYNAVRRFGKISYDTLRLPHKVLAQEA  377



>ref|XP_003554480.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Glycine 
max]
Length=455

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGIER+++P+SVQ+DFN RR+L +ISAVLP GAPEVDPRTHRLKKPA    
Sbjct  169  DVLRPDGVIHGIERLIVPRSVQEDFNRRRNLAAISAVLPEGAPEVDPRTHRLKKPAPVPA  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDAMAPGP+LAPAPAPGPGG  HHF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  229  GAPPVLP-IYDAMAPGPSLAPAPAPGPGGPKHHFNGERQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN VRRFGK+ YDTLRLPHKV+A+E+
Sbjct  348  SMYNTVRRFGKVSYDTLRLPHKVLAQES  375



>ref|XP_009130939.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
 ref|XP_009130940.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=458

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRT+RLKK   P P
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKKPAPAP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGSPPALPIKSAMAPGPSLAPAPAPGPGGKRHHFDGEAQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  348  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  375



>ref|XP_006287712.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
 gb|EOA20610.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
Length=459

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  P P
Sbjct  170  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  230  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  350  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  377



>gb|ABI95417.1| fasciclin-like protein FLA27 [Triticum aestivum]
Length=482

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+ PDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  185  VLSPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLP  244

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  245  GAPPVLPVWDAMAPGPSIAPAPAPGPGNGKHHFDGHSQVKDFIQTLVLYGGYNELADILV  304

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVS+GYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  305  NLTSLATEMGRLVSKGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  364

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  365  MYNAVRRFGKVRYDTLRLPHKVVAREA  391



>ref|XP_008392004.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=454

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV RPDGVIHGIE +LIP+ V+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKKPA    
Sbjct  168  DVTRPDGVIHGIESLLIPRXVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPVPA  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDA+APGP+LAPAPAPGPGG  HHFDGESQVKDFI TLLHYGGYNE+ADIL
Sbjct  228  GAPPVLP-IYDALAPGPSLAPAPAPGPGGPKHHFDGESQVKDFIHTLLHYGGYNEMADIL  286

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  287  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  346

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+V+RFGK+RYDTLRLPHKVVA+EA
Sbjct  347  SMYNSVKRFGKVRYDTLRLPHKVVAQEA  374



>gb|ACG39696.1| fasciclin domain [Zea mays]
Length=469

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  172  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  231

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  232  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  291

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  292  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  351

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  352  MYNAVRRFGKVRYDTLRLPHKVVAREA  378



>ref|XP_009122246.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=457

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKK   PVP
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGAPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  348  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  375



>gb|KJB73326.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=515

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN RRSLRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  226  VDRPDGVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  285

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  286  GAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  345

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  346  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  405

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHKV+A+EA
Sbjct  406  MYNAVRRFGKVSYDTLRLPHKVLAQEA  432



>emb|CDX81004.1| BnaC03g02580D [Brassica napus]
Length=488

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRT+RLKK   P P
Sbjct  166  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKKPAPAP  225

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+ PALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  226  AGSSPALPIKSAMAPGPSLAPAPAPGPGGKRHHFDGEAQVKDFIHTLLHYGGYNEMADIL  285

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAM KLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  286  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMVKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  345

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKVVA+EA
Sbjct  346  SMYNSVRRFGKVKFDTLRFPHKVVAKEA  373



>tpg|DAA51813.1| TPA: LOW QUALITY PROTEIN: fasciclin domain protein [Zea mays]
Length=464

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  168  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  228  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAM +LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAM-RLTTDQLSEPGSPENILYYHMIPEYQTEES  346

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  347  MYNAVRRFGKVRYDTLRLPHKVVAREA  373



>ref|XP_004955500.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Setaria 
italica]
Length=489

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+ FN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  187  VVRPDGVIHGIERLLVPRSVQEAFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPL  246

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GA P LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  247  GATPILPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  306

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  307  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPEDILYYHMVPEYQTEES  366

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV A EA
Sbjct  367  MYNAVRRFGKVRYDTLRLPHKVTAREA  393



>ref|NP_001051504.1| Os03g0788600 [Oryza sativa Japonica Group]
 gb|AAT75247.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99257.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13418.1| Os03g0788600 [Oryza sativa Japonica Group]
 dbj|BAG91233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76302.1| hypothetical protein OsI_13823 [Oryza sativa Indica Group]
 gb|EEE60067.1| hypothetical protein OsJ_12880 [Oryza sativa Japonica Group]
Length=474

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL  ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  177  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLADISAVLPTGAPEVDPRTHRLKKPAPPVPP  236

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  237  GAPPVLPIWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  296

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  297  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  356

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  357  MYNAVRRFGKVRYDTLRLPHKVVAREA  383



>ref|XP_004296276.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIH IER+LIP+SV+ DFN RRSLRSI+AV P GAPEVDPRT+RLKKPA P   
Sbjct  168  VTRPDGVIHAIERLLIPRSVEDDFNRRRSLRSITAVKPEGAPEVDPRTNRLKKPAPPSKP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDA+APGP+LAPAPAPGPGG HHHF+G +QVKDFIQTLLHYGGYNE+ADILV
Sbjct  228  GSSPVLPIYDALAPGPSLAPAPAPGPGGAHHHFNGHAQVKDFIQTLLHYGGYNEMADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  347

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ Y+TLRLP+KVVA+EA
Sbjct  348  MYNAVRRFGKVSYETLRLPNKVVAQEA  374



>ref|NP_196257.2| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
 sp|Q66GR0.1|FLA17_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 17; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAU05465.1| At5g06390 [Arabidopsis thaliana]
 gb|AAV74247.1| At5g06390 [Arabidopsis thaliana]
 gb|AED91009.1| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
Length=458

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKPA PVP
Sbjct  169  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVP  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  229  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKQHHFDGEAQVKDFIHTLLHYGGYNEMADIL  288

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  289  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  348

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  349  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  376



>ref|NP_001159324.1| uncharacterized protein LOC100304417 precursor [Zea mays]
 gb|ACN25805.1| unknown [Zea mays]
 gb|AFW67416.1| hypothetical protein ZEAMMB73_395863 [Zea mays]
Length=473

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  176  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  235

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  236  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  295

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  296  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  355

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  356  MYNAVRRFGKVRYDTLRLPHKVVAREA  382



>dbj|BAJ97817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA  VP 
Sbjct  165  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPTVPL  224

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  225  GAPPVLPVWDAMAPGPSIAPAPAPGPGFGKHHFDGHSQVKDFIQTLVLYGGYNELADILV  284

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  285  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEES  344

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFG +RYDTLRLP KV A EA
Sbjct  345  MYNAVRRFGTVRYDTLRLPQKVTAREA  371



>dbj|BAJ98684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA  VP 
Sbjct  165  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPTVPL  224

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  225  GAPPVLPVWDAMAPGPSIAPAPAPGPGFGKHHFDGHSQVKDFIQTLVLYGGYNELADILV  284

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  285  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEES  344

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFG +RYDTLRLP KV A EA
Sbjct  345  MYNAVRRFGTVRYDTLRLPQKVTAREA  371



>gb|ABI95415.1| fasciclin-like protein FLA25 [Triticum aestivum]
Length=459

 Score =   301 bits (770),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  162  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPL  221

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  222  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLVLYGGYNELADILV  281

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  282  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEES  341

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFG +RYDTLRLP KV A EA
Sbjct  342  MYNAVRRFGTVRYDTLRLPQKVTAREA  368



>ref|XP_010423345.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=459

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  PVP
Sbjct  170  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTAPVP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  230  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  350  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  377



>gb|ABV27487.1| fasciclin-like arabinogalactan protein 16 [Gossypium hirsutum]
Length=457

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN+RR+LRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  168  VNRPDGVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  228  GSPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  347

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYN VRRFGK+ YDTLRLPHKV A+EA
Sbjct  348  MYNTVRRFGKVSYDTLRLPHKVSAQEA  374



>dbj|BAB08961.1| unnamed protein product [Arabidopsis thaliana]
Length=465

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKPA PVP
Sbjct  169  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVP  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  229  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKQHHFDGEAQVKDFIHTLLHYGGYNEMADIL  288

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  289  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  348

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  349  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  376



>gb|KHG00930.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=434

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN+RR+LRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  168  VNRPDGVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  228  GSPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  347

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYN VRRFGK+ YDTLRLPHKV A+EA
Sbjct  348  MYNTVRRFGKVSYDTLRLPHKVSAQEA  374



>dbj|BAE71191.1| hypothetical protein [Trifolium pratense]
Length=454

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIHGI+R+LIP+SV+ DFN RRSLRSI+AV P GAP+VD R HRLKK   P   
Sbjct  157  LTRPDGVIHGIQRLLIPRSVEDDFNNRRSLRSITAVKPEGAPDVDIRNHRLKKYPPPEKP  216

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP LPIYDAM+PGP+LAPAPAPGPGG HHHF+GE+QVKDFI+TLLHYGGYNE+ADILV
Sbjct  217  GSPPVLPIYDAMSPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIKTLLHYGGYNEMADILV  276

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEM RLVSEGYVLTVLAPNDEAMAKLTT+QLSEPG+PE+IMYYH+IPEYQTEES
Sbjct  277  NLTSLATEMSRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGSPEEIMYYHIIPEYQTEES  336

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVAEEA
Sbjct  337  MYNAVRRFGKVRYDTLRLPHKVVAEEA  363



>emb|CDX98919.1| BnaC09g49160D [Brassica napus]
Length=457

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKK   PVP
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGAPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT DQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTADQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  348  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  375



>emb|CDY55758.1| BnaA03g55350D [Brassica napus]
Length=458

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPEVDPRT+RLKK   P P
Sbjct  169  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKKPAPTP  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  229  AGSPPALPIKSAMAPGPSLAPAPAPGPGGKRHHFDGEAQVKDFIHTLLHYGGYNEMADIL  288

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  289  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  348

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEE  623
            SMYN+VRRFGK+++DTLR PHKV A+E
Sbjct  349  SMYNSVRRFGKVKFDTLRFPHKVAAKE  375



>gb|KJB78512.1| hypothetical protein B456_013G003200 [Gossypium raimondii]
Length=457

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN+RR+LRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  168  VNRPDGVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  228  GSPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEES
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIYYHIIPEYQTEES  347

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYN VRRFGK+ YDTLRLPHKV A+EA
Sbjct  348  MYNTVRRFGKVSYDTLRLPHKVSAQEA  374



>ref|XP_010452564.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=456

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  PVP
Sbjct  167  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTAPVP  226

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  227  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  286

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  287  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  346

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  347  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  374



>emb|CDY57989.1| BnaA10g30360D [Brassica napus]
Length=457

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKK   PVP
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVP  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGAPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT DQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTADQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  348  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  375



>ref|XP_004981498.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Setaria 
italica]
Length=467

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  170  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  229

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGPA+APAPAPGP    HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  230  GAPPVLPIWDAMAPGPAIAPAPAPGPSSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  289

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  290  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEES  349

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV A EA
Sbjct  350  MYNAVRRFGKVRYDTLRLPHKVTAREA  376



>ref|XP_009399002.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+ VQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  184  VVRPDGVIHGIERLLVPRCVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  243

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPG   H FDGESQVKDFIQTLL YGGYNE ADILV
Sbjct  244  GAPPVLPIYDAMAPGPSLAPAPAPGPGHGKHWFDGESQVKDFIQTLLLYGGYNEFADILV  303

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTS+ATEMGRLVSEGYVLTVLAPND+AMA+LT DQLSEPGAPE IMYYHLIPEYQTEES
Sbjct  304  NLTSMATEMGRLVSEGYVLTVLAPNDDAMARLTADQLSEPGAPEAIMYYHLIPEYQTEES  363

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLR+PHKV+A EA
Sbjct  364  MYNAVRRFGKVRYDTLRVPHKVMAREA  390



>ref|XP_006399110.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40563.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=438

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP++VQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKK   PVP
Sbjct  170  DLTRPDGLIHGIERLLIPRAVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  230  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  350  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  377



>ref|XP_003557575.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brachypodium 
distachyon]
Length=489

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIE++LIP+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  186  VVRPDGVIHGIEKLLIPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLP  245

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGP     HFDG SQVKDFIQTL+ YGGYNELADILV
Sbjct  246  GAPPVLPVWDAMAPGPSIAPAPAPGPNSGKLHFDGHSQVKDFIQTLVLYGGYNELADILV  305

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEES
Sbjct  306  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEES  365

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFG +RYDTLRLP KV A EA
Sbjct  366  MYNAVRRFGTVRYDTLRLPQKVTAREA  392



>ref|XP_006399111.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40564.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=460

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP++VQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKK   PVP
Sbjct  170  DLTRPDGLIHGIERLLIPRAVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVP  229

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  230  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  290  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  349

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  350  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  377



>gb|EAZ38767.1| hypothetical protein OsJ_23169 [Oryza sativa Japonica Group]
Length=460

 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  175  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  234

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  235  GAPPVLPIWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLP+KV A EA
Sbjct  355  MYNAVRRFGKVRYDTLRLPNKVTAREA  381



>ref|NP_001058941.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAC79642.1| GPI-anchored protein -like [Oryza sativa Japonica Group]
 dbj|BAF20855.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAG89338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93771.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  175  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  234

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  235  GAPPVLPIWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  294

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  295  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  354

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLP+KV A EA
Sbjct  355  MYNAVRRFGKVRYDTLRLPNKVTAREA  381



>gb|EEC81554.1| hypothetical protein OsI_24980 [Oryza sativa Indica Group]
Length=484

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PVP 
Sbjct  202  VVRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPP  261

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPI+DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  262  GAPPVLPIWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  321

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  322  NLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEES  381

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLP+KV A EA
Sbjct  382  MYNAVRRFGKVRYDTLRLPNKVTAREA  408



>ref|XP_010491197.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=457

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  PV 
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTPPVL  227

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  228  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKRHHFDGEAQVKDFIHTLLHYGGYNEMADIL  287

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  288  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  347

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFG +++DTLR PHKV A+EA
Sbjct  348  SMYNSVRRFGNVKFDTLRFPHKVAAKEA  375



>ref|XP_002871217.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47476.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SI+AVLP GAPEVDPRT+RLKKPA PVP
Sbjct  169  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSITAVLPEGAPEVDPRTNRLKKPAAPVP  228

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG  HHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  229  AGSPPALPIQSAMAPGPSLAPAPAPGPGGKQHHFDGEAQVKDFIHTLLHYGGYNEMADIL  288

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  289  VNLTSLAMEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEE  348

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYN+VRRFGK+++DTLR PHKV A+EA
Sbjct  349  SMYNSVRRFGKVKFDTLRFPHKVAAKEA  376



>ref|XP_009121226.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=464

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 188/211 (89%), Gaps = 3/211 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPE+DPRT+RLKK A    
Sbjct  172  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSAAAAA  231

Query  183  agappalp---IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELA  353
            A    A P   I  AMAPGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+A
Sbjct  232  AVPAGAPPVLPIQSAMAPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMA  291

Query  354  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQ  533
            DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQ
Sbjct  292  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQ  351

Query  534  TEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TEESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  352  TEESMYNSVRRFGKVKYETLRFPHKVAAKEA  382



>ref|XP_007132513.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
 gb|ESW04507.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
Length=450

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIHGI+ +LIP+SVQ DFN RR+L SI+AV P  APEVDPRTHRLKKPA P PA
Sbjct  160  LTRPDGVIHGIDTLLIPRSVQDDFNRRRNLISIAAVKPESAPEVDPRTHRLKKPAPPSPA  219

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PALPIYDAMAPGP+LAPAPAPGPGG  HHF+GE QVKDFI+TLLHYGGYNE+ADILV
Sbjct  220  GSAPALPIYDAMAPGPSLAPAPAPGPGGPRHHFNGEKQVKDFIETLLHYGGYNEMADILV  279

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPG+PEQIMYYHLIPEYQTEES
Sbjct  280  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIMYYHLIPEYQTEES  339

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHK+ A+EA
Sbjct  340  MYNAVRRFGKVHYDTLRLPHKMTAQEA  366



>ref|XP_003543398.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006594907.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=455

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGI+R+L+P+SV+ DFN RRSLRSISAV P  APEVDPRTHRLKKP  P   
Sbjct  160  VTRPDGVIHGIDRLLLPRSVEDDFNRRRSLRSISAVKPEPAPEVDPRTHRLKKPPPPAKP  219

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  220  GSLPELPIYDAMAPGPSLAPAPAPGPGGPHHHFNGERQVKDFIHTLLHYGGYNEMADILV  279

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSL  EMGRLVSEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQIMYYH+IPEYQTEES
Sbjct  280  NLTSLDVEMGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIMYYHIIPEYQTEES  339

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  340  MYNAVRRFGKVRYDTLRLPHKVVAQEA  366



>ref|XP_006297639.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
 gb|EOA30537.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
Length=457

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPE+DPRT+RLKKPA+   
Sbjct  167  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAV  226

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  I  AMAPGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADI
Sbjct  227  PAGSPPVLPIQSAMAPGPSLAPAPAPGPGGARKHFNGDAQVKDFIHTLLHYGGYNEMADI  286

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTE
Sbjct  287  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTE  346

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  347  ESMYNSVRRFGKVKYETLRFPHKVGAKEA  375



>ref|XP_010486838.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=461

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPE+DPRT+RLKKPA+   
Sbjct  171  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAV  230

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  I  AMAPGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADI
Sbjct  231  PAGSPPVLPIQSAMAPGPSLAPAPAPGPGGARKHFNGDAQVKDFIHTLLHYGGYNEMADI  290

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTE
Sbjct  291  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTE  350

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  351  ESMYNSVRRFGKVKYETLRFPHKVGAKEA  379



>ref|XP_006592365.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=453

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGI+ +LIP+SVQ +FN RR+L SI+AV P  +PEVDPRTHRLKKPA   PA
Sbjct  163  VTRPDGVIHGIDTLLIPRSVQDEFNRRRNLISIAAVKPEPSPEVDPRTHRLKKPAPASPA  222

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPIYDAMAPGP+LAPAPAPGPGG  HHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  223  GSPPALPIYDAMAPGPSLAPAPAPGPGGPRHHFNGEKQVKDFIHTLLHYGGYNEMADILV  282

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPG+PEQIMYYHLIPEYQTEES
Sbjct  283  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIMYYHLIPEYQTEES  342

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV A+EA
Sbjct  343  MYNAVRRFGKVRYDTLRLPHKVTAQEA  369



>ref|XP_010464900.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=462

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPE+DPRT+RLKKPA+   
Sbjct  172  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAV  231

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  I  AMAPGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADI
Sbjct  232  PAGSPPVLPIQSAMAPGPSLAPAPAPGPGGARKHFNGDAQVKDFIHTLLHYGGYNEMADI  291

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTE
Sbjct  292  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTE  351

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  352  ESMYNSVRRFGKVKYETLRFPHKVGAKEA  380



>ref|XP_010497995.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X1 [Camelina sativa]
 ref|XP_010498004.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X2 [Camelina sativa]
Length=469

 Score =   296 bits (758),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPE+DPRT+RLKKPA+   
Sbjct  179  DLARPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAV  238

Query  183  agappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                P +  I  AMAPGP+LAPAPAPGPGG   HF+G++QVKDFI TLLHYGGYNE+ADI
Sbjct  239  PAGSPPVLPIQSAMAPGPSLAPAPAPGPGGARKHFNGDAQVKDFIHTLLHYGGYNEMADI  298

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTE
Sbjct  299  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTE  358

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  359  ESMYNSVRRFGKVKYETLRFPHKVGAKEA  387



>ref|XP_010685474.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 4/212 (2%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRL----KKpa  170
            DVVRPDGVIHGIER+L+P SV +DFN RRSLRSISAVLP GAP VDPRT++L    K   
Sbjct  167  DVVRPDGVIHGIERLLVPHSVLEDFNRRRSLRSISAVLPEGAPVVDPRTNKLIKKKKSVG  226

Query  171  npvpagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNEL  350
             P P GAPPALPIY AMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFI TL HYGGYNEL
Sbjct  227  PPPPPGAPPALPIYAAMAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFITTLTHYGGYNEL  286

Query  351  ADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEY  530
            ADILVNLTSLATEMGRLVSEGY++TVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEY
Sbjct  287  ADILVNLTSLATEMGRLVSEGYLITVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHMIPEY  346

Query  531  QTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            QTEESMYNAVRRFGKI+YDTLRLPHK+ AEEA
Sbjct  347  QTEESMYNAVRRFGKIKYDTLRLPHKMTAEEA  378



>gb|KDP42957.1| hypothetical protein JCGZ_23899 [Jatropha curcas]
Length=458

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDG+IHGIER+LIP+SV+ DFN RR+LRSI+AV P GAPEVDPRT+RLKKPA P   
Sbjct  169  VIRPDGIIHGIERLLIPQSVENDFNRRRTLRSITAVKPEGAPEVDPRTNRLKKPAPPAKP  228

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+PPALPI+DA+APGP+LAPAPAPGPGG HHHF+GE+QVKDFI TLL YGGYNE ADI+V
Sbjct  229  GSPPALPIFDALAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIATLLQYGGYNEFADIMV  288

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT +QLSEPGAPEQIMYYHLIPEYQTEES
Sbjct  289  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTAEQLSEPGAPEQIMYYHLIPEYQTEES  348

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ Y+TLR+PHKVVA+EA
Sbjct  349  MYNAVRRFGKVNYETLRVPHKVVAQEA  375



>ref|XP_003527510.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006582372.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=447

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGI+ +LIP+SVQ +FN RR+L SI+AV P  +PEVDPRTHRLKKPA   PA
Sbjct  156  VTRPDGVIHGIDTLLIPRSVQDEFNRRRNLISIAAVKPEPSPEVDPRTHRLKKPAPASPA  215

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPPALPIYDAMAPGP+LAPAPAPGPGG H HF+GE QVKDFI+TLLHYGGYNE+ADILV
Sbjct  216  GAPPALPIYDAMAPGPSLAPAPAPGPGGSHKHFNGEKQVKDFIETLLHYGGYNEMADILV  275

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL T+QLSEPG+PEQIMYYHLIPEYQTEES
Sbjct  276  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLATEQLSEPGSPEQIMYYHLIPEYQTEES  335

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKV A+EA
Sbjct  336  MYNAVRRFGKVRYDTLRLPHKVTAQEA  362



>ref|XP_006407421.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
 gb|ESQ48874.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
Length=464

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 189/211 (90%), Gaps = 3/211 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAVLP GAPE+DPRT+RLKK A    
Sbjct  172  DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKSAAASV  231

Query  183  agappa---lpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELA  353
            A    +   LPI  AMAPGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+A
Sbjct  232  AVPAGSPPVLPIQSAMAPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMA  291

Query  354  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQ  533
            DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQ
Sbjct  292  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQ  351

Query  534  TEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TEESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  352  TEESMYNSVRRFGKVKYETLRFPHKVAAKEA  382



>emb|CDY08502.1| BnaA05g27380D [Brassica napus]
Length=456

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 185/210 (88%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRT+RLKK +    
Sbjct  166  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKASAAAA  225

Query  183  agappalp--IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A       I  AMAPGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+AD
Sbjct  226  VPAGSPPVLPIQSAMAPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMAD  285

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQT
Sbjct  286  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQT  345

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRFGK+ Y+TLR PHKV A+EA
Sbjct  346  EESMYNSVRRFGKVNYETLRFPHKVAAKEA  375



>ref|XP_002882744.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59003.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPE+DPRT+RLKK A    
Sbjct  168  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSAAAAS  227

Query  183  agapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A    ALPI  AMAPGP+LAPAPAPGPGG H HF+G++QVKDFI TLLHYGGYNE+AD
Sbjct  228  VPAGSPPALPIESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMAD  287

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQT
Sbjct  288  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQT  347

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  348  EESMYNSVRRFGKVKYETLRFPHKVGAKEA  377



>ref|XP_003540278.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=454

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGI+R+L+P+SV+ DFN RRSLRSI+AV P  +PE+DPRTHRLKKP  PV  
Sbjct  158  VTRPDGVIHGIDRLLLPRSVEDDFNRRRSLRSITAVKPEPSPEIDPRTHRLKKPPPPVKP  217

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGPALAPAPAPGPGG HHHF+GE QV+DFI TLLHYGGYNE+ADILV
Sbjct  218  GSSPELPIYDAMAPGPALAPAPAPGPGGPHHHFNGERQVEDFIHTLLHYGGYNEMADILV  277

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQIMYYH+IPEYQTEES
Sbjct  278  NLTSLAVEMGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIMYYHIIPEYQTEES  337

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  338  MYNAVRRFGKVRYDTLRLPHKVVAQEA  364



>ref|XP_007150000.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
 gb|ESW21994.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
Length=457

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            + RPDGVIH I+R+L+P+SV+ DFN RR+LRSISAV P GAPEVDPRTHRLKKP  P   
Sbjct  162  LTRPDGVIHAIDRLLLPRSVEHDFNRRRTLRSISAVKPEGAPEVDPRTHRLKKPPPPAKP  221

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ PAL IYDA++PGP+LAPAPAPGPGG HHHF+GE QVKDFI TLLHYGGYNE+ADILV
Sbjct  222  GSSPALSIYDALSPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIHTLLHYGGYNEMADILV  281

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLA EMG LVSEGY+LTVLAPNDEA+AKLTT+QLSEPGAPE+IMYYH+IPEYQTEES
Sbjct  282  NLTSLAVEMGHLVSEGYILTVLAPNDEAVAKLTTEQLSEPGAPERIMYYHIIPEYQTEES  341

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  342  MYNAVRRFGKVRYDTLRLPHKVVAQEA  368



>ref|XP_006826417.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
 gb|ERM93654.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
Length=470

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +VRPDGVIHGIER+LIP+SVQ +FN RRSL SI AVLP GAPEVDPRT RLKKPA+  PA
Sbjct  176  IVRPDGVIHGIERLLIPRSVQAEFNKRRSLTSIQAVLPEGAPEVDPRTARLKKPAHSAPA  235

Query  186  ga-ppalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
                P LPIY AMAPGP+LAPAPAPGPG  HH FDGESQ+KDFI TLLHYGGYNELADIL
Sbjct  236  PPYTPTLPIYAAMAPGPSLAPAPAPGPGSGHHWFDGESQIKDFIHTLLHYGGYNELADIL  295

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+LVSEGYV+TVLAPNDEAMA+LT DQLSEPGAPEQI+YYH+IPEYQTEE
Sbjct  296  VNLTSLATEMGKLVSEGYVITVLAPNDEAMAQLTADQLSEPGAPEQIVYYHVIPEYQTEE  355

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK++Y+TLRLPHK+VAEEA
Sbjct  356  SMYNAVRRFGKLQYETLRLPHKLVAEEA  383



>gb|AAF02137.1|AC009918_9 unknown protein [Arabidopsis thaliana]
Length=447

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPE+DPRT+RLKK A  V 
Sbjct  170  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVS  229

Query  183  agapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A     LPI  AMAPGP+LAPAPAPGPGG H HF+G++QVKDFI TLLHYGGYNE+AD
Sbjct  230  VPAGSPPVLPIESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMAD  289

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAM KLTTDQLSEPGAPEQIMYYH+IPEYQT
Sbjct  290  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMGKLTTDQLSEPGAPEQIMYYHIIPEYQT  349

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  350  EESMYNSVRRFGKVKYETLRFPHKVGAKEA  379



>ref|NP_566398.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
 sp|Q93W32.1|FLA18_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 18; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07046.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24265.1| AT3g11700/T19F11_10 [Arabidopsis thaliana]
 gb|AAM91728.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75085.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
Length=462

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPE+DPRT+RLKK A  V 
Sbjct  170  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVS  229

Query  183  agapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A     LPI  AMAPGP+LAPAPAPGPGG H HF+G++QVKDFI TLLHYGGYNE+AD
Sbjct  230  VPAGSPPVLPIESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMAD  289

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAM KLTTDQLSEPGAPEQIMYYH+IPEYQT
Sbjct  290  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMGKLTTDQLSEPGAPEQIMYYHIIPEYQT  349

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  350  EESMYNSVRRFGKVKYETLRFPHKVGAKEA  379



>emb|CDY01050.1| BnaC05g41500D [Brassica napus]
Length=463

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRT+RLKK A    
Sbjct  173  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKSAAAAA  232

Query  183  agapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A     LPI  AMAPGP+LAPAPAPGPGG  HHF+G++QVKDFI TLLHYGGYNE+AD
Sbjct  233  VPAGSPPVLPIQSAMAPGPSLAPAPAPGPGGPRHHFNGDAQVKDFIHTLLHYGGYNEMAD  292

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQT
Sbjct  293  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQT  352

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRFGK+ Y+TLR PHKV A+EA
Sbjct  353  EESMYNSVRRFGKVNYETLRFPHKVAAKEA  382



>ref|XP_009146690.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=456

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RR+LRSISAVLP GAPEVDPRT+RLKK A    
Sbjct  166  DLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKSAAAAA  225

Query  183  agapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
              A     LPI  A+APGP+LAPAPAPGPGG  HHF+GE+QVKDFI TLLHYGGYNE+AD
Sbjct  226  VPAGSPPVLPIQSAIAPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMAD  285

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQT
Sbjct  286  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQT  345

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYN+VRRF K+ Y+TLR PHKV A+EA
Sbjct  346  EESMYNSVRRFRKVNYETLRFPHKVAAKEA  375



>ref|XP_002515862.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46531.1| conserved hypothetical protein [Ricinus communis]
Length=464

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDG+IHGIERVLIP+SV+ +FN RR+LRSISAV P GAPE+DPRT+RLKKP++    
Sbjct  171  VTRPDGIIHGIERVLIPQSVEDEFNRRRNLRSISAVKPEGAPEIDPRTNRLKKPSSLPAK  230

Query  186  gappalp-IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P +  I+DAMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFI TLL YGGYNE ADI+
Sbjct  231  PGSPPVLPIFDAMAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFIATLLQYGGYNEFADIM  290

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTS+A EMG+LVSEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQIMYYHL+PEYQTEE
Sbjct  291  VNLTSIANEMGKLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIMYYHLVPEYQTEE  350

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+ Y+TLR+PHKVVA EA
Sbjct  351  SMYNAVRRFGKVNYETLRVPHKVVAMEA  378



>ref|XP_010090522.1| hypothetical protein L484_017146 [Morus notabilis]
 gb|EXB39671.1| hypothetical protein L484_017146 [Morus notabilis]
Length=459

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 181/209 (87%), Gaps = 2/209 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+L+P+SV  DFN RRSL+SI+AV P GAPEVD R  + K       A
Sbjct  169  VTRPDGVIHGIERMLVPRSVVDDFNKRRSLQSITAVKPEGAPEVDLRRAKKKGVDLVSKA  228

Query  186  gapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
                  A+ IY+A+APGP+LAPAPAPGPGG HHHFDGE QVKDFIQTLL YGGYNE+ADI
Sbjct  229  KPGSPPAVSIYEALAPGPSLAPAPAPGPGGPHHHFDGERQVKDFIQTLLQYGGYNEMADI  288

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+EMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE
Sbjct  289  LVNLTSLASEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  348

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGKI YDTLRLPHKVVA+EA
Sbjct  349  ESMYNAVRRFGKIGYDTLRLPHKVVAQEA  377



>ref|XP_002461483.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
 gb|EER98004.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
Length=471

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            VVR DGVIHG++R+L+P+SVQ  FN RRSL  SISA LPTGAPEVDPRTHRL +  +P P
Sbjct  171  VVRADGVIHGVDRLLVPRSVQDAFNRRRSLASSISAALPTGAPEVDPRTHRLLRKLSPGP  230

Query  183  agappalp---IYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELA  353
            A    A P   ++DAMAPGP++APAPAPGPG   H FDG  QVKDFIQTLL YGGYNELA
Sbjct  231  APPLGAPPALPVWDAMAPGPSIAPAPAPGPGTGTHRFDGHGQVKDFIQTLLLYGGYNELA  290

Query  354  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQ  533
            DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQ
Sbjct  291  DILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHVIPEYQ  350

Query  534  TEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TEESMYNAVRRFGK+RYDTLRLPHKV A EA
Sbjct  351  TEESMYNAVRRFGKVRYDTLRLPHKVTAREA  381



>ref|XP_007163001.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
 gb|ESW34995.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
Length=437

 Score =   277 bits (709),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 177/208 (85%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+VRPDGVIHGIER+L+P+SVQ+DFN R             APE+DPRTHRLKK A    
Sbjct  165  DIVRPDGVIHGIERLLVPRSVQEDFNRR-------------APEIDPRTHRLKKSAPVPA  211

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IYDAMAPGP++APAPAPGPGG  HH++GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  212  GAPPVLP-IYDAMAPGPSIAPAPAPGPGGAKHHYNGERQVKDFIHTLLHYGGYNEMADIL  270

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  271  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEE  330

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+ YDTLRLPHKV+A+E+
Sbjct  331  SMYNAVRRFGKVSYDTLRLPHKVLAQES  358



>ref|XP_010677585.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +++PDG+IHGI+RVL+P SV ++FN RR LRSISAVLPT AP +D R     + A   PA
Sbjct  161  IIKPDGLIHGIDRVLVPHSVLEEFNNRRELRSISAVLPTSAPTMDSRKRTQHRGAKMGPA  220

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPPA+PI+DA+APGP+LAPAPAPGPGG HHHFDG SQVKDFI TL HYGGYNELADILV
Sbjct  221  GAPPAVPIFDALAPGPSLAPAPAPGPGGPHHHFDGASQVKDFITTLTHYGGYNELADILV  280

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYV+TVLAPNDEAM +LT DQLSEPGAPEQIMYYH+IPEYQTEES
Sbjct  281  NLTSLATEMGRLVSEGYVITVLAPNDEAMGRLTADQLSEPGAPEQIMYYHIIPEYQTEES  340

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MY++VRRFGK+ Y+TLRLPHKV+AEEA
Sbjct  341  MYSSVRRFGKVNYETLRLPHKVMAEEA  367



>ref|XP_004487436.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cicer 
arietinum]
Length=454

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 182/209 (87%), Gaps = 2/209 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpan--pv  179
            + RPDGVIHGI+ +LIP+SV  DFN RRSLRSI+AV P  +PEVD R H+LKK       
Sbjct  159  ITRPDGVIHGIQNLLIPRSVVDDFNRRRSLRSITAVKPEPSPEVDTRNHKLKKQKQPPSE  218

Query  180  pagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
              G+ P LPIY+AM+PGP+LAPAPAPGPG  HHHF+G++ VKDFI+TL+ YGGYNE+ADI
Sbjct  219  KPGSLPKLPIYEAMSPGPSLAPAPAPGPGSPHHHFNGDANVKDFIKTLIRYGGYNEMADI  278

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLATEM RLVSEGYVLTVLAPNDEA+ KLTT+QLSEPG+PE+IMYYH+IPEYQTE
Sbjct  279  LVNLTSLATEMSRLVSEGYVLTVLAPNDEAIGKLTTEQLSEPGSPEEIMYYHIIPEYQTE  338

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK+RYDTLRLPHKV+AEEA
Sbjct  339  ESMYNAVRRFGKVRYDTLRLPHKVLAEEA  367



>gb|AAT75258.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99261.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=460

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVR DGVIHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKPA P  +
Sbjct  189  VVRTDGVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPAPPGDS  248

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
               P   I DA  P P++A A  P        +DG+SQVKDFIQTLL YGGYNELADI V
Sbjct  249  PVLP---ISDATVPDPSVALASEPSDH-----YDGDSQVKDFIQTLLKYGGYNELADIFV  300

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATE+ +LVSEGY LTVLAPNDEAMA+LT DQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  301  NLTSLATELAQLVSEGYALTVLAPNDEAMARLTADQLSEPGSPENILYYHMIPEYQTEES  360

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  361  MYNAVRRFGKVRYDTLRLPHKVVAREA  387



>ref|NP_001051505.1| Os03g0788700 [Oryza sativa Japonica Group]
 gb|AAT75257.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99260.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13419.1| Os03g0788700 [Oryza sativa Japonica Group]
 dbj|BAG93670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVR DGVIHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKPA P  +
Sbjct  189  VVRTDGVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPAPPGDS  248

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
               P   I DA  P P++A A  P        +DG+SQVKDFIQTLL YGGYNELADI V
Sbjct  249  PVLP---ISDATVPDPSVALASEPSDH-----YDGDSQVKDFIQTLLKYGGYNELADIFV  300

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATE+ +LVSEGY LTVLAPNDEAMA+LT DQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  301  NLTSLATELAQLVSEGYALTVLAPNDEAMARLTADQLSEPGSPENILYYHMIPEYQTEES  360

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  361  MYNAVRRFGKVRYDTLRLPHKVVAREA  387



>gb|AAO24903.1| putative arabinogalactan-protein [Oryza sativa Japonica Group]
 gb|EAZ28848.1| hypothetical protein OsJ_12883 [Oryza sativa Japonica Group]
Length=494

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVR DGVIHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKPA P  +
Sbjct  189  VVRTDGVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPAPPGDS  248

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
               P   I DA  P P++A A  P        +DG+SQVKDFIQTLL YGGYNELADI V
Sbjct  249  PVLP---ISDATVPDPSVALASEPSDH-----YDGDSQVKDFIQTLLKYGGYNELADIFV  300

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATE+ +LVSEGY LTVLAPNDEAMA+LT DQLSEPG+PE I+YYH+IPEYQTEES
Sbjct  301  NLTSLATELAQLVSEGYALTVLAPNDEAMARLTADQLSEPGSPENILYYHMIPEYQTEES  360

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  361  MYNAVRRFGKVRYDTLRLPHKVVAREA  387



>gb|EAY92117.1| hypothetical protein OsI_13824 [Oryza sativa Indica Group]
Length=494

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVR DGVIHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKPA P  +
Sbjct  189  VVRTDGVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPAPPGDS  248

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
               P   I DA  P P++A A  P        +DG+SQVKDFIQTLL YGGYNELADI V
Sbjct  249  PVLP---ISDATVPDPSVALASEPSDH-----YDGDSQVKDFIQTLLKYGGYNELADIFV  300

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATE+ +LVSEGY LTVLAPNDEAMA+LT DQLSEPG+PE I+YYH++PEYQTEES
Sbjct  301  NLTSLATELAQLVSEGYALTVLAPNDEAMARLTADQLSEPGSPENILYYHMVPEYQTEES  360

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  361  MYNAVRRFGKVRYDTLRLPHKVVAREA  387



>ref|XP_011076879.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Sesamum 
indicum]
Length=464

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 185/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKpanpvp  182
            VVRPDG+IHGIE+V+IPKSV+++FN RR+L+SISAV P GAPE+DPR+ +L K+ AN +P
Sbjct  167  VVRPDGIIHGIEKVIIPKSVEREFNNRRNLQSISAVKPEGAPEIDPRSRKLPKRKANEIP  226

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
                  L +Y+AMAP P+LAPAPAPGPGG HHHF GE QVKDFIQTLL YGGYNE+ADIL
Sbjct  227  MDGAQKLSVYEAMAPAPSLAPAPAPGPGGPHHHFHGEKQVKDFIQTLLLYGGYNEMADIL  286

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMG+L+SEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQI+YYH++PEYQTEE
Sbjct  287  VNLTSLATEMGKLISEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIVYYHIVPEYQTEE  346

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFG + YDTL L HK+VA+EA
Sbjct  347  SMYNAVRRFGSVSYDTLSLHHKIVAKEA  374



>ref|XP_006651891.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 16-like [Oryza brachyantha]
Length=464

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 160/206 (78%), Gaps = 7/206 (3%)
 Frame = +3

Query  9    VRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpag  188
            +RPDGVIHGIER+L+P+SVQ+DFN RRSL  ISA+ PT AP+VDPRT  L+KP     A 
Sbjct  167  LRPDGVIHGIERLLVPRSVQEDFNRRRSLADISAMPPTAAPQVDPRTQPLEKPPPSASAV  226

Query  189  appalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILVN  368
             P    I        A A  P+         +DGE QVKDFIQ+LL YGGYNELADILVN
Sbjct  227  LPTPNAIVPDDPSVVAQASEPSGR-------YDGEGQVKDFIQSLLKYGGYNELADILVN  279

Query  369  LTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESM  548
            LTSLA E+ +LVSEGY LTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQ+EESM
Sbjct  280  LTSLAAEVAQLVSEGYTLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQSEESM  339

Query  549  YNAVRRFGKIRYDTLRLPHKVVAEEA  626
            YNAVRRFG +RYDTLRLPHKVVA EA
Sbjct  340  YNAVRRFGAVRYDTLRLPHKVVAREA  365



>ref|XP_010685475.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 178/208 (86%), Gaps = 15/208 (7%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DVVRPDGVIHGIER+L+P SV +DFN RRSLRSISAV                    P P
Sbjct  167  DVVRPDGVIHGIERLLVPHSVLEDFNRRRSLRSISAV---------------LPEGPPPP  211

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
             GAPPALPIY AMAPGP+LAPAPAPGPGG HHHF+GE+QVKDFI TL HYGGYNELADIL
Sbjct  212  PGAPPALPIYAAMAPGPSLAPAPAPGPGGPHHHFNGEAQVKDFITTLTHYGGYNELADIL  271

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGY++TVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEE
Sbjct  272  VNLTSLATEMGRLVSEGYLITVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHMIPEYQTEE  331

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGKI+YDTLRLPHK+ AEEA
Sbjct  332  SMYNAVRRFGKIKYDTLRLPHKMTAEEA  359



>ref|XP_003596932.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES67183.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=446

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 3/208 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGI+++LIP++V  DFN RRSL SI+AV P GAPE D R  +LKK +   P
Sbjct  150  DITRPDGVIHGIQKILIPRAVVDDFNNRRSLSSITAVKPEGAPEADTR--KLKKSSPEKP  207

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+A+APGP+LAPAPAPGPGG HHHF+G+ QVKDFI+TLLHYGGY E+ADIL
Sbjct  208  GSPPEIP-IYEALAPGPSLAPAPAPGPGGPHHHFNGDLQVKDFIKTLLHYGGYKEMADIL  266

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEM RLVSEGYVLTVLAPNDEAMAKLTT++LSEPG+PE+IMYYH+IPEYQTEE
Sbjct  267  VNLTSLATEMSRLVSEGYVLTVLAPNDEAMAKLTTEELSEPGSPEEIMYYHIIPEYQTEE  326

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RY+TLRL +KVVA+EA
Sbjct  327  SMYNAVRRFGKVRYETLRLKYKVVAQEA  354



>ref|XP_006487826.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=452

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 2/209 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKpanpv  179
            + RPDG IHGI ++++P+SVQ +FN RR+L SI+AV P  APE+DPR  T +L KP   V
Sbjct  157  ITRPDGTIHGISQLMVPRSVQNEFNRRRNLDSIAAVKPEAAPEIDPRVITKKLNKPVFKV  216

Query  180  pagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
               +PP LPI++A+A GP  APA  P PGG  HHFDG  QVKDFI+TL+HYGGYNE+ADI
Sbjct  217  KPDSPPVLPIFEAIAAGPGQAPASDPAPGGPRHHFDGHIQVKDFIKTLVHYGGYNEMADI  276

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+E+G+LVSEGYVLT+LAPNDEAM KLTTDQLSEPGA EQIMYYH++ EYQTE
Sbjct  277  LVNLTSLASEIGKLVSEGYVLTILAPNDEAMVKLTTDQLSEPGAAEQIMYYHMVAEYQTE  336

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK+ YDTLR+PHKVVA EA
Sbjct  337  ESMYNAVRRFGKVEYDTLRVPHKVVAVEA  365



>ref|XP_010917919.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Elaeis 
guineensis]
Length=544

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 167/210 (80%), Gaps = 7/210 (3%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDF-NTRRSLRSISAVLPTGAPEVDPRT--HRLKKpanp  176
            VVRPDGVIHGIER+L+P+SVQ+++ N RR L S++AVLPTGAPE DPRT  HRL      
Sbjct  255  VVRPDGVIHGIERMLVPRSVQEEYLNRRRRLSSVAAVLPTGAPEADPRTTGHRLFPSRPV  314

Query  177  vpagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
             P+  P             A + APAP PG     FDGES+V+DFIQ+L+ YGGYNELAD
Sbjct  315  SPSDGPTT----SPDPAVAAPSSAPAPAPGSAFQVFDGESEVRDFIQSLIRYGGYNELAD  370

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            +L NLTSLA+EMGRLVSEGYVLTVLAPNDEAM KLT +QLSE GAPE+++YYHLIPEYQT
Sbjct  371  VLANLTSLASEMGRLVSEGYVLTVLAPNDEAMGKLTAEQLSEAGAPERMVYYHLIPEYQT  430

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYNAVRRFGK+RYDTLR+PHKVVA EA
Sbjct  431  EESMYNAVRRFGKVRYDTLRVPHKVVAREA  460



>ref|XP_008790162.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Phoenix 
dactylifera]
Length=549

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQD-FNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            VVRPDGVIHGIE++L+P+SVQ+  FN RR L S++AVLPTGAP+VDPR  R      P  
Sbjct  260  VVRPDGVIHGIEQMLVPRSVQEAYFNRRRRLSSVAAVLPTGAPKVDPR--RTGNRLLPSK  317

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
              +P   P         + A  PAP PG     FDGES+V+DFI +L+ YGGY ELAD+L
Sbjct  318  PVSPAGGPTTSPDPAVASPASDPAPAPGSAVQVFDGESEVRDFIHSLIQYGGYGELADVL  377

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEE  542
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAM KLT +QLSEPGAPE+++YYHLIPEYQTEE
Sbjct  378  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMGKLTMEQLSEPGAPERMVYYHLIPEYQTEE  437

Query  543  SMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            SMYNAVRRFGK+RYDTLR+PHKVVA EA
Sbjct  438  SMYNAVRRFGKVRYDTLRVPHKVVAREA  465



>gb|KJB73327.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=443

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 177/207 (86%), Gaps = 17/207 (8%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIE++LIP+SVQQDFN RRSLRSISAV P GAPEVDPRTHRLKKPA PV  
Sbjct  171  VDRPDGVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKP  230

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LPIYDAMAPGP+LAPAPAPGPGG HHHF+G  QVKDFIQTL+ YGGYNE+ADILV
Sbjct  231  GAPPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGMRQVKDFIQTLIQYGGYNEMADILV  290

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMGRLVSEGYVLTVLAPND                 EQI+YYH+IPEYQTEES
Sbjct  291  NLTSLATEMGRLVSEGYVLTVLAPND-----------------EQIIYYHIIPEYQTEES  333

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+ YDTLRLPHKV+A+EA
Sbjct  334  MYNAVRRFGKVSYDTLRLPHKVLAQEA  360



>ref|XP_010908912.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Elaeis 
guineensis]
Length=416

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 144/207 (70%), Gaps = 48/207 (23%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RR+L       P  AP      H           
Sbjct  172  VIRPDGVIHGIERLLVPRSVQEDFNRRRTL------APAPAPGPGSGKH-----------  214

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
                                            FDGESQVKDFIQTLL YGGYNELADILV
Sbjct  215  -------------------------------WFDGESQVKDFIQTLLLYGGYNELADILV  243

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSLATEMG LVSEGYVLTVLAPNDEAMAKLT DQLSEPGAPEQI+YYHLIPEYQTEES
Sbjct  244  NLTSLATEMGHLVSEGYVLTVLAPNDEAMAKLTADQLSEPGAPEQIVYYHLIPEYQTEES  303

Query  546  MYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            MYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  304  MYNAVRRFGKVRYDTLRLPHKVVAREA  330



>gb|EPS68119.1| hypothetical protein M569_06649, partial [Genlisea aurea]
Length=370

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 175/209 (84%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAV-LPTGAPEVDPRTHRLKKpanpv  179
            DVVRPDG++HGIER+LIPKSV+ +F+ RRSL S S+V +P GAPE D    +LK PA P 
Sbjct  133  DVVRPDGIVHGIERLLIPKSVRHEFDARRSLISASSVVIPDGAPEFD---LQLKAPAAPP  189

Query  180  pagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
             +  P    + DA+APG  +APAPAPGPGG + H DGESQVKDFI+TLL YGGY+E AD+
Sbjct  190  VSVLP----VSDALAPGSDIAPAPAPGPGGPNRHIDGESQVKDFIETLLRYGGYSETADV  245

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+EMGRL+S+GYVLTVLAPNDEAM+KLT + LSEPGAPEQIMY+HL+PEYQTE
Sbjct  246  LVNLTSLASEMGRLISDGYVLTVLAPNDEAMSKLTAELLSEPGAPEQIMYHHLMPEYQTE  305

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYN+VRRFGK+RY TL  PHK+VAEEA
Sbjct  306  ESMYNSVRRFGKVRYGTLSPPHKLVAEEA  334



>gb|ABK25415.1| unknown [Picea sitchensis]
Length=464

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 169/209 (81%), Gaps = 4/209 (2%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            VVRPDGVIHGI+R+LIPKSVQ DF+  RS  S+ AV+P GAP +DP   +L K       
Sbjct  166  VVRPDGVIHGIDRMLIPKSVQDDFSKWRSGVSL-AVMPQGAPVLDP-IKKLSKSVAASSL  223

Query  186  gapp--alpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
             A       IY A+APGP+LAPAPAPGP   H+ FDGESQVKDFI TL+ YGGYNE+ADI
Sbjct  224  SAKSPPIHSIYYALAPGPSLAPAPAPGPSTGHYWFDGESQVKDFINTLVLYGGYNEMADI  283

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+E+ +LVSEGY +TVLAPNDEAM +LTT+QLSEPGA E IMYYH+IPEYQTE
Sbjct  284  LVNLTSLASELAKLVSEGYKVTVLAPNDEAMGELTTEQLSEPGAQEHIMYYHIIPEYQTE  343

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK++YDTLR+PHK+ ++EA
Sbjct  344  ESMYNAVRRFGKMKYDTLRIPHKITSQEA  372



>gb|AEN82905.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82906.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82907.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82908.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82909.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82910.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82911.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82912.1| AT5G06390-like protein, partial [Capsella rubella]
Length=186

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  P P
Sbjct  18   DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKP  77

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  78   AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  137

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  509
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY
Sbjct  138  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  186



>gb|AEN82899.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82900.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82901.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82902.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82903.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82904.1| AT5G06390-like protein, partial [Capsella grandiflora]
Length=186

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDG+IHGIER+LIP+SVQ+DFN RRSL+SISAVLP GAPEVDPRT+RLKKP  P P
Sbjct  18   DLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKP  77

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PPALPI  AMAPGP+LAPAPAPGPGG HHHFDGE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  78   AGSPPALPIQSAMAPGPSLAPAPAPGPGGKHHHFDGEAQVKDFIHTLLHYGGYNEMADIL  137

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  509
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY
Sbjct  138  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  186



>ref|XP_006424052.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
 gb|ESR37292.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
Length=442

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 165/209 (79%), Gaps = 12/209 (6%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKpanpv  179
            + RPDG IHGI ++++P          R+L SI+AV P  APE+DPR  T +L KP   V
Sbjct  157  ITRPDGTIHGISQLMVP----------RNLDSIAAVKPEAAPEIDPRVITKKLNKPVFNV  206

Query  180  pagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
               +PP LPI +A+A GP  APA AP PGG   HFDG  QVKDFI+TL+HYGGYNE+ADI
Sbjct  207  KPYSPPVLPISEAIAAGPGQAPASAPAPGGPRDHFDGHIQVKDFIKTLVHYGGYNEMADI  266

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+E+G+LVSEGYVLT+LAPNDEAM KLTTDQLSEPGA EQIMYYH++ EYQTE
Sbjct  267  LVNLTSLASEIGKLVSEGYVLTILAPNDEAMVKLTTDQLSEPGAAEQIMYYHMVAEYQTE  326

Query  540  ESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            ESMYNAVRRFGK+ +DTLR+PHKVVA EA
Sbjct  327  ESMYNAVRRFGKVEFDTLRVPHKVVAVEA  355



>gb|EYU19863.1| hypothetical protein MIMGU_mgv1a006599mg [Erythranthe guttata]
Length=437

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 162/210 (77%), Gaps = 7/210 (3%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTR--RSLRSISAVL-PTGAPEVDPRTHRLKKpanp  176
            +VR DG+IHG+E+V++PKSV++DFN    R+ RS++A + P GAPE++PRT++L K    
Sbjct  181  IVRHDGIIHGVEKVIVPKSVERDFNNNNGRNPRSVAAAVEPEGAPEINPRTNKLSKRNAI  240

Query  177  vpagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
               G      IY       A   +P+P PGG HHH DGE QV +FIQTL  YGGYNE+A+
Sbjct  241  SAPGGGANT-IY---KATAAPEHSPSPAPGGPHHHLDGEKQVNNFIQTLTFYGGYNEMAE  296

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            ILVNLT+LA E+G L++EGY  TVLAP+DEAMAKLTTDQLS+ GAPE+I+YYH++PEYQT
Sbjct  297  ILVNLTNLAAELGNLINEGYAFTVLAPSDEAMAKLTTDQLSDSGAPERIVYYHIVPEYQT  356

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            EESMYNAVRRF  + YDTLRLPHK+VA++A
Sbjct  357  EESMYNAVRRFKTVSYDTLRLPHKIVAKDA  386



>ref|XP_006388929.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
 gb|ERP47843.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
Length=361

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGI+R+LIP+SVQQDFN RRSL+SISAV P GAPEVDPRTHRLKKPA P   
Sbjct  181  VERPDGVIHGIKRLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTHRLKKPALPAKP  240

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  241  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIETLLLYGGYNEMADILV  300

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  509
            NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+Y
Sbjct  301  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIY  348



>ref|XP_006388223.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
 gb|ERP47137.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
Length=273

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V RPDGVIHGIER+LIP+SVQQDFN  RSL+SISAV P GAPEVDPRTHR+KKPA P   
Sbjct  93   VERPDGVIHGIERLLIPRSVQQDFNNCRSLQSISAVKPEGAPEVDPRTHRMKKPAPPAKP  152

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            G+ P LPIYDAMAPGP+LAPAPAPGPGG HHHF+GE QVKDFI+TLL YGGYNE+ADILV
Sbjct  153  GSAPVLPIYDAMAPGPSLAPAPAPGPGGPHHHFNGEKQVKDFIETLLLYGGYNEMADILV  212

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMY  509
            NLTSLATEM RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQI+Y
Sbjct  213  NLTSLATEMERLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIIY  260



>emb|CDY47922.1| BnaAnng09540D [Brassica napus]
Length=227

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +3

Query  282  FDGESQVKDFIQTLLHYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  461
            F+GE+QVKDFI TLLHYGGYNE+ADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL
Sbjct  31   FNGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  90

Query  462  TTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TTDQLSEPGAPEQIMYYH+IPEYQTEESMYN+VRRFGK++Y+TLR PHKV A+EA
Sbjct  91   TTDQLSEPGAPEQIMYYHIIPEYQTEESMYNSVRRFGKVKYETLRFPHKVAAKEA  145



>ref|XP_006651890.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Oryza 
brachyantha]
Length=413

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +3

Query  282  FDGESQVKDFIQTLLHYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  461
            FDG SQVKDFIQTLL YGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMA+L
Sbjct  208  FDGHSQVKDFIQTLLLYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMARL  267

Query  462  TTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TTDQLSEPG+PE I+YYH+IPEYQTEESMYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  268  TTDQLSEPGSPENILYYHMIPEYQTEESMYNAVRRFGKVRYDTLRLPHKVVAREA  322



>gb|KDO48944.1| hypothetical protein CISIN_1g043668mg [Citrus sinensis]
Length=415

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKpanpv  179
            + RPDG IHGI ++++P+SVQ +FN RR+L SI+AV P  APE+DPR  T +L KP   V
Sbjct  157  ITRPDGTIHGISQLMVPRSVQNEFNRRRNLDSIAAVKPEAAPEIDPRVITKKLNKPVFNV  216

Query  180  pagappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADI  359
               +PP LPI +A+A GP  APA AP PGG   HFDG  QVKDFI+TL+HYGGYNE+ADI
Sbjct  217  KPYSPPVLPISEAIAAGPGQAPASAPAPGGPRDHFDGHIQVKDFIKTLVHYGGYNEMADI  276

Query  360  LVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTE  539
            LVNLTSLA+E+G+LVSEGYVLT+LAPNDEAM KLTTDQLSEPGA EQIMYYH++ EYQTE
Sbjct  277  LVNLTSLASEIGKLVSEGYVLTILAPNDEAMVKLTTDQLSEPGAAEQIMYYHMVAEYQTE  336

Query  540  ESMYNAV  560
            ESMYNAV
Sbjct  337  ESMYNAV  343



>ref|XP_006658293.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Oryza 
brachyantha]
Length=412

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  282  FDGESQVKDFIQTLLHYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  461
            FDG SQVKDFIQTLL YGG NELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAM +L
Sbjct  206  FDGHSQVKDFIQTLLLYGGLNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMTRL  265

Query  462  TTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            TTDQLSEPG+PE I+YYH+IPEYQTEESMYNAVRRFGK+RYDTLRLPHKV A EA
Sbjct  266  TTDQLSEPGSPENILYYHMIPEYQTEESMYNAVRRFGKVRYDTLRLPHKVTAREA  320



>ref|XP_010516833.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=325

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 148/167 (89%), Gaps = 4/167 (2%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDG+IHGIER+LIP+SVQ+DFN RRSLRSISAV+P GAPEVDPRTHRLKKPA  VP
Sbjct  158  DVIRPDGIIHGIERLLIPRSVQEDFNHRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVP  217

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AG+PP LPIYDAM+PGP+LAPAPA GPGG   HF+GE+QVKDFI TLLHYGGYNE+ADIL
Sbjct  218  AGSPPVLPIYDAMSPGPSLAPAPASGPGGPRGHFNGEAQVKDFIHTLLHYGGYNEMADIL  277

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLT----TDQLSEPGA  491
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMA LT       L++P A
Sbjct  278  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMANLTEPSPCPNLTDPSA  324



>gb|KJB36231.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=330

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            DV+RPDGVIHGI+++LIP+SV +DFN RR+LRSI+AVLP GAPEVDPRTHRLKKPA    
Sbjct  171  DVIRPDGVIHGIQQLLIPRSVIEDFNRRRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPV  230

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    IY+AMAPGP+LAPAPAPGPGG  HHFDGESQVKDFIQTLLHYGGYNE+ADIL
Sbjct  231  GAPPVLP-IYEAMAPGPSLAPAPAPGPGGPRHHFDGESQVKDFIQTLLHYGGYNEMADIL  289

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQL  476
            VNLTSLATEMGRLVSEGYV+TVLAPNDEAMAKLTTDQL
Sbjct  290  VNLTSLATEMGRLVSEGYVITVLAPNDEAMAKLTTDQL  327



>ref|XP_002448333.1| hypothetical protein SORBIDRAFT_06g025350 [Sorghum bicolor]
 gb|EES12661.1| hypothetical protein SORBIDRAFT_06g025350 [Sorghum bicolor]
Length=288

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            VVR DGVIHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K   P  
Sbjct  65   VVRADGVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPL  124

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    ++DAMAPGP++APAPAPGPG   H FDG  QVKDFIQTLL YGGYNELA IL
Sbjct  125  GAPPALP-VWDAMAPGPSIAPAPAPGPGTGTHRFDGHGQVKDFIQTLLLYGGYNELAGIL  183

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIM  506
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE  M
Sbjct  184  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPESTM  231



>ref|XP_002444260.1| hypothetical protein SORBIDRAFT_07g019123 [Sorghum bicolor]
 gb|EES13755.1| hypothetical protein SORBIDRAFT_07g019123 [Sorghum bicolor]
Length=184

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            VVR DGVIHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K   P  
Sbjct  22   VVRADGVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPL  81

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    ++DAMAPGP++APAPAPGPG   H FDG  QVKDFIQTLL YGGYNELADIL
Sbjct  82   GAPPALP-VWDAMAPGPSIAPAPAPGPGTGTHRFDGHGQVKDFIQTLLLYGGYNELADIL  140

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAP  494
            VNLTSLATEMGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+P
Sbjct  141  VNLTSLATEMGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSP  184



>gb|KHN36515.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=365

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  LLHYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQ  500
            L HYGGYNE+ADILVNLTSLA EMGRLVSEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQ
Sbjct  175  LPHYGGYNEMADILVNLTSLAVEMGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQ  234

Query  501  IMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            IMYYH+IPEYQTEESMYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  235  IMYYHIIPEYQTEESMYNAVRRFGKVRYDTLRLPHKVVAQEA  276



>tpg|DAA51812.1| TPA: hypothetical protein ZEAMMB73_870378 [Zea mays]
Length=337

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKKPA PV  
Sbjct  168  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAP  227

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
            GAPP LP++DAMAPGP++APAPAPGPG   HHFDG SQVKDFIQTLL YGGYNELADILV
Sbjct  228  GAPPVLPVWDAMAPGPSIAPAPAPGPGSGKHHFDGHSQVKDFIQTLLLYGGYNELADILV  287

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAP  494
            NLTSLATEMGRLVSEGYVLTVLAPNDEAM        + P  P
Sbjct  288  NLTSLATEMGRLVSEGYVLTVLAPNDEAMRASPRTSSASPARP  330



>ref|XP_006495395.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Citrus sinensis]
Length=309

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  162  DITRPDGVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVP  221

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG H HF+GE QVKDFI TLLHYGGYNE+ADIL
Sbjct  222  AGAPPILPIYDAMAPGPSLAPAPAPGPGGAHRHFNGERQVKDFIHTLLHYGGYNEMADIL  281

Query  363  VNLTSLATEMGRLVSEGYVLTVLAPNDE  446
            VNLTSLATEMGRLVSEGYVLTVLAPNDE
Sbjct  282  VNLTSLATEMGRLVSEGYVLTVLAPNDE  309



>emb|CBI39116.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +3

Query  348  LADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPE  527
            +ADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHL+PE
Sbjct  1    MADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLVPE  60

Query  528  YQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            YQTEESMYNAVRRFGK+RYDTLRLPHKVVA+EA
Sbjct  61   YQTEESMYNAVRRFGKVRYDTLRLPHKVVAQEA  93



>ref|XP_006487827.1| PREDICTED: fasciclin-like arabinogalactan protein 18-like [Citrus 
sinensis]
Length=180

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  348  LADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPE  527
            +ADILVNLTSLA+E+G+LVSEGYVLT+LAPNDEAM KLTTDQLSEPGA EQIMYYH++ E
Sbjct  1    MADILVNLTSLASEIGKLVSEGYVLTILAPNDEAMVKLTTDQLSEPGAAEQIMYYHMVAE  60

Query  528  YQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            YQTEESMYNAVRRFGK+ YDTLR+PHKVVA EA
Sbjct  61   YQTEESMYNAVRRFGKVEYDTLRVPHKVVAVEA  93



>gb|ABK25995.1| unknown [Picea sitchensis]
Length=185

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  348  LADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPE  527
            +ADILVNLTSLA+E+ +LVSEGY +TVLAPNDEAM +LTT+QLSEPGAPE IMYYH+IPE
Sbjct  1    MADILVNLTSLASELAKLVSEGYKVTVLAPNDEAMGELTTEQLSEPGAPEHIMYYHIIPE  60

Query  528  YQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            YQTEESMYNAVRRFGK++YDTLR+PHK+ ++EA
Sbjct  61   YQTEESMYNAVRRFGKMKYDTLRIPHKITSQEA  93



>gb|KHN17997.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=164

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +3

Query  390  MGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRF  569
            MGRLVSEGYVLTVLAPNDEAMAKLTT+QLSEPGAPEQIMYYH+IPEYQTEESMYNAVRRF
Sbjct  1    MGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIMYYHIIPEYQTEESMYNAVRRF  60

Query  570  GKIRYDTLRLPHKVVAEEA  626
            GK+RYDTLRLPHKVVA+EA
Sbjct  61   GKVRYDTLRLPHKVVAQEA  79



>ref|XP_002974338.1| hypothetical protein SELMODRAFT_54466, partial [Selaginella moellendorffii]
 gb|EFJ24560.1| hypothetical protein SELMODRAFT_54466, partial [Selaginella moellendorffii]
Length=381

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 129/209 (62%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ + DGV+HG+  +L+P+SVQ+ F+ ++   S +A+LP  +PE DP    L + +    
Sbjct  138  DINKKDGVVHGVNGLLVPRSVQEAFSVKKLGSSANALLPQASPEFDPLGASLAEMSKEFQ  197

Query  183  agappalpIY--DamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
                 A      +                 G H  +  E  V DF+ TL ++GGYNE+A+
Sbjct  198  DFLEAAESPLPLEFAYAPEVAPAPAPGPSSGKHRVYTWE-DVDDFVSTLANFGGYNEMAE  256

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            +LVNLTS A +M +LV+EG+ LT+LAPND AM  LTT+QL+ PG  E I+ YH++ EYQT
Sbjct  257  LLVNLTSFAWDMAKLVNEGHRLTLLAPNDHAMDHLTTEQLNAPGGLEAILMYHVLTEYQT  316

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEE  623
            EES+YNAVRRF K+++ TL  PH + A+E
Sbjct  317  EESLYNAVRRFEKVKFLTLWQPHTIHAKE  345



>ref|XP_002990854.1| hypothetical protein SELMODRAFT_44414, partial [Selaginella moellendorffii]
 gb|EFJ08127.1| hypothetical protein SELMODRAFT_44414, partial [Selaginella moellendorffii]
Length=381

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 129/209 (62%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ + DGV+HG+  +L+P+SVQ+ F+ ++   S +A+LP  +PE DP    L + +    
Sbjct  138  DINKKDGVVHGVNGLLVPRSVQEAFSVKKLGSSANALLPQASPEFDPLGASLAEMSKEFQ  197

Query  183  agappalpIY--DamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELAD  356
                 A      +                 G H  +  E  V DF+ TL ++GGY+E+A+
Sbjct  198  DFLEAAESPLPLEFAYAPEVAPAPAPGPSSGKHRVYTWE-DVDDFVSTLANFGGYSEMAE  256

Query  357  ILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQT  536
            +LVNLTS A +M +LV+EG+ LT+LAPND AM  LTT+QL+ PG  E I+ YH++ EYQT
Sbjct  257  LLVNLTSFAWDMAKLVNEGHRLTLLAPNDHAMDHLTTEQLNAPGGLEAILMYHVLTEYQT  316

Query  537  EESMYNAVRRFGKIRYDTLRLPHKVVAEE  623
            EES+YNAVRRF K+++ TL  PH + A+E
Sbjct  317  EESLYNAVRRFEKVKFLTLWQPHTIHAKE  345



>gb|ACF84712.1| unknown [Zea mays]
Length=170

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  390  MGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRF  569
            MGRLVSEGYVLTVLAPNDEAMA+LTTDQLSEPG+PE I+YYH+IPEYQTEESMYNAVRRF
Sbjct  1    MGRLVSEGYVLTVLAPNDEAMARLTTDQLSEPGSPENILYYHMIPEYQTEESMYNAVRRF  60

Query  570  GKIRYDTLRLPHKVVAEEA  626
            GK+RYDTLRLPHKVVA EA
Sbjct  61   GKVRYDTLRLPHKVVAREA  79



>gb|KHN43596.1| Fasciclin-like arabinogalactan protein 15 [Glycine soja]
Length=298

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  396  RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGK  575
            RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEESMYN VRRFGK
Sbjct  112  RLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNTVRRFGK  171

Query  576  IRYDTLRLPHKVVAEEA  626
            + YDTLRLPHKV+A+E+
Sbjct  172  VSYDTLRLPHKVLAQES  188



>gb|KHN41248.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=265

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  399  LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKI  578
            LVSEGYVLTVLAPNDEAMAKL T+QLSEPG+PEQIMYYHLIPEYQTEESMYNAVRRFGK+
Sbjct  121  LVSEGYVLTVLAPNDEAMAKLATEQLSEPGSPEQIMYYHLIPEYQTEESMYNAVRRFGKV  180

Query  579  RYDTLRLPHKVVAEEA  626
            RYDTLRLPHKV A+EA
Sbjct  181  RYDTLRLPHKVTAQEA  196



>ref|XP_002454878.1| hypothetical protein SORBIDRAFT_03g000685 [Sorghum bicolor]
 gb|EER99997.1| hypothetical protein SORBIDRAFT_03g000685 [Sorghum bicolor]
Length=185

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            VVR DGVIHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K   P  
Sbjct  22   VVRADGVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPL  81

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADIL  362
               P    ++DAMAPGP++APAPAPGPG   H FDG  QVKDFIQTLL YGGYNELADIL
Sbjct  82   GAPPALP-VWDAMAPGPSIAPAPAPGPGTGTHRFDGHGQVKDFIQTLLLYGGYNELADIL  140

Query  363  VNLTSLATEMGRLVS  407
            VNLTSLATEMGR  S
Sbjct  141  VNLTSLATEMGRASS  155



>dbj|BAH20344.1| AT3G52370 [Arabidopsis thaliana]
Length=149

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +3

Query  417  VLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLR  596
            VLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYH+IPEYQTEESMYN+VRRFGKIRYD+LR
Sbjct  1    VLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNSVRRFGKIRYDSLR  60

Query  597  LPHKVVAEEA  626
             PHKV A+EA
Sbjct  61   FPHKVEAQEA  70



>ref|XP_001784356.1| predicted protein [Physcomitrella patens]
 gb|EDQ50825.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 129/213 (61%), Gaps = 9/213 (4%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +VR DG++HG++ +++P  V   F   +     S V P G+P      + L++ A  VPA
Sbjct  152  IVRKDGIVHGVDGLMVPPKVASAFEEWKR-NGKSGVNPHGSPSAPKARYMLERSAPAVPA  210

Query  186  gappalpIYDamapgpalapapapgpg------ghhhhFDGESQVKDFIQTLLHYGGYNE  347
                A+      A  P+L P+  P             ++D E ++  F+  L +YGGYN+
Sbjct  211  ALIHAVTAPAPPATAPSLGPSLGPSIAPAPGPGTAMFNWDDEDEMLQFVTALSNYGGYND  270

Query  348  LADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPE  527
            +A++LVN T+L  E+G+L   GY LT+LAPND+AM  LTT+QL++  A E ++YYH + E
Sbjct  271  MAELLVNATTLGVELGKLARMGYKLTILAPNDQAMQLLTTEQLNQ--AMEPLLYYHFLSE  328

Query  528  YQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            YQTEESMYNAV+R GK  Y TLR PHKVVA E+
Sbjct  329  YQTEESMYNAVKRLGKQSYSTLRHPHKVVASES  361



>gb|KDO70682.1| hypothetical protein CISIN_1g019153mg [Citrus sinensis]
Length=345

 Score =   125 bits (314),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+L+P+SVQ+DFN RR+LRSISAVLP GAPEVDPRTHRLKKPA PVP
Sbjct  162  DITRPDGVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVP  221

Query  183  agappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYN  344
            AGAPP LPIYDAMAPGP+LAPAPAPGPGG H HF+GE QVKDFI TLLHYG  N
Sbjct  222  AGAPPILPIYDAMAPGPSLAPAPAPGPGGAHRHFNGERQVKDFIHTLLHYGQRN  275


 Score = 55.5 bits (132),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  341  QRTGRHSGKFNVFSYGNGEISFRRLRADSFSAQR*SHG*AHHRSAERARGAGADNVLSSH  520
            QR G +SG+ +V S GNG    R +RAD    +R   G A + S ER  GAGAD +L  +
Sbjct  273  QRNGGYSGELDVVSDGNGPFGVRGIRADGAGPERRGDGEADNGSIERTGGAGADYLLPHY  332

Query  521  TGVPDGGEYVQC  556
            +GV +GGE+VQ 
Sbjct  333  SGVSNGGEHVQL  344



>ref|XP_010495088.1| PREDICTED: fasciclin-like arabinogalactan protein 17, partial 
[Camelina sativa]
Length=151

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  420  LTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRL  599
            LTVLAPNDEAMAKLTTDQLSEPGAPEQI+YYH+IPEYQTEESMYN+VRRFG +++DTLR 
Sbjct  1    LTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEESMYNSVRRFGNVKFDTLRF  60

Query  600  PHKVVAEEA  626
            PHKV A+EA
Sbjct  61   PHKVAAKEA  69



>emb|CBI39118.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 4/73 (5%)
 Frame = +3

Query  420  LTVLAPND----EAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYD  587
            LTVLAP      +AMAKLTTDQLSEPGAPEQIMYYHL+PEYQTEESMYNAVRRFGK+RYD
Sbjct  35   LTVLAPPVLPIYDAMAKLTTDQLSEPGAPEQIMYYHLVPEYQTEESMYNAVRRFGKVRYD  94

Query  588  TLRLPHKVVAEEA  626
            TLRLPHKVVA+EA
Sbjct  95   TLRLPHKVVAQEA  107



>ref|XP_002992031.1| hypothetical protein SELMODRAFT_23020, partial [Selaginella moellendorffii]
 gb|EFJ06880.1| hypothetical protein SELMODRAFT_23020, partial [Selaginella moellendorffii]
Length=372

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 117/208 (56%), Gaps = 16/208 (8%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +VR DGV+H I+ +L+PKSVQ  ++  R   S SAVLP  AP +   +   K  A     
Sbjct  129  IVRSDGVVHRIDGLLVPKSVQDAYSAARI--SSSAVLPQAAPSLSGESFGTKAEAKLFHV  186

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
              P    +  +           +          DG  +V+DFI  L+ +GGY E+AD+LV
Sbjct  187  TFPVIDDLIGSAPAPAPSPSRFSA---------DGHGRVQDFIAALVSFGGYGEIADLLV  237

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSL+ E+  LV+EG+ LTVLAP D A+A+L  + L   GA E I+ YH++ EYQTEES
Sbjct  238  NLTSLSVEIANLVNEGHALTVLAPGDRAVARLAAEHL---GAIESILAYHIVAEYQTEES  294

Query  546  MYNAVRRFGKIRYDTLRLP--HKVVAEE  623
            +Y   +R  ++   TL  P  +++VA E
Sbjct  295  LYTLAKRHDRVVLSTLHEPPFNRLVARE  322



>ref|XP_001766851.1| predicted protein [Physcomitrella patens]
 gb|EDQ68253.1| predicted protein, partial [Physcomitrella patens]
Length=373

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +3

Query  282  FDGESQVKDFIQTLLHYGGYNELADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  461
            +D + +   F+  L +YGGYN++A++LVN T+L  E+G+L   GY +T+LAPND+AM +L
Sbjct  224  WDDDEETLQFVMALTNYGGYNDMAELLVNATTLGIEIGKLARMGYKITILAPNDQAMQQL  283

Query  462  TTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            T +QL  P  P  ++YYH + EYQT+ESMYNAV+R GK  Y TLR PHKV+A E+
Sbjct  284  TIEQLDMPMEP--LLYYHFLSEYQTDESMYNAVKRLGKQSYSTLRHPHKVIASES  336



>ref|XP_002964493.1| hypothetical protein SELMODRAFT_64323, partial [Selaginella moellendorffii]
 gb|EFJ34826.1| hypothetical protein SELMODRAFT_64323, partial [Selaginella moellendorffii]
Length=400

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 115/208 (55%), Gaps = 16/208 (8%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvpa  185
            +VR DGV+H I+ +L+PKSVQ  +   R   S SAVLP  AP +   +   K  A     
Sbjct  159  IVRSDGVVHRIDGLLVPKSVQDAYAAARI--SSSAVLPQAAPSLSGESFGNKAEAKLFHV  216

Query  186  gappalpIYDamapgpalapapapgpgghhhhFDGESQVKDFIQTLLHYGGYNELADILV  365
              P    +  +           +          DG  +V+DFI  L+  GGY E+AD+LV
Sbjct  217  TFPVIDDLIGSAPAPAPSPSRFSA---------DGHGRVQDFIAALVSIGGYGEIADLLV  267

Query  366  NLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEES  545
            NLTSL+ E+  LV+EG+ LTVLAP D A+A+L  + L   GA E I+ YH++ EYQTEES
Sbjct  268  NLTSLSVEIANLVNEGHALTVLAPGDRAVARLAAEHL---GAIESILAYHIVAEYQTEES  324

Query  546  MYNAVRRFGKIRYDTLRLP--HKVVAEE  623
            +Y   +R  ++   TL  P  +++VA E
Sbjct  325  LYTLAKRHDRVVLSTLHEPPFNRLVARE  352



>gb|EMT22481.1| hypothetical protein F775_14603 [Aegilops tauschii]
Length=294

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  417  VLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLR  596
            V+ VLAPNDEAMA+LTTDQLSEPG+PE I+YYH++PEYQTEESMYNAVRRFG +R  T R
Sbjct  170  VIHVLAPNDEAMARLTTDQLSEPGSPENILYYHMVPEYQTEESMYNAVRRFGTVRCVTSR  229



>ref|XP_010431275.1| PREDICTED: fasciclin-like arabinogalactan protein 15, partial 
[Camelina sativa]
Length=246

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    DVVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKpanpvp  182
            D+ RPDGVIHGIER+LIP+SVQ+DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVP
Sbjct  149  DLTRPDGVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVP  208

Query  183  agappalpIYD  215
            AGAPP LPIYD
Sbjct  209  AGAPPVLPIYD  219



>gb|ABI95409.1| fasciclin-like protein FLA19 [Triticum aestivum]
Length=480

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  164
            V+RPDGVIHGIER+L+P+SVQ+DFN RRSL +ISAVLPTGAPEVDPRTHRLKK
Sbjct  183  VLRPDGVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKK  235


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 58/99 (59%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  ESGQRFHPNPPALRRVQRTGRHSGKFNVFSYGNGEISFRRLRADSFSAQR*SHG*AHHRS  472
            + GQ  HP+P  LRRVQR GRH  + ++  + +G      +RAD   AQR  HG A H  
Sbjct  279  QPGQGLHPDPGPLRRVQRAGRHPRQPHLAGHRDGPAGVGGVRADRAGAQRRGHGAADHGP  338

Query  473  AERARGAGADNVLSSHTGVPDGGEYVQCGEEVRQNQIRH  589
            AERAR AG   VL    GVPDGGE+VQ    VRQ  +RH
Sbjct  339  AERARVAGEHPVLPHDPGVPDGGEHVQRRPPVRQGAVRH  377



>dbj|BAJ87361.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 97/175 (55%), Gaps = 0/175 (0%)
 Frame = +2

Query  65   AAGFQHSTELEINLRRAPHRSSGGGPQDSPPEKTGEsrprrrpsGSTNLRRNGPRasssa  244
            A G Q   +   +L RAPHR + G PQD+P ++   +R  RR   +  + R+GPR     
Sbjct  248  AGGLQPPPQPRRDLGRAPHRRARGRPQDAPAQEARPARAPRRAPRAPRVGRHGPRPVHRP  307

Query  245  gagsgTrrpppplrrrESGQRFHPNPPALRRVQRTGRHSGKFNVFSYGNGEISFRRLRAD  424
             A +   +   PLRR + GQ  HP+P  LRRVQR GRH G+ ++  + +G      +RAD
Sbjct  308  RARARPGQREAPLRRAQPGQGLHPDPGPLRRVQRAGRHPGEPHLAGHRDGAAGVGGVRAD  367

Query  425  SFSAQR*SHG*AHHRSAERARGAGADNVLSSHTGVPDGGEYVQCGEEVRQNQIRH  589
               AQR  HG A H  AERAR AG   +L    GVPDGGE+VQ    VRQ  +RH
Sbjct  368  RAGAQRRGHGAADHGPAERARVAGEHPLLPHDPGVPDGGEHVQRRPPVRQGAVRH  422



>ref|XP_006663458.1| PREDICTED: uncharacterized protein LOC102717475 [Oryza brachyantha]
Length=468

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  6    VVRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  164
            +VRP+ VIHGIER+L+P+SVQ+DFN RRSL +ISAVL  GAPEVDPRTH+LKK
Sbjct  1    MVRPNDVIHGIERLLVPRSVQEDFNWRRSLAAISAVLLIGAPEVDPRTHQLKK  53



>tpg|DAA51811.1| TPA: hypothetical protein ZEAMMB73_870378 [Zea mays]
Length=128

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  516  LIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            +IPEYQTEESMYNAVRRFGK+RYDTLRLPHKVVA EA
Sbjct  1    MIPEYQTEESMYNAVRRFGKVRYDTLRLPHKVVAREA  37



>ref|NP_196184.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09659.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90903.1| uncharacterized protein AT5G05650 [Arabidopsis thaliana]
Length=125

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +3

Query  468  DQLSEPGAPEQIMYYHLIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAEEA  626
            DQLSE    +QI YYH+IPEYQTE+S Y  VRR G I++DT   PH + A E 
Sbjct  2    DQLSE----KQIWYYHIIPEYQTEKSFYACVRRSGMIKFDTFYFPHMLSARET  50



>emb|CDY35502.1| BnaA01g24100D [Brassica napus]
Length=50

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 4/38 (11%)
 Frame = +3

Query  348  LADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKL  461
            +ADILVNLT    EMGRLVSEGYVLTVLAPNDEA AK+
Sbjct  1    MADILVNLT----EMGRLVSEGYVLTVLAPNDEAKAKV  34



>gb|AFG49337.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  9    VRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAP  131
            VRPDGVIHGI+R+L+PKSVQ DFN  R    I AV P GAP
Sbjct  96   VRPDGVIHGIDRLLVPKSVQDDFNAWRH-GVILAVKPEGAP  135



>gb|AEW07983.1| hypothetical protein 0_16121_01, partial [Pinus radiata]
 gb|AFG49325.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49326.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49327.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49329.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49331.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49332.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49333.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49334.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49336.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49338.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49339.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49340.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49341.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  9    VRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAP  131
            VRPDGVIHGI+R+L+PKSVQ DFN  R    + AV P GAP
Sbjct  96   VRPDGVIHGIDRLLVPKSVQDDFNAWRH-GVVLAVKPEGAP  135



>gb|AFG49330.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49335.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  9    VRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAP  131
            VRPDGVIHGI+R+L+PKSVQ DFN  R    + AV P GAP
Sbjct  96   VRPDGVIHGIDRLLVPKSVQDDFNAWRH-GVVLAVKPEGAP  135



>gb|AFG49328.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  9    VRPDGVIHGIERVLIPKSVQQDFNTRRSLRSISAVLPTGAP  131
            VRPDGVIHGI+R+L+PKSVQ DFN  R    + AV P GAP
Sbjct  96   VRPDGVIHGIDRLLVPKSVQDDFNAWRH-GVVLAVKPEGAP  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250