BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007C06 459 bp,:Filtered

Length=428
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like   75.1    4e-13   Nicotiana sylvestris
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...  75.1    4e-13   Nicotiana tomentosiformis
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...  75.1    5e-13   Nicotiana tomentosiformis
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like   72.8    3e-12   Sesamum indicum [beniseed]
gb|ACU17519.1|  unknown                                               67.8    7e-12   Glycine max [soybeans]
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like   71.2    8e-12   Solanum tuberosum [potatoes]
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g           70.5    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like   70.1    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like   69.3    4e-11   Sesamum indicum [beniseed]
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like   69.3    5e-11   Solanum lycopersicum
gb|KJB48378.1|  hypothetical protein B456_008G069300                  65.5    6e-11   Gossypium raimondii
gb|KJB66874.1|  hypothetical protein B456_010G162600                  65.1    1e-10   Gossypium raimondii
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890        68.2    1e-10   Nelumbo nucifera [Indian lotus]
gb|AAM62626.1|  nodulin protein, putative                             67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1          67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36195.1|  hypothetical protein AALP_AA4G090300                  67.8    2e-10   Arabis alpina [alpine rockcress]
ref|XP_009151421.1|  PREDICTED: WAT1-related protein At4g08300 is...  67.4    2e-10   Brassica rapa
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...  67.8    2e-10   Theobroma cacao [chocolate]
emb|CDY63388.1|  BnaCnng41950D                                        67.4    2e-10   Brassica napus [oilseed rape]
ref|XP_009151420.1|  PREDICTED: WAT1-related protein At4g08300 is...  67.4    2e-10   Brassica rapa
ref|XP_002893995.1|  nodulin MtN21 family protein                     67.4    2e-10   Arabidopsis lyrata subsp. lyrata
emb|CDY49560.1|  BnaAnng10230D                                        67.4    2e-10   Brassica napus [oilseed rape]
emb|CDY57632.1|  BnaC08g46530D                                        66.2    2e-10   Brassica napus [oilseed rape]
gb|KJB59209.1|  hypothetical protein B456_009G245000                  67.4    2e-10   Gossypium raimondii
gb|KHG29332.1|  Auxin-induced 5NG4                                    67.4    2e-10   Gossypium arboreum [tree cotton]
gb|ACD56621.1|  putative nodulin-like protein                         66.2    5e-10   Gossypioides kirkii
emb|CDY71496.1|  BnaAnng37680D                                        65.1    6e-10   Brassica napus [oilseed rape]
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800        65.9    6e-10   Camelina sativa [gold-of-pleasure]
gb|KJB16279.1|  hypothetical protein B456_002G221400                  65.9    7e-10   Gossypium raimondii
emb|CDP15800.1|  unnamed protein product                              65.9    7e-10   Coffea canephora [robusta coffee]
ref|XP_010469717.1|  PREDICTED: WAT1-related protein At4g08300-like   62.8    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010939364.1|  PREDICTED: WAT1-related protein At2g37450 is...  65.1    9e-10   Elaeis guineensis
gb|KJB16270.1|  hypothetical protein B456_002G221300                  64.7    9e-10   Gossypium raimondii
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300        65.5    1e-09   Glycine max [soybeans]
ref|XP_006287944.1|  hypothetical protein CARUB_v10001177mg           65.5    1e-09   Capsella rubella
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like   65.5    1e-09   Glycine max [soybeans]
gb|ACU23200.1|  unknown                                               65.1    1e-09   Glycine max [soybeans]
gb|KHN09198.1|  Auxin-induced protein 5NG4                            65.5    1e-09   Glycine soja [wild soybean]
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...  65.1    1e-09   Elaeis guineensis
ref|XP_009107474.1|  PREDICTED: WAT1-related protein At1g44800        65.1    1e-09   Brassica rapa
gb|KJB16269.1|  hypothetical protein B456_002G221300                  64.7    1e-09   Gossypium raimondii
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300        65.1    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg           65.1    1e-09   Capsella rubella
gb|KJB16268.1|  hypothetical protein B456_002G221300                  65.1    1e-09   Gossypium raimondii
gb|KJB29231.1|  hypothetical protein B456_005G090300                  64.7    1e-09   Gossypium raimondii
gb|KHG13292.1|  Auxin-induced 5NG4                                    63.9    2e-09   Gossypium arboreum [tree cotton]
gb|KJB29230.1|  hypothetical protein B456_005G090300                  64.7    2e-09   Gossypium raimondii
gb|KJB64393.1|  hypothetical protein B456_010G049300                  64.7    2e-09   Gossypium raimondii
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg              64.7    2e-09   Erythranthe guttata [common monkey flower]
gb|KHG18008.1|  Auxin-induced 5NG4                                    64.7    2e-09   Gossypium arboreum [tree cotton]
emb|CAB45800.1|  nodulin-like protein                                 64.7    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421739.1|  PREDICTED: WAT1-related protein At4g08300-li...  64.7    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010421740.1|  PREDICTED: WAT1-related protein At4g08300-li...  64.7    2e-09   Camelina sativa [gold-of-pleasure]
ref|NP_001240202.1|  uncharacterized protein LOC100811114             64.7    2e-09   Glycine max [soybeans]
ref|NP_192570.2|  nodulin MtN21 /EamA-like transporter family pro...  64.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84735.1|  unknown                                               64.3    2e-09   Medicago truncatula
gb|AFK35679.1|  unknown                                               64.3    2e-09   Medicago truncatula
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein               64.3    2e-09   Glycine soja [wild soybean]
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like   64.3    2e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AFK47115.1|  unknown                                               64.3    2e-09   Medicago truncatula
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like   63.9    3e-09   Phoenix dactylifera
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like   63.5    4e-09   Populus euphratica
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like   63.5    4e-09   Populus euphratica
gb|KHG01110.1|  Auxin-induced 5NG4                                    61.2    5e-09   Gossypium arboreum [tree cotton]
ref|XP_002872390.1|  nodulin MtN21 family protein                     63.2    5e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...  63.5    5e-09   Theobroma cacao [chocolate]
gb|KJB64433.1|  hypothetical protein B456_010G049200                  62.4    6e-09   Gossypium raimondii
ref|XP_010436420.1|  PREDICTED: WAT1-related protein At4g08300-like   63.2    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g           63.2    7e-09   Phaseolus vulgaris [French bean]
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like   63.2    7e-09   Glycine max [soybeans]
ref|XP_004498329.1|  PREDICTED: WAT1-related protein At1g44800-li...  62.4    7e-09   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like   62.8    7e-09   Cucumis melo [Oriental melon]
ref|XP_010455252.1|  PREDICTED: WAT1-related protein At4g08300        62.8    9e-09   Camelina sativa [gold-of-pleasure]
gb|ACJ84542.1|  unknown                                               58.9    9e-09   Medicago truncatula
gb|KJB64434.1|  hypothetical protein B456_010G049200                  62.4    1e-08   Gossypium raimondii
gb|KHG10291.1|  Auxin-induced 5NG4                                    62.4    1e-08   Gossypium arboreum [tree cotton]
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg           62.4    1e-08   Citrus clementina
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like   62.4    1e-08   Citrus sinensis [Valencia orange]
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...  62.4    1e-08   Cicer arietinum [garbanzo]
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g           62.4    1e-08   Populus trichocarpa [western balsam poplar]
gb|KHG16518.1|  Auxin-induced 5NG4                                    62.4    1e-08   Gossypium arboreum [tree cotton]
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like   62.0    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY14996.1|  BnaA10g08600D                                        62.0    1e-08   Brassica napus [oilseed rape]
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like   62.0    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006393710.1|  hypothetical protein EUTSA_v10011570mg           62.0    1e-08   Eutrema salsugineum
gb|KGN54575.1|  hypothetical protein Csa_4G365050                     62.0    2e-08   Cucumis sativus [cucumbers]
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like   61.6    2e-08   Prunus mume [ume]
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like   61.6    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300        61.6    2e-08   Prunus mume [ume]
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg             61.6    2e-08   Erythranthe guttata [common monkey flower]
gb|ABS52574.1|  nodulin family protein                                61.6    2e-08   Gossypium hirsutum [American cotton]
gb|KHG29659.1|  Auxin-induced 5NG4                                    61.6    2e-08   Gossypium arboreum [tree cotton]
gb|EPS61297.1|  hypothetical protein M569_13502                       58.2    2e-08   Genlisea aurea
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...  61.2    3e-08   Malus domestica [apple tree]
gb|KHG10292.1|  Auxin-induced 5NG4                                    61.2    3e-08   Gossypium arboreum [tree cotton]
ref|XP_004290852.1|  PREDICTED: WAT1-related protein At4g08300-like   61.2    3e-08   Fragaria vesca subsp. vesca
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like   62.0    3e-08   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                  61.2    3e-08   Arabis alpina [alpine rockcress]
ref|XP_003601062.1|  Auxin-induced protein 5NG4                       61.2    3e-08   Medicago truncatula
ref|XP_009123503.1|  PREDICTED: WAT1-related protein At1g44800-like   60.8    3e-08   Brassica rapa
ref|XP_002302243.2|  nodulin MtN21 family protein                     60.8    3e-08   Populus trichocarpa [western balsam poplar]
emb|CDY12554.1|  BnaC06g00800D                                        60.8    4e-08   Brassica napus [oilseed rape]
emb|CDY00403.1|  BnaC07g14230D                                        60.8    4e-08   Brassica napus [oilseed rape]
gb|KJB59206.1|  hypothetical protein B456_009G244800                  60.5    5e-08   Gossypium raimondii
gb|KJB64440.1|  hypothetical protein B456_010G049500                  60.5    5e-08   Gossypium raimondii
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890        60.1    6e-08   Vitis vinifera
ref|XP_006397314.1|  hypothetical protein EUTSA_v10028745mg           60.1    6e-08   Eutrema salsugineum
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like   60.1    6e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like   60.1    7e-08   Pyrus x bretschneideri [bai li]
gb|ACU18438.1|  unknown                                               57.4    7e-08   Glycine max [soybeans]
emb|CDY01310.1|  BnaA07g10830D                                        60.1    7e-08   Brassica napus [oilseed rape]
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890        60.1    8e-08   Brassica rapa
gb|KDP32785.1|  hypothetical protein JCGZ_12077                       59.7    8e-08   Jatropha curcas
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like   59.7    9e-08   Pyrus x bretschneideri [bai li]
gb|EAY76186.1|  hypothetical protein OsI_04119                        57.4    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg           59.3    1e-07   Prunus persica
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like   59.3    1e-07   Elaeis guineensis
ref|XP_010091381.1|  Auxin-induced protein 5NG4                       59.3    1e-07   Morus notabilis
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like   58.9    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g           59.3    1e-07   Phaseolus vulgaris [French bean]
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like   58.9    2e-07   Citrus sinensis [Valencia orange]
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg           58.9    2e-07   Citrus clementina
gb|AFK39842.1|  unknown                                               58.9    2e-07   Medicago truncatula
gb|AGZ85011.1|  hypothetical protein 6                                58.9    2e-07   Cicer arietinum [garbanzo]
gb|AES71306.2|  nodulin MtN21/EamA-like transporter family protein    58.5    2e-07   Medicago truncatula
ref|XP_003601058.1|  Auxin-induced protein 5NG4                       58.9    2e-07   Medicago truncatula
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg           58.9    2e-07   Eutrema salsugineum
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050        58.9    2e-07   Sesamum indicum [beniseed]
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like   58.5    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16695.1|  unknown                                               58.9    2e-07   Picea sitchensis
gb|KHG23400.1|  Auxin-induced 5NG4                                    58.5    2e-07   Gossypium arboreum [tree cotton]
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like   58.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like   58.5    2e-07   Eucalyptus grandis [rose gum]
ref|XP_002309380.1|  hypothetical protein POPTR_0006s19160g           58.2    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004500562.1|  PREDICTED: WAT1-related protein At4g08300-li...  58.2    2e-07   
gb|ABK25095.1|  unknown                                               58.5    3e-07   Picea sitchensis
ref|XP_003601053.1|  Auxin-induced protein 5NG4                       58.2    3e-07   Medicago truncatula
gb|KJB59208.1|  hypothetical protein B456_009G244900                  58.2    3e-07   Gossypium raimondii
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...  58.2    3e-07   Tarenaya hassleriana [spider flower]
dbj|BAK02715.1|  predicted protein                                    58.2    3e-07   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like   58.2    3e-07   Oryza brachyantha
emb|CDY20446.1|  BnaC04g05980D                                        58.2    3e-07   Brassica napus [oilseed rape]
gb|KJB29232.1|  hypothetical protein B456_005G090300                  58.2    3e-07   Gossypium raimondii
ref|XP_010910818.1|  PREDICTED: WAT1-related protein At4g08290-like   57.8    3e-07   Elaeis guineensis
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like   57.8    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_002324505.1|  hypothetical protein POPTR_0018s10840g           57.8    4e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001044551.1|  Os01g0803300                                     57.4    4e-07   
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330        57.8    4e-07   Sorghum bicolor [broomcorn]
emb|CDY07016.1|  BnaA04g22990D                                        57.8    4e-07   Brassica napus [oilseed rape]
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like   57.8    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510        57.4    5e-07   Brassica rapa
dbj|BAB92246.1|  putative nodulin MtN21                               57.8    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71658.1|  hypothetical protein OsI_04113                        57.8    5e-07   Oryza sativa Indica Group [Indian rice]
gb|AFK33380.1|  unknown                                               57.0    5e-07   Medicago truncatula
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like   57.4    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_002528210.1|  Auxin-induced protein 5NG4, putative             57.4    6e-07   Ricinus communis
emb|CDX93255.1|  BnaC04g46410D                                        57.4    6e-07   Brassica napus [oilseed rape]
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...  57.4    6e-07   Glycine max [soybeans]
gb|KHN05928.1|  Auxin-induced protein 5NG4                            57.4    6e-07   Glycine soja [wild soybean]
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like   57.0    6e-07   Pyrus x bretschneideri [bai li]
gb|KEH32583.1|  nodulin MtN21/EamA-like transporter family protein    56.2    6e-07   Medicago truncatula
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like   57.0    7e-07   Elaeis guineensis
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg           57.0    7e-07   Prunus persica
ref|XP_006651043.1|  PREDICTED: WAT1-related protein At2g39510-like   57.4    7e-07   
ref|XP_003628011.1|  Auxin-induced protein 5NG4                       57.0    7e-07   Medicago truncatula
ref|XP_002534331.1|  conserved hypothetical protein                   55.5    7e-07   
ref|XP_002881660.1|  nodulin MtN21 family protein                     57.0    7e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like   57.0    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg           57.0    8e-07   Capsella rubella
ref|XP_010534681.1|  PREDICTED: WAT1-related protein At1g21890 is...  56.6    8e-07   Tarenaya hassleriana [spider flower]
ref|NP_001041856.1|  Os01g0117900                                     56.6    9e-07   
ref|XP_007137398.1|  hypothetical protein PHAVU_009G123700g           56.6    9e-07   Phaseolus vulgaris [French bean]
ref|XP_004511088.1|  PREDICTED: WAT1-related protein At5g07050-like   57.0    9e-07   Cicer arietinum [garbanzo]
gb|KDO35805.1|  hypothetical protein CISIN_1g041924mg                 53.1    9e-07   Citrus sinensis [Valencia orange]
ref|XP_011012129.1|  PREDICTED: WAT1-related protein At4g30420-li...  56.6    9e-07   Populus euphratica
ref|XP_008452363.1|  PREDICTED: WAT1-related protein At4g30420        56.6    9e-07   Cucumis melo [Oriental melon]
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg              57.0    9e-07   Erythranthe guttata [common monkey flower]
gb|ABA29159.1|  nodulin-like protein                                  55.1    9e-07   Pisum sativum [garden pea]
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290        56.6    9e-07   Prunus mume [ume]
gb|ABA29160.1|  nodulin-like protein                                  55.1    9e-07   Pisum sativum [garden pea]
gb|ABR18253.1|  unknown                                               56.6    1e-06   Picea sitchensis
gb|EMT31802.1|  Auxin-induced protein 5NG4                            56.6    1e-06   Aegilops tauschii
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...  56.6    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like   56.6    1e-06   Brassica rapa
emb|CDY53594.1|  BnaA05g34670D                                        56.2    1e-06   Brassica napus [oilseed rape]
emb|CDM84603.1|  unnamed protein product                              56.6    1e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg           56.2    1e-06   Prunus persica
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890        56.2    1e-06   Malus domestica [apple tree]
gb|KEH32584.1|  nodulin MtN21/EamA-like transporter family protein    56.2    1e-06   Medicago truncatula
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g           56.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like   56.2    1e-06   Setaria italica
gb|KCW70586.1|  hypothetical protein EUGRSUZ_F03775                   55.1    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like   55.8    1e-06   
ref|XP_010919069.1|  PREDICTED: WAT1-related protein At5g64700-like   56.2    1e-06   Elaeis guineensis
ref|NP_001239827.1|  uncharacterized protein LOC100804390             55.8    2e-06   Glycine max [soybeans]
gb|EMS46274.1|  Auxin-induced protein 5NG4                            55.8    2e-06   Triticum urartu
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like   55.8    2e-06   Nelumbo nucifera [Indian lotus]
gb|EMS52511.1|  Auxin-induced protein 5NG4                            53.9    2e-06   Triticum urartu
ref|XP_003625520.1|  Auxin-induced protein 5NG4                       55.8    2e-06   Medicago truncatula
gb|KHG05804.1|  Auxin-induced 5NG4                                    55.5    2e-06   Gossypium arboreum [tree cotton]
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g           55.8    2e-06   Phaseolus vulgaris [French bean]
gb|AFK37217.1|  unknown                                               55.8    2e-06   Medicago truncatula
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like   55.5    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_006846484.1|  hypothetical protein AMTR_s00018p00136220        53.9    2e-06   
gb|EMS57240.1|  Auxin-induced protein 5NG4                            55.5    2e-06   Triticum urartu
gb|EPS73987.1|  hypothetical protein M569_00767                       55.5    2e-06   Genlisea aurea
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like   55.8    2e-06   
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like   55.8    2e-06   Glycine max [soybeans]
ref|XP_008362204.1|  PREDICTED: WAT1-related protein At4g30420-like   53.5    2e-06   Malus domestica [apple tree]
gb|AFW81938.1|  hypothetical protein ZEAMMB73_476289                  55.8    2e-06   Zea mays [maize]
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g           55.5    2e-06   Populus trichocarpa [western balsam poplar]
gb|KJB28448.1|  hypothetical protein B456_005G049000                  55.5    2e-06   Gossypium raimondii
ref|NP_001150619.1|  nodulin-like protein                             55.8    2e-06   Zea mays [maize]
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like   55.5    2e-06   Pyrus x bretschneideri [bai li]
gb|ACL54205.1|  unknown                                               55.8    2e-06   Zea mays [maize]
gb|AFK43964.1|  unknown                                               55.1    2e-06   Medicago truncatula
gb|KGN61082.1|  hypothetical protein Csa_2G042770                     55.1    2e-06   Cucumis sativus [cucumbers]
ref|XP_006838307.1|  hypothetical protein AMTR_s00103p00127060        55.5    2e-06   
gb|EMT33815.1|  Auxin-induced protein 5NG4                            55.5    2e-06   Aegilops tauschii
ref|NP_001048972.2|  Os03g0149300                                     52.4    2e-06   
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like   55.5    2e-06   Sesamum indicum [beniseed]
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like   55.5    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006453497.1|  hypothetical protein CICLE_v10010601mg           55.5    2e-06   Citrus clementina
ref|NP_181483.1|  nodulin MtN21-like transporter family protein       55.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EMS45454.1|  Auxin-induced protein 5NG4                            55.5    2e-06   Triticum urartu
ref|XP_003590513.1|  Auxin-induced protein 5NG4                       55.5    3e-06   Medicago truncatula
ref|NP_001170095.1|  hypothetical protein                             55.5    3e-06   Zea mays [maize]
gb|KDO62356.1|  hypothetical protein CISIN_1g017523mg                 55.1    3e-06   Citrus sinensis [Valencia orange]
gb|EYU29713.1|  hypothetical protein MIMGU_mgv11b0165801mg            52.0    3e-06   Erythranthe guttata [common monkey flower]
emb|CDX99013.1|  BnaC09g48220D                                        53.1    3e-06   Brassica napus [oilseed rape]
ref|NP_173607.1|  WAT1-related protein                                55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAL38712.1|  putative nodulin protein                              55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474620.1|  PREDICTED: WAT1-related protein At4g28040-like   55.1    3e-06   Citrus sinensis [Valencia orange]
gb|AAF16542.1|AC013482_16  T26F17.11                                  55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162696.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...  55.1    3e-06   
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like   55.1    3e-06   Eucalyptus grandis [rose gum]
ref|XP_004302750.1|  PREDICTED: WAT1-related protein At2g37460-like   55.1    3e-06   Fragaria vesca subsp. vesca
ref|XP_004144705.1|  PREDICTED: auxin-induced protein 5NG4-like       55.1    3e-06   
ref|XP_004985690.1|  PREDICTED: WAT1-related protein At2g39510-li...  55.1    3e-06   Setaria italica
ref|XP_004985689.1|  PREDICTED: WAT1-related protein At2g39510-li...  55.1    3e-06   Setaria italica
gb|AFK37263.1|  unknown                                               55.1    3e-06   Lotus japonicus
gb|KHN47036.1|  Auxin-induced protein 5NG4-like protein               55.1    3e-06   Glycine soja [wild soybean]
ref|NP_001241603.1|  uncharacterized protein LOC100812537             55.1    3e-06   Glycine max [soybeans]
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like   55.1    3e-06   Glycine max [soybeans]
gb|KHN48995.1|  Auxin-induced protein 5NG4                            55.1    3e-06   Glycine soja [wild soybean]
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...  55.1    3e-06   Populus euphratica
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510        55.1    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010110114.1|  Auxin-induced protein 5NG4                       55.1    3e-06   Morus notabilis
ref|XP_006844156.1|  hypothetical protein AMTR_s00006p00261210        54.7    3e-06   Amborella trichopoda
gb|KHG27290.1|  Auxin-induced 5NG4                                    55.1    4e-06   Gossypium arboreum [tree cotton]
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg              54.7    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like   55.1    4e-06   Cicer arietinum [garbanzo]
gb|KJB58165.1|  hypothetical protein B456_009G197500                  54.7    4e-06   Gossypium raimondii
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like   54.7    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like       54.7    4e-06   
ref|XP_008681283.1|  PREDICTED: hypothetical protein isoform X3       54.7    4e-06   Zea mays [maize]
tpg|DAA45833.1|  TPA: hypothetical protein ZEAMMB73_166425            54.3    4e-06   Zea mays [maize]
gb|EAY98030.1|  hypothetical protein OsI_19945                        55.1    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like       54.7    4e-06   Cucumis sativus [cucumbers]
ref|NP_001159175.1|  hypothetical protein                             54.7    4e-06   Zea mays [maize]
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like   54.7    4e-06   Pyrus x bretschneideri [bai li]
ref|NP_001055529.2|  Os05g0409500                                     54.7    4e-06   
ref|XP_002893187.1|  T26F17.11                                        54.7    5e-06   Arabidopsis lyrata subsp. lyrata
gb|AFK44115.1|  unknown                                               52.8    5e-06   Lotus japonicus
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050        54.7    5e-06   Brachypodium distachyon [annual false brome]
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg           54.7    5e-06   Eutrema salsugineum
gb|EMT07558.1|  Auxin-induced protein 5NG4                            54.3    5e-06   Aegilops tauschii
gb|ACR34989.1|  unknown                                               54.7    5e-06   Zea mays [maize]
ref|XP_010453454.1|  PREDICTED: WAT1-related protein At5g13670-like   54.7    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002467683.1|  hypothetical protein SORBIDRAFT_01g032270        54.7    5e-06   Sorghum bicolor [broomcorn]
gb|KJB76061.1|  hypothetical protein B456_012G069300                  54.3    5e-06   Gossypium raimondii
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...  54.7    5e-06   Zea mays [maize]
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like   54.3    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like   54.3    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006838306.1|  hypothetical protein AMTR_s00103p00126500        54.3    6e-06   
ref|NP_001141126.1|  uncharacterized protein LOC100273211             54.3    6e-06   Zea mays [maize]
ref|XP_010555908.1|  PREDICTED: WAT1-related protein At3g28130-like   54.3    6e-06   Tarenaya hassleriana [spider flower]
emb|CDX75163.1|  BnaC09g25190D                                        54.3    6e-06   Brassica napus [oilseed rape]
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg           54.3    6e-06   Prunus persica
ref|XP_011018103.1|  PREDICTED: WAT1-related protein At4g30420-li...  54.3    6e-06   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like   54.3    6e-06   
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...  53.9    7e-06   
ref|XP_006453495.1|  hypothetical protein CICLE_v10008665mg           53.9    7e-06   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...  53.9    7e-06   
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like       53.9    7e-06   
ref|XP_007137544.1|  hypothetical protein PHAVU_009G135600g           53.9    7e-06   
ref|XP_011018102.1|  PREDICTED: WAT1-related protein At4g30420-li...  53.9    7e-06   
ref|XP_006453494.1|  hypothetical protein CICLE_v10008665mg           53.9    7e-06   
gb|KGN61714.1|  hypothetical protein Csa_2G231960                     53.9    7e-06   
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290        53.9    7e-06   
gb|KJB42248.1|  hypothetical protein B456_007G145000                  53.9    8e-06   
ref|XP_006474092.1|  PREDICTED: WAT1-related protein At4g30420-like   53.9    8e-06   
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050        53.9    8e-06   
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like   53.9    8e-06   
ref|XP_010911519.1|  PREDICTED: WAT1-related protein At5g07050-like   53.5    8e-06   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like   53.9    8e-06   
gb|EYU41683.1|  hypothetical protein MIMGU_mgv1a009185mg              53.5    8e-06   
gb|AFK34273.1|  unknown                                               53.9    8e-06   
gb|KJB60315.1|  hypothetical protein B456_009G299900                  53.9    9e-06   
ref|XP_010031134.1|  PREDICTED: WAT1-related protein At3g28050-li...  53.5    9e-06   
ref|XP_007227168.1|  hypothetical protein PRUPE_ppa023869mg           52.8    9e-06   
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg           53.5    9e-06   
gb|KHN47884.1|  Auxin-induced protein 5NG4                            51.6    9e-06   
gb|EMT14666.1|  Auxin-induced protein 5NG4                            53.9    9e-06   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050        53.9    9e-06   
gb|KDO53672.1|  hypothetical protein CISIN_1g033196mg                 51.2    1e-05   
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like   53.5    1e-05   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like   53.5    1e-05   
emb|CAH58631.1|  nodulin-like protein                                 53.5    1e-05   
ref|XP_009380328.1|  PREDICTED: auxin-induced protein 5NG4-like       53.5    1e-05   
gb|ABR16764.1|  unknown                                               50.8    1e-05   
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like   53.5    1e-05   
gb|EMS55812.1|  Auxin-induced protein 5NG4                            53.5    1e-05   
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like   53.5    1e-05   
gb|ABG65997.1|  nodulin MtN21 family protein, putative, expressed     53.1    1e-05   
dbj|BAJ98418.1|  predicted protein                                    53.5    1e-05   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510        53.5    1e-05   
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...  53.1    1e-05   
gb|EMT22545.1|  Auxin-induced protein 5NG4                            52.8    1e-05   
ref|XP_006586537.1|  PREDICTED: WAT1-related protein At1g68170-like   51.6    1e-05   
ref|XP_011470862.1|  PREDICTED: WAT1-related protein At5g07050-like   53.5    1e-05   
gb|AES96253.2|  nodulin MtN21/EamA-like transporter family protein    53.5    1e-05   
gb|KHN32156.1|  Auxin-induced protein 5NG4                            51.2    1e-05   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like   53.5    1e-05   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like   53.1    1e-05   
ref|XP_009360246.1|  PREDICTED: WAT1-related protein At5g64700-like   53.5    1e-05   
ref|XP_010097389.1|  Auxin-induced protein 5NG4                       53.1    1e-05   
gb|AFK41031.1|  unknown                                               52.4    1e-05   
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg           53.5    1e-05   
ref|XP_010530244.1|  PREDICTED: WAT1-related protein At1g43650        53.1    1e-05   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg           53.1    1e-05   
gb|ABG65998.1|  nodulin MtN21 family protein, putative, expressed     53.1    1e-05   
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890        53.5    1e-05   
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like   53.1    1e-05   
gb|AAM01041.1|AC091735_14  Putative nodulin-like protein              53.1    1e-05   
ref|XP_008391190.1|  PREDICTED: WAT1-related protein At5g07050-like   53.1    1e-05   
ref|XP_008782344.1|  PREDICTED: WAT1-related protein At1g21890-like   53.1    1e-05   
ref|XP_006430499.1|  hypothetical protein CICLE_v10013028mg           51.2    1e-05   
gb|EPS58955.1|  hypothetical protein M569_15858                       50.1    1e-05   
gb|KEH16771.1|  nodulin MtN21/EamA-like transporter family protein    53.1    1e-05   
ref|XP_003533139.2|  PREDICTED: WAT1-related protein At1g68170-like   51.2    1e-05   
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950        53.1    1e-05   
ref|XP_002447367.1|  hypothetical protein SORBIDRAFT_06g033810        53.1    1e-05   
ref|XP_011469819.1|  PREDICTED: WAT1-related protein At2g39510-like   53.1    1e-05   
ref|XP_008223640.1|  PREDICTED: WAT1-related protein At4g28040        53.1    1e-05   
ref|NP_001064323.1|  Os10g0210500                                     53.1    1e-05   
ref|XP_003613295.1|  Auxin-induced protein 5NG4                       53.5    1e-05   
gb|EEC66707.1|  hypothetical protein OsI_33030                        53.1    1e-05   
gb|EMT18534.1|  Auxin-induced protein 5NG4                            52.8    1e-05   
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200        53.1    2e-05   
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like   53.1    2e-05   
emb|CDY29141.1|  BnaA09g53940D                                        53.1    2e-05   
ref|XP_008392675.1|  PREDICTED: WAT1-related protein At1g43650-li...  52.8    2e-05   
gb|KDP35589.1|  hypothetical protein JCGZ_09027                       52.8    2e-05   
ref|XP_007133644.1|  hypothetical protein PHAVU_011G1969001g          52.8    2e-05   
gb|EMS46950.1|  Auxin-induced protein 5NG4                            52.8    2e-05   
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like   53.1    2e-05   
ref|XP_006441413.1|  hypothetical protein CICLE_v10023533mg           52.8    2e-05   
emb|CAA75575.1|  MtN21                                                52.8    2e-05   
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like   52.8    2e-05   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like   52.8    2e-05   
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like   53.1    2e-05   
ref|XP_002510467.1|  Auxin-induced protein 5NG4, putative             52.8    2e-05   
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like   52.8    2e-05   
gb|KJB67652.1|  hypothetical protein B456_010G202300                  52.8    2e-05   
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like   52.8    2e-05   
gb|KHN09193.1|  Auxin-induced protein 5NG4                            52.8    2e-05   
dbj|BAJ53175.1|  JHL18I08.9                                           52.8    2e-05   
ref|XP_004300887.1|  PREDICTED: WAT1-related protein At3g28050-like   52.8    2e-05   
gb|AAN87740.1|  Unknown protein                                       52.8    2e-05   
gb|EMS60690.1|  Auxin-induced protein 5NG4                            52.8    2e-05   
gb|EEC74527.1|  hypothetical protein OsI_10035                        52.4    2e-05   
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like   52.4    2e-05   
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like   52.4    2e-05   
gb|ABF93996.1|  Integral membrane protein DUF6 containing protein...  52.4    2e-05   
ref|XP_010268393.1|  PREDICTED: WAT1-related protein At4g30420-li...  52.4    2e-05   
ref|XP_010103139.1|  Auxin-induced protein 5NG4                       52.0    2e-05   
ref|XP_003558804.2|  PREDICTED: WAT1-related protein At1g43650-like   52.4    2e-05   
gb|KHN10873.1|  Auxin-induced protein 5NG4                            50.1    2e-05   
ref|XP_007208872.1|  hypothetical protein PRUPE_ppa026053mg           52.4    2e-05   
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...  52.4    2e-05   
ref|XP_004309501.2|  PREDICTED: WAT1-related protein At5g07050-like   52.4    3e-05   
ref|XP_010268395.1|  PREDICTED: WAT1-related protein At4g30420-li...  52.0    3e-05   
ref|XP_011470863.1|  PREDICTED: WAT1-related protein At5g07050-like   52.4    3e-05   
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290        52.4    3e-05   
ref|XP_010268394.1|  PREDICTED: WAT1-related protein At4g30420-li...  52.0    3e-05   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like   52.4    3e-05   
ref|XP_004294697.1|  PREDICTED: WAT1-related protein At5g07050-like   52.4    3e-05   
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050        52.4    3e-05   
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g           52.4    3e-05   
gb|AFK39191.1|  unknown                                               52.4    3e-05   
gb|EMS60728.1|  Auxin-induced protein 5NG4                            52.4    3e-05   
ref|XP_003547068.1|  PREDICTED: WAT1-related protein At1g68170-like   52.4    3e-05   
ref|XP_010687694.1|  PREDICTED: WAT1-related protein At4g30420        52.4    3e-05   
gb|KHG03072.1|  Auxin-induced 5NG4                                    52.4    3e-05   
ref|XP_011091208.1|  PREDICTED: WAT1-related protein At4g08300-like   52.0    3e-05   
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...  52.0    3e-05   
gb|EMT13376.1|  Auxin-induced protein 5NG4                            52.4    3e-05   
gb|EEC79453.1|  hypothetical protein OsI_20446                        52.4    3e-05   
ref|NP_001055921.1|  Os05g0493800                                     52.4    3e-05   
gb|KEH41550.1|  nodulin MtN21/EamA-like transporter family protein    51.6    3e-05   
ref|XP_004500563.1|  PREDICTED: WAT1-related protein At4g08290-like   52.0    3e-05   
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like   52.0    3e-05   
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                  52.0    3e-05   
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...  52.0    3e-05   
ref|XP_004959978.1|  PREDICTED: WAT1-related protein At1g25270-like   52.0    3e-05   
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like   52.0    3e-05   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like   52.0    3e-05   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...  52.0    3e-05   
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like   52.0    4e-05   
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                  52.0    4e-05   
ref|XP_007201258.1|  hypothetical protein PRUPE_ppa008369mg           51.6    4e-05   
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                  52.0    4e-05   
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like   52.0    4e-05   
ref|XP_003551846.1|  PREDICTED: WAT1-related protein At1g25270-like   52.0    4e-05   
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...  52.0    4e-05   
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like   51.6    4e-05   
ref|XP_008235790.1|  PREDICTED: WAT1-related protein At1g44800-like   52.0    4e-05   
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...  51.6    4e-05   
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g           52.0    4e-05   
gb|KHG12592.1|  Auxin-induced 5NG4                                    50.8    4e-05   
ref|XP_004142696.1|  PREDICTED: auxin-induced protein 5NG4-like       48.5    4e-05   
gb|EMT04611.1|  Auxin-induced protein 5NG4                            51.6    4e-05   
gb|EAY72293.1|  hypothetical protein OsI_00148                        51.6    4e-05   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                   52.0    4e-05   
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like   51.6    4e-05   
ref|NP_001148990.1|  nodulin protein                                  51.6    5e-05   
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like       51.6    5e-05   
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like       51.6    5e-05   
gb|KEH42716.1|  auxin-induced 5NG4-like protein                       51.6    5e-05   
gb|AFK38302.1|  unknown                                               51.6    5e-05   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like   51.6    5e-05   
gb|KGN59418.1|  hypothetical protein Csa_3G818270                     51.6    5e-05   
ref|XP_006285169.1|  hypothetical protein CARUB_v10006514mg           51.6    5e-05   
emb|CDX70003.1|  BnaA10g23520D                                        51.6    5e-05   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like   51.6    5e-05   
gb|EMT05125.1|  Auxin-induced protein 5NG4                            50.4    5e-05   
gb|KHN47037.1|  Auxin-induced protein 5NG4-like protein               51.6    5e-05   
ref|XP_003593115.1|  Auxin-induced protein 5NG4                       51.6    5e-05   
ref|XP_002309381.2|  hypothetical protein POPTR_0006s19150g           50.4    5e-05   
ref|XP_008375444.1|  PREDICTED: WAT1-related protein At1g43650-like   51.2    5e-05   
ref|XP_003541345.1|  PREDICTED: WAT1-related protein At3g18200-like   51.2    5e-05   
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like   51.6    5e-05   
gb|ACU17240.1|  unknown                                               48.1    6e-05   
gb|AAM65570.1|  nodulin-like protein                                  51.2    6e-05   
gb|KHG09563.1|  Auxin-induced 5NG4                                    51.2    6e-05   
ref|XP_008233583.1|  PREDICTED: WAT1-related protein At2g37460-li...  50.8    6e-05   
ref|XP_009360245.1|  PREDICTED: WAT1-related protein At1g43650-like   51.2    6e-05   
gb|EMS60727.1|  Auxin-induced protein 5NG4                            51.2    6e-05   
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740           51.2    6e-05   
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like   51.2    6e-05   
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like   51.2    6e-05   
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...  51.2    6e-05   
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...  51.2    6e-05   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...  51.2    6e-05   
ref|XP_006846485.1|  hypothetical protein AMTR_s00018p00139030        51.2    6e-05   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                   51.2    6e-05   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like   51.2    6e-05   
emb|CDY04680.1|  BnaC05g17180D                                        51.2    6e-05   
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like   51.2    6e-05   
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg           51.2    6e-05   
emb|CBI35062.3|  unnamed protein product                              51.2    6e-05   
gb|KDP40571.1|  hypothetical protein JCGZ_24570                       51.2    6e-05   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...  51.2    6e-05   
ref|XP_010096638.1|  Auxin-induced protein 5NG4                       51.2    6e-05   
gb|KJB73827.1|  hypothetical protein B456_011G255200                  50.4    7e-05   
emb|CDY64772.1|  BnaC08g49990D                                        50.8    7e-05   
gb|KHG11891.1|  Auxin-induced 5NG4                                    51.2    7e-05   
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050        51.2    7e-05   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050        51.2    7e-05   
ref|XP_010026174.1|  PREDICTED: WAT1-related protein At1g09380-like   50.8    7e-05   
ref|XP_006305109.1|  hypothetical protein CARUB_v10009476mg           50.8    7e-05   
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like   50.8    7e-05   
gb|KHG12908.1|  Auxin-induced 5NG4                                    50.8    7e-05   
emb|CBI32681.3|  unnamed protein product                              50.8    8e-05   
gb|EMS48876.1|  Auxin-induced protein 5NG4                            50.8    8e-05   
gb|KJB73828.1|  hypothetical protein B456_011G255200                  50.8    8e-05   
gb|KJB73825.1|  hypothetical protein B456_011G255200                  50.8    8e-05   
ref|XP_007224058.1|  hypothetical protein PRUPE_ppa015276mg           50.8    8e-05   
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290        50.8    8e-05   
ref|XP_011028934.1|  PREDICTED: protein WALLS ARE THIN 1-like         50.8    8e-05   
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like   50.8    8e-05   
ref|XP_008224471.1|  PREDICTED: WAT1-related protein At4g08300-like   50.8    8e-05   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like   50.8    8e-05   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like   50.8    8e-05   
ref|NP_001066591.1|  Os12g0288000                                     50.8    8e-05   
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like   50.8    8e-05   
ref|XP_010438180.1|  PREDICTED: WAT1-related protein At4g30420        50.8    8e-05   
ref|XP_002520409.1|  conserved hypothetical protein                   50.4    8e-05   
ref|XP_009399308.1|  PREDICTED: WAT1-related protein At1g68170-like   50.8    8e-05   
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g           50.8    8e-05   
gb|KJB78535.1|  hypothetical protein B456_013G004200                  50.8    8e-05   
gb|EMT08224.1|  Auxin-induced protein 5NG4                            50.4    8e-05   
ref|XP_009379003.1|  PREDICTED: WAT1-related protein At5g07050-like   50.8    8e-05   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like   50.8    9e-05   
ref|XP_006660646.1|  PREDICTED: WAT1-related protein At4g30420-like   50.4    9e-05   
gb|EEC69113.1|  hypothetical protein OsI_38025                        50.8    9e-05   
gb|KJB73826.1|  hypothetical protein B456_011G255200                  50.8    9e-05   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like   50.8    9e-05   
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg           50.4    9e-05   



>ref|XP_009767374.1| PREDICTED: WAT1-related protein At4g08300-like [Nicotiana sylvestris]
Length=385

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKGKMQELPIVMMDRES  179
            IT+VLA IILAE+++ GS IGA IIV+GLYSVVWGKSK+ + NE GK QELP+V +   S
Sbjct  297  ITSVLAAIILAESVHLGSCIGAVIIVMGLYSVVWGKSKEGKGNETGKDQELPVVDIKERS  356

Query  180  VESKD------TIKSKL  212
                D      T+KSK+
Sbjct  357  TIVDDISDDVTTVKSKV  373



>ref|XP_009623147.1| PREDICTED: WAT1-related protein At4g08300 isoform X2 [Nicotiana 
tomentosiformis]
Length=394

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKGKMQELPIVMMDRES  179
            IT+VLA IILAE+++ GS IGA IIV+GLYSVVWGKSK+ + NE GK QELP+V +   S
Sbjct  306  ITSVLAAIILAESVHLGSCIGAIIIVMGLYSVVWGKSKEGKGNETGKDQELPVVDIKERS  365

Query  180  VESKD------TIKSKL  212
                D      T+KSK+
Sbjct  366  TIVDDISDDVTTVKSKV  382



>ref|XP_009623146.1| PREDICTED: WAT1-related protein At4g08300 isoform X1 [Nicotiana 
tomentosiformis]
Length=406

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKGKMQELPIVMMDRES  179
            IT+VLA IILAE+++ GS IGA IIV+GLYSVVWGKSK+ + NE GK QELP+V +   S
Sbjct  318  ITSVLAAIILAESVHLGSCIGAIIIVMGLYSVVWGKSKEGKGNETGKDQELPVVDIKERS  377

Query  180  VESKD------TIKSKL  212
                D      T+KSK+
Sbjct  378  TIVDDISDDVTTVKSKV  394



>ref|XP_011074856.1| PREDICTED: WAT1-related protein At1g44800-like [Sesamum indicum]
Length=389

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDET------NEKGKMQELPIVM  164
            ITAVL  IIL+E ++ GSLIGA IIV GLYSVVWGKSK+ +       ++ + QELP+  
Sbjct  299  ITAVLGAIILSEQVHLGSLIGALIIVFGLYSVVWGKSKENSAANKLAYDEERAQELPVTD  358

Query  165  MDRESVESKDTI------KSKLQEKTPQE  233
             D + V   D I      KS  ++ +PQE
Sbjct  359  KDMQGVGDADIIETIVKSKSHQKKNSPQE  387



>gb|ACU17519.1| unknown [Glycine max]
Length=80

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  ++LAE ++ GS+ GA +IV GLY+VVWGKSKD  +    EKG+ QELPI    
Sbjct  3    ITAALGSLVLAEQVHLGSIFGAILIVCGLYTVVWGKSKDRKSTTEIEKGESQELPIKNGT  62

Query  171  RESVESKDTIKS  206
            + + +  D +KS
Sbjct  63   KSASDIFDALKS  74



>ref|XP_006351896.1| PREDICTED: WAT1-related protein At4g08300-like [Solanum tuberosum]
Length=368

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNE-KGKMQELPIVMMDRE  176
            IT+VLA IILAE+++ GSLIGA IIV+GLYSVVWGKSK+ + NE   K QELP+V +   
Sbjct  291  ITSVLAAIILAESVHLGSLIGAIIIVMGLYSVVWGKSKEGKGNEITSKDQELPVVDIKER  350

Query  177  SVESKDTIKSKLQEKTP  227
            S    D I    ++KTP
Sbjct  351  STIVDDII----EKKTP  363



>ref|XP_007141061.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
 gb|ESW13055.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
Length=385

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  I+LAE +Y GS+IGA IIV GLY+VVWGKSKD  N    EK + QELPI    
Sbjct  298  ITAALGSIVLAEQVYMGSVIGAIIIVSGLYTVVWGKSKDNVNKTEAEKSEGQELPI----  353

Query  171  RESVESKDTIKSKLQEKTPQEA  236
            ++S  S   I   ++   P  A
Sbjct  354  KDSAASGSGIFDSIEINVPSGA  375



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I A L  +ILAE I+ GS+IGA +IVIGLYSVVWGKSKD       TNEKG+  ELP+  
Sbjct  298  IVAALGSLILAEQIHLGSVIGAIVIVIGLYSVVWGKSKDIVASSQLTNEKGQALELPVAA  357

Query  165  MDRESVESKDTIKSKLQEK  221
             D     + D   S + E+
Sbjct  358  TDGAKSINGDHNGSSVMEE  376



>ref|XP_011069552.1| PREDICTED: WAT1-related protein At1g21890-like [Sesamum indicum]
Length=384

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-----GKMQELPIVMM  167
            ITAVL  I+LAE ++ GSLIGA IIV GLYSVVWGKSK+  + K     G+ QELP+V  
Sbjct  299  ITAVLGAIVLAEQVHLGSLIGAVIIVSGLYSVVWGKSKESASNKLVDGEGRDQELPVVDK  358

Query  168  DRESVESKDTIKSKLQEK  221
                V   D   +  + K
Sbjct  359  QTSGVADADVSHTAAKSK  376



>ref|XP_004250321.2| PREDICTED: WAT1-related protein At4g08300-like [Solanum lycopersicum]
Length=403

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNE-KGKMQELPIVMMDRE  176
            IT++LA IILAE+++ GSLIGA IIV+GLYSVVWGKSK+ + N+   K QELP+V +   
Sbjct  325  ITSILAAIILAESVHLGSLIGAIIIVMGLYSVVWGKSKEGKINDITSKDQELPVVDIKER  384

Query  177  SVESKDTIKSK  209
            S    D I  K
Sbjct  385  STIVDDNINEK  395



>gb|KJB48378.1| hypothetical protein B456_008G069300 [Gossypium raimondii]
Length=90

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIV  161
            ITA L   ILAE ++ GS+IG  II+  LY+V+WGKSKD+ N    E GK+QELPI 
Sbjct  3    ITAALGSFILAEKVHLGSIIGTVIIIFRLYTVLWGKSKDQKNSTATENGKIQELPIT  59



>gb|KJB66874.1| hypothetical protein B456_010G162600, partial [Gossypium raimondii]
Length=114

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPI  158
            ITA L   ILAE  + GS+IG  II+ GLY+V+WGKSKD+ N    E GK+QELPI
Sbjct  28   ITAALGYFILAEKFHLGSIIGTVIIIFGLYTVLWGKSKDQKNSTATENGKVQELPI  83



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE------TNEKGKMQELPIVM  164
            I A L  +IL E ++ GS+IGA +IVIGLYSVVWGKSKD       TNEKG+  ELP+  
Sbjct  297  IVAALGSLILGEQLHLGSVIGALVIVIGLYSVVWGKSKDHLVSSELTNEKGQALELPVAS  356

Query  165  MD  170
             D
Sbjct  357  TD  358



>gb|AAM62626.1| nodulin protein, putative [Arabidopsis thaliana]
Length=365

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EK--GKMQELPIVMM  167
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKDE N   EK   K QELPI  +
Sbjct  285  ITAFLGALVLAEKIHLGSIIGAVFIVVGLYSVVWGKSKDEVNPLDEKIVAKNQELPITNV  344

Query  168  DRES  179
             +++
Sbjct  345  VKQT  348



>ref|NP_175101.1| bidirectional amino acid transporter SIAR1 [Arabidopsis thaliana]
 sp|Q9LPF1.1|WTR8_ARATH RecName: Full=WAT1-related protein At1g44800 [Arabidopsis thaliana]
 gb|AAF78263.1|AC020576_7 Contains similarity to Mtn21 gene from Medicago truncatula gb|Y15293 
and contains two integral membrane protein domains DUF6 
of unknown function PF|00892. ESTs gb|AI998702, gb|Z30851 
come from this gene [Arabidopsis thaliana]
 gb|AAK83648.1| At1g44800/T12C22_7 [Arabidopsis thaliana]
 gb|AAN31118.1| At1g44800/T12C22_7 [Arabidopsis thaliana]
 gb|AEE32053.1| bidirectional amino acid transporter SIAR1 [Arabidopsis thaliana]
Length=370

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EK--GKMQELPIVMM  167
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKDE N   EK   K QELPI  +
Sbjct  290  ITAFLGALVLAEKIHLGSIIGAVFIVLGLYSVVWGKSKDEVNPLDEKIVAKSQELPITNV  349

Query  168  DRES  179
             +++
Sbjct  350  VKQT  353



>gb|KFK36195.1| hypothetical protein AALP_AA4G090300 [Arabis alpina]
Length=372

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPIVMMDR  173
            IT++L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   +K   QELPIV + +
Sbjct  294  ITSILGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDGANPLDDKIVTQELPIVNVVK  353

Query  174  ES  179
            +S
Sbjct  354  QS  355



>ref|XP_009151421.1| PREDICTED: WAT1-related protein At4g08300 isoform X2 [Brassica 
rapa]
Length=352

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE    T EK  MQELPI
Sbjct  274  ITAFLGALVLAEKIHLGSIIGAVFIVFGLYSVVWGKAKDEVISTTEEKIGMQELPI  329



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPIVMMDR  173
            ITA L   +LAE ++ GS+IG  II+ GLY+V+WGKSKD+ N   ++GK+QELPI     
Sbjct  297  ITAALGSFLLAEKVHLGSIIGTVIIICGLYTVLWGKSKDQQNSTTDEGKLQELPIT-DSA  355

Query  174  ESVESKDTIKSKLQ-EKTPQE  233
            +S++ +D+I+   +  K P E
Sbjct  356  KSIDIEDSIEGPARILKIPTE  376



>emb|CDY63388.1| BnaCnng41950D [Brassica napus]
Length=373

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE    T EK  MQELPI
Sbjct  295  ITAFLGALVLAEKIHLGSIIGAVFIVFGLYSVVWGKAKDEVISTTEEKIGMQELPI  350



>ref|XP_009151420.1| PREDICTED: WAT1-related protein At4g08300 isoform X1 [Brassica 
rapa]
Length=373

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE    T EK  MQELPI
Sbjct  295  ITAFLGALVLAEKIHLGSIIGAVFIVFGLYSVVWGKAKDEVISTTEEKIGMQELPI  350



>ref|XP_002893995.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70254.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=370

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EK--GKMQELPIVMM  167
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKDE N   EK   K QELPI  +
Sbjct  290  ITAFLGALVLAEKIHLGSIIGAVFIVLGLYSVVWGKSKDEVNPLDEKIVAKNQELPITNV  349

Query  168  DRES  179
             +++
Sbjct  350  VKQT  353



>emb|CDY49560.1| BnaAnng10230D [Brassica napus]
Length=373

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE    T EK  MQELPI
Sbjct  295  ITAFLGALVLAEKIHLGSIIGAVFIVFGLYSVVWGKAKDEMISTTEEKIGMQELPI  350



>emb|CDY57632.1| BnaC08g46530D [Brassica napus]
Length=289

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPIVMMDR  173
            IT+ L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   EK   QELPI ++ +
Sbjct  203  ITSFLGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDVVNPLDEKMVAQELPITVVKQ  262

Query  174  E  176
             
Sbjct  263  H  263



>gb|KJB59209.1| hypothetical protein B456_009G245000 [Gossypium raimondii]
Length=377

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPI  158
            ITA L   ILAE ++ GS+IG  II+ GLY+V+WGKSKD+ N    E GK+QELPI
Sbjct  290  ITAALGSFILAEKVHLGSIIGTVIIIFGLYTVLWGKSKDQKNSTATENGKVQELPI  345



>gb|KHG29332.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPI  158
            ITA L   ILAE ++ GS+IG  II+ GLY+V+WGKSKD+ N    E GK+QELPI
Sbjct  290  ITAALGSFILAEKVHLGSIIGTVIIIFGLYTVLWGKSKDQKNATAIENGKVQELPI  345



>gb|ACD56621.1| putative nodulin-like protein [Gossypioides kirkii]
Length=382

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIV+GLY+VVWGKSKD    ET+EK   +QELP+
Sbjct  297  ITAALGAIILAEKLHLGSILGAIIIVLGLYTVVWGKSKDGKNTETDEKSNGLQELPV  353



>emb|CDY71496.1| BnaAnng37680D [Brassica napus]
Length=290

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPIVMMDR  173
            IT+ L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   EK   QELPI  + +
Sbjct  203  ITSFLGALVLAEKIHLGSIIGAVFIVIGLYSVVWGKSKDAVNPLDEKIVAQELPITNVVK  262

Query  174  E  176
            +
Sbjct  263  Q  263



>ref|XP_010461452.1| PREDICTED: WAT1-related protein At1g44800 [Camelina sativa]
Length=371

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-----GKMQELPIVMM  167
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKDE N        K QELPI  +
Sbjct  290  ITAFLGALVLAEKIHLGSIIGAVFIVLGLYSVVWGKSKDEVNPLDVKVVTKDQELPITSV  349

Query  168  DRES  179
             +++
Sbjct  350  VKQT  353



>gb|KJB16279.1| hypothetical protein B456_002G221400 [Gossypium raimondii]
Length=382

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA L   ILAE ++ GS++GA IIV+GLY+VVWGKSKD    ET+EK   +QELP+   
Sbjct  297  ITAALGATILAEKLHLGSILGAIIIVLGLYTVVWGKSKDGKNTETDEKSNGLQELPLTNN  356

Query  168  DR  173
            D+
Sbjct  357  DK  358



>emb|CDP15800.1| unnamed protein product [Coffea canephora]
Length=382

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN-----EKGKMQELPIV--  161
            ITAVL  I+LAE  + GSLIGA +IVIGLYSV+WGKSKD T      EKGK  +L  +  
Sbjct  299  ITAVLGAIVLAEQTHLGSLIGATVIVIGLYSVIWGKSKDLTAANAEFEKGKASQLENISD  358

Query  162  MMDRESVESKDTIKSKLQEKTPQ  230
              D   +ES    KS  ++  P+
Sbjct  359  FGDDIDLESNGVSKSAAKKFPPE  381



>ref|XP_010469717.1| PREDICTED: WAT1-related protein At4g08300-like [Camelina sativa]
Length=124

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLY VVWGK+KDE     EK  +QELPI  +  
Sbjct  45   ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYCVVWGKAKDEVISVEEKTGLQELPITNIST  104

Query  174  ES  179
            ++
Sbjct  105  KT  106



>ref|XP_010939364.1| PREDICTED: WAT1-related protein At2g37450 isoform X2 [Elaeis 
guineensis]
Length=311

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ------ELPIVM  164
            ITAVL  I+LAE+I  GS+IGA  IVIGLYS++WGKSKD  N++ +        ELP+ +
Sbjct  232  ITAVLGSIVLAEDITLGSVIGAVFIVIGLYSLIWGKSKDHLNQRSQSSEKTGAFELPLAI  291

Query  165  MD  170
             D
Sbjct  292  TD  293



>gb|KJB16270.1| hypothetical protein B456_002G221300 [Gossypium raimondii]
Length=306

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIV+GLY+VVWGKSKD    ET++K   +QELP+
Sbjct  221  ITAALGAIILAEKLHLGSILGAIIIVLGLYTVVWGKSKDGKNTETDDKSNGLQELPV  277



>ref|XP_006581581.1| PREDICTED: WAT1-related protein At4g08300 [Glycine max]
Length=399

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  ++LAE ++ GS+ GA +IV GLY+VVWGKSKD  +    EKG+ QELPI    
Sbjct  303  ITAALGSLVLAEQVHLGSIFGAILIVCGLYTVVWGKSKDRKSTTEIEKGESQELPI----  358

Query  171  RESVESKDTIKSKLQEKTPQE  233
            +   +S   I   ++   P E
Sbjct  359  KNGTKSASDIFDGIEINVPSE  379



>ref|XP_006287944.1| hypothetical protein CARUB_v10001177mg [Capsella rubella]
 gb|EOA20842.1| hypothetical protein CARUB_v10001177mg [Capsella rubella]
Length=380

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  +QELPI  +  
Sbjct  298  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVIPVEEKVGLQELPITNIST  357

Query  174  ESVE  185
            ++ E
Sbjct  358  KTAE  361



>ref|XP_006593592.1| PREDICTED: WAT1-related protein At1g44800-like [Glycine max]
 gb|KHN33863.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=389

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 9/83 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-----GKMQELPIVMM  167
            ITA L  I+LAE +Y GS+IGA IIV GLY+VVWGKSKD+ N K      +  ELPI   
Sbjct  300  ITAALGSIVLAEQVYMGSVIGAIIIVSGLYTVVWGKSKDKLNNKTNEGNSEGHELPI---  356

Query  168  DRESVESKDTIKSKLQEKTPQEA  236
             ++  +S   I   ++   P  A
Sbjct  357  -KDGTKSGSDIFDSIEINVPSGA  378



>gb|ACU23200.1| unknown [Glycine max]
Length=389

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 9/83 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-----GKMQELPIVMM  167
            ITA L  I+LAE +Y GS+IGA IIV GLY+VVWGKSKD+ N K      +  ELPI   
Sbjct  300  ITAALGSIVLAEQVYMGSVIGAIIIVSGLYTVVWGKSKDKLNNKTNEGNSEGHELPI---  356

Query  168  DRESVESKDTIKSKLQEKTPQEA  236
             ++  +S   I   ++   P  A
Sbjct  357  -KDGTKSGSDIFDSIEINVPSGA  378



>gb|KHN09198.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=399

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  ++LAE ++ GS+ GA +IV GLY+VVWGKSKD  +    EKG+ QELPI    
Sbjct  303  ITAALGSLVLAEQVHLGSIFGAILIVCGLYTVVWGKSKDRKSTTEIEKGESQELPI----  358

Query  171  RESVESKDTIKSKLQEKTPQE  233
            +   +S   I   ++   P E
Sbjct  359  KNGTKSASDIFDGIEINVPAE  379



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ------ELPIVM  164
            ITAVL  I+LAE+I  GS+IGA  IVIGLYS++WGKSKD  N++ +        ELP+ +
Sbjct  292  ITAVLGSIVLAEDITLGSVIGAVFIVIGLYSLIWGKSKDHLNQRSQSSEKTGAFELPLAI  351

Query  165  MD  170
             D
Sbjct  352  TD  353



>ref|XP_009107474.1| PREDICTED: WAT1-related protein At1g44800 [Brassica rapa]
Length=378

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPIVMMDR  173
            IT+ L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   EK   QELPI  + +
Sbjct  291  ITSFLGALVLAEKIHLGSIIGAVFIVIGLYSVVWGKSKDAVNPLDEKIVAQELPITNVVK  350

Query  174  E  176
            +
Sbjct  351  Q  351



>gb|KJB16269.1| hypothetical protein B456_002G221300 [Gossypium raimondii]
Length=343

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIV+GLY+VVWGKSKD    ET++K   +QELP+
Sbjct  258  ITAALGAIILAEKLHLGSILGAIIIVLGLYTVVWGKSKDGKNTETDDKSNGLQELPV  314



>ref|XP_010538980.1| PREDICTED: WAT1-related protein At4g08300 [Tarenaya hassleriana]
Length=377

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLY VVWGKSKD  N   EK  +QELPI
Sbjct  299  ITAFLGALVLAETIHLGSIIGAVFIVFGLYFVVWGKSKDNVNSAEEKMAIQELPI  353



>ref|XP_006305116.1| hypothetical protein CARUB_v10009485mg [Capsella rubella]
 gb|EOA38014.1| hypothetical protein CARUB_v10009485mg [Capsella rubella]
Length=372

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE-----KGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKDE N        K QELPI
Sbjct  290  ITAFLGALVLAEKIHLGSIIGAVFIVLGLYSVVWGKSKDEVNPLDVKVVTKDQELPI  346



>gb|KJB16268.1| hypothetical protein B456_002G221300 [Gossypium raimondii]
Length=382

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIV+GLY+VVWGKSKD    ET++K   +QELP+
Sbjct  297  ITAALGAIILAEKLHLGSILGAIIIVLGLYTVVWGKSKDGKNTETDDKSNGLQELPV  353



>gb|KJB29231.1| hypothetical protein B456_005G090300 [Gossypium raimondii]
Length=348

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA+L  IILAE I+ GS++GA IIV GLY+VVWGKSKD    ET+ K   +QELPI   
Sbjct  258  ITAILGAIILAEKIHLGSILGAIIIVTGLYTVVWGKSKDGENSETDVKCNGLQELPITGN  317

Query  168  DRESVESKDTIK  203
             +   +  D I 
Sbjct  318  AKSITDDDDDIN  329



>gb|KHG13292.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=292

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIV+GLY+VVWGK KD    ET+EK   +QELP+
Sbjct  207  ITAALGAIILAEKLHLGSVLGAIIIVLGLYTVVWGKRKDGKNTETDEKSNGLQELPV  263



>gb|KJB29230.1| hypothetical protein B456_005G090300 [Gossypium raimondii]
Length=387

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA+L  IILAE I+ GS++GA IIV GLY+VVWGKSKD    ET+ K   +QELPI   
Sbjct  297  ITAILGAIILAEKIHLGSILGAIIIVTGLYTVVWGKSKDGENSETDVKCNGLQELPITGN  356

Query  168  DRESVESKDTIK  203
             +   +  D I 
Sbjct  357  AKSITDDDDDIN  368



>gb|KJB64393.1| hypothetical protein B456_010G049300 [Gossypium raimondii]
Length=384

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA L   +LAE ++ GS++GA IIV GLY+VVWGKSKD    E++EK K +QELPI   
Sbjct  294  ITAALGTFVLAEKVHLGSILGAIIIVSGLYTVVWGKSKDGKNLESDEKSKGLQELPIT-N  352

Query  168  DRESVESKDTI  200
            + +S+   D+I
Sbjct  353  NAKSINVNDSI  363



>gb|EYU23896.1| hypothetical protein MIMGU_mgv1a008243mg [Erythranthe guttata]
Length=380

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 10/63 (16%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM----------QEL  152
            ITAVL  +IL+E I+ GSLIGA IIV GLY VVWGKSK+  N+ G            QEL
Sbjct  288  ITAVLGALILSEQIHLGSLIGAVIIVFGLYCVVWGKSKENNNKPGGSDKLASSGKGGQEL  347

Query  153  PIV  161
            PIV
Sbjct  348  PIV  350



>gb|KHG18008.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=387

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA+L  IILAE I+ GS++GA IIV GLY+VVWGKSKD    ET+ K   +QELPI   
Sbjct  297  ITAILGAIILAEKIHLGSILGAIIIVTGLYTVVWGKSKDGENSETDVKCNGLQELPITGN  356

Query  168  DRESVESKDTIK  203
             +   +  D I 
Sbjct  357  AKSITDDDDDIN  368



>emb|CAB45800.1| nodulin-like protein [Arabidopsis thaliana]
 emb|CAB77955.1| nodulin-like protein [Arabidopsis thaliana]
Length=368

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  MQELPI
Sbjct  288  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVISVEEKIGMQELPI  342



>ref|XP_010421739.1| PREDICTED: WAT1-related protein At4g08300-like isoform X1 [Camelina 
sativa]
Length=389

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  +QELPI  +  
Sbjct  310  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVISVEEKTGLQELPITNIST  369

Query  174  ES  179
            ++
Sbjct  370  KT  371



>ref|XP_010421740.1| PREDICTED: WAT1-related protein At4g08300-like isoform X2 [Camelina 
sativa]
Length=382

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  +QELPI  +  
Sbjct  303  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVISVEEKTGLQELPITNIST  362

Query  174  ES  179
            ++
Sbjct  363  KT  364



>ref|NP_001240202.1| uncharacterized protein LOC100811114 [Glycine max]
 gb|ACU19405.1| unknown [Glycine max]
Length=394

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  ++LAE ++ GS+ GA +IV GLY+VVWGKSKD  +    EKG+ +ELPI    
Sbjct  303  ITAALGSLVLAEQVHLGSIFGAILIVCGLYTVVWGKSKDRKSTREIEKGESRELPI----  358

Query  171  RESVESKDTIKSKLQEKTPQE  233
            ++  +S   I   ++   P E
Sbjct  359  KDGTKSASDIYEGIEINVPAE  379



>ref|NP_192570.2| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q501F8.1|WTR32_ARATH RecName: Full=WAT1-related protein At4g08300 [Arabidopsis thaliana]
 gb|AAY25421.1| At4g08300 [Arabidopsis thaliana]
 dbj|BAF01344.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE82623.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=373

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  MQELPI
Sbjct  293  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVISVEEKIGMQELPI  347



>gb|ACJ84735.1| unknown [Medicago truncatula]
Length=372

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPI  158
            ITA L  I+LAE  + GS+IGA IIV GLY+VVWGKSKD  N     K + QELPI
Sbjct  296  ITAALGSIVLAEQTHLGSIIGAIIIVCGLYTVVWGKSKDSVNTIDAPKSEGQELPI  351



>gb|AFK35679.1| unknown [Medicago truncatula]
Length=382

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  I+LAE  + GS+IGA IIV GLY+VVWGKSKD  N     K + QELPI    
Sbjct  296  ITAALGSIVLAEQTHLGSIIGAIIIVCGLYTVVWGKSKDSVNTIDAPKSEGQELPI----  351

Query  171  RESVESKDTIKSKLQEKTPQE  233
            ++   +   I   ++   P++
Sbjct  352  KDGTRTGSDIFESIEVNVPKD  372



>gb|KHN47031.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=394

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  ++LAE ++ GS+ GA +IV GLY+VVWGKSKD  +    EKG+ +ELPI    
Sbjct  303  ITAALGSLVLAEQVHLGSIFGAILIVCGLYTVVWGKSKDRKSTREIEKGESRELPI----  358

Query  171  RESVESKDTIKSKLQEKTPQE  233
            ++  +S   I   ++   P E
Sbjct  359  KDGTKSASDIYEGIEINVPAE  379



>ref|XP_010669710.1| PREDICTED: WAT1-related protein At4g08300-like [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 11/85 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--TNEKGKMQ-ELPIVMMDR  173
            ITA    +IL E ++ GS+IGA IIVIGLY+VVWGKSKD   ++EKGK+Q ELPIV    
Sbjct  296  ITAASGSLILHELLHLGSIIGALIIVIGLYTVVWGKSKDLRISDEKGKVQAELPIV----  351

Query  174  ESVESKDTIKSKLQEKTPQEA*NIE  248
                   TI +     TP ++ +I 
Sbjct  352  ----HDSTINTIAAATTPTKSTDIN  372



>gb|AFK47115.1| unknown [Medicago truncatula]
 gb|KEH40539.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=382

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN----EKGKMQELPIVMMD  170
            ITA L  I+LAE  + GS+IGA IIV GLY+VVWGKSKD  N     K + QELPI    
Sbjct  296  ITAALGSIVLAEQTHLGSIIGAIIIVCGLYTVVWGKSKDSVNTIDAPKSEGQELPI----  351

Query  171  RESVESKDTIKSKLQEKTPQE  233
            ++   +   I   ++   P++
Sbjct  352  KDGTRTGSDIFESIEVNVPKD  372



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I AVL  IILAE I  G LIGA IIVIGLYS++WGKSKD      ET E+    ELPI  
Sbjct  291  IVAVLGSIILAEEITLGRLIGAIIIVIGLYSLIWGKSKDHLTQPSETGEEMGALELPIAA  350

Query  165  MDRESVESKD  194
             D    +S D
Sbjct  351  TDAIRSKSAD  360



>ref|XP_010999364.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=387

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 8/59 (14%)
 Frame = +3

Query  6    TAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--------TNEKGKMQELPI  158
            TA L  I+LAE I+ GS+IGAF+IV GLY+VVWGKSK+         T+E+   QELPI
Sbjct  298  TAALGSIVLAEQIHLGSIIGAFLIVWGLYTVVWGKSKERINSSKLQMTSERTGTQELPI  356



>ref|XP_011027560.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=391

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 11/77 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--------TNEKGKMQ-ELP  155
            ITA L  I+L+E I+ GS+IGA +IV GLY+VVWGKSKD         TNEKG  Q +LP
Sbjct  298  ITAALGSIVLSEQIHLGSIIGAILIVFGLYTVVWGKSKDSISSSTMELTNEKGGPQDQLP  357

Query  156  IVMMDRESVESKDTIKS  206
            I   D   + S +   S
Sbjct  358  I--QDSSKLSSANFANS  372



>gb|KHG01110.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=151

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE ++ GS++GA IIVIGLY++VWGKSKD    ET+EK   +QEL +
Sbjct  66   ITAALGTIILAEKLHLGSILGAIIIVIGLYTMVWGKSKDGKNIETDEKSNSLQELAV  122



>ref|XP_002872390.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48649.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=367

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV GLYSVVWGK+KDE     EK  +QELPI
Sbjct  293  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYSVVWGKAKDEVISAEEKIGLQELPI  347



>ref|XP_007019027.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY16252.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=386

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGKMQELPIVMMD  170
            ITA L  ++LAE I+ GS++GA IIV GLY VVWGKSKD    ET+EK   QELPI    
Sbjct  297  ITAALGVVVLAEKIHFGSILGAIIIVSGLYIVVWGKSKDAKNSETDEKSIEQELPITNNA  356

Query  171  RE  176
            R 
Sbjct  357  RS  358



>gb|KJB64433.1| hypothetical protein B456_010G049200 [Gossypium raimondii]
Length=308

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L   +L+E ++ GS++GA IIV GLY+VVWGKSKD    E++EK K +QELPI
Sbjct  221  ITAALGTFVLSEQVHLGSILGAIIIVSGLYTVVWGKSKDGKSPESDEKSKGLQELPI  277



>ref|XP_010436420.1| PREDICTED: WAT1-related protein At4g08300-like [Camelina sativa]
Length=377

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLY VVWGK+KDE     EK  +QELPI  +  
Sbjct  298  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYCVVWGKAKDEVISVEEKTGLQELPITNIST  357

Query  174  ES  179
            ++
Sbjct  358  KT  359



>ref|XP_007137403.1| hypothetical protein PHAVU_009G124100g [Phaseolus vulgaris]
 gb|ESW09397.1| hypothetical protein PHAVU_009G124100g [Phaseolus vulgaris]
Length=389

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-TNEKGK--MQELPIVMMDR  173
            ITA L  ++LAE ++ GS++GA +IV GLY+VVWGKSKD  T + GK   QELP+    +
Sbjct  302  ITAALGSLVLAEQVHLGSILGAILIVCGLYTVVWGKSKDRNTTDMGKEASQELPM----K  357

Query  174  ESVESKDTIKSKLQEKTPQE  233
            ++ +S   I   L+   P E
Sbjct  358  DTTKSASDIFYGLEINVPGE  377



>ref|XP_003544681.1| PREDICTED: WAT1-related protein At1g44800-like [Glycine max]
Length=387

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE----KGKMQELPI  158
            ITA L  I+LAE +Y GS+IGA IIV GLY+VVWGKSKD+ N+      +  ELPI
Sbjct  300  ITAALGSIVLAEQVYLGSVIGAIIIVSGLYTVVWGKSKDKLNKTKEGNSEGHELPI  355



>ref|XP_004498329.1| PREDICTED: WAT1-related protein At1g44800-like isoform X2 [Cicer 
arietinum]
Length=309

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE-----KGKMQELPI  158
            ITA L  ++LAE  + GS+IGA IIV GLY+VVWGKSKD  N      + + QELPI
Sbjct  222  ITAALGAVVLAEQTHLGSIIGAIIIVCGLYTVVWGKSKDSVNNTIDTTQSEGQELPI  278



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 11/80 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGK-MQELPIVMM  167
            ITA+L  I+LAE I+ GS+IGA  IV+GLY VVWGK+KD     TN+K     ELPI   
Sbjct  299  ITAILGSIVLAEQIHLGSIIGAIFIVMGLYLVVWGKAKDHLNKLTNQKSSAATELPI---  355

Query  168  DRESVESKDTIKSKLQEKTP  227
               + E + T   +   K P
Sbjct  356  ---TTEPETTAAERCSSKAP  372



>ref|XP_010455252.1| PREDICTED: WAT1-related protein At4g08300 [Camelina sativa]
Length=377

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA  IV GLY VVWGK+KDE     EK  +QELPI  +  
Sbjct  298  ITAFLGVLVLAEKIHLGSIIGAIFIVFGLYRVVWGKAKDEVISVEEKTGLQELPITNIST  357

Query  174  ES  179
            ++
Sbjct  358  KT  359



>gb|ACJ84542.1| unknown [Medicago truncatula]
Length=70

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            IT  L   + AE ++ GS+IGA II +GLYSVVWGK+KD  ++   +   P+ M   E
Sbjct  3    ITCALGSFLFAEQLHLGSIIGALIIAVGLYSVVWGKAKDYLSDTTTLPPSPVAMKQTE  60



>gb|KJB64434.1| hypothetical protein B456_010G049200 [Gossypium raimondii]
Length=384

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L   +L+E ++ GS++GA IIV GLY+VVWGKSKD    E++EK K +QELPI
Sbjct  297  ITAALGTFVLSEQVHLGSILGAIIIVSGLYTVVWGKSKDGKSPESDEKSKGLQELPI  353



>gb|KHG10291.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=384

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L   +L+E ++ GS++GA IIV GLY+VVWGKSKD    E++EK K +QELPI
Sbjct  297  ITAALGTFVLSEQVHLGSILGAIIIVSGLYTVVWGKSKDGKSPESDEKSKGLQELPI  353



>ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
 gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
Length=387

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPI  158
            IT+ L  IILAE ++ GS++GA +IV GLY+VVWGKSKD        T+EK   QELPI
Sbjct  297  ITSALGVIILAELVHLGSILGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI  355



>ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis]
 gb|KDO80699.1| hypothetical protein CISIN_1g016580mg [Citrus sinensis]
Length=387

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPI  158
            IT+ L  IILAE ++ GS++GA +IV GLY+VVWGKSKD        T+EK   QELPI
Sbjct  297  ITSALGVIILAELVHLGSILGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI  355



>ref|XP_004498328.1| PREDICTED: WAT1-related protein At1g44800-like isoform X1 [Cicer 
arietinum]
Length=383

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE-----KGKMQELPI  158
            ITA L  ++LAE  + GS+IGA IIV GLY+VVWGKSKD  N      + + QELPI
Sbjct  296  ITAALGAVVLAEQTHLGSIIGAIIIVCGLYTVVWGKSKDSVNNTIDTTQSEGQELPI  352



>ref|XP_002306626.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
 gb|EEE93622.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
Length=387

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 8/59 (14%)
 Frame = +3

Query  6    TAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--------TNEKGKMQELPI  158
            TA L  ++LAE I+ GS+IGA +IV GLY+VVWGKSK+         TNEK   QELPI
Sbjct  298  TAALGSLVLAEQIHLGSIIGAVLIVWGLYTVVWGKSKERINSSKLQMTNEKTGTQELPI  356



>gb|KHG16518.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=385

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  IILAE I+ GS++GA IIV GLY+VVWGKSKD    E  EK   +QELPI
Sbjct  298  ITAALGTIILAEKIHLGSILGAIIIVSGLYTVVWGKSKDVKTPELEEKSNGLQELPI  354



>ref|XP_009409675.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 6/62 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKG------KMQELPIVM  164
            ITAVL  IILAE I  GS+IGA IIV+GLYS++WGKSKD+  +        +  +LPI  
Sbjct  291  ITAVLGSIILAEEITLGSVIGAVIIVVGLYSLIWGKSKDQAKQSSERTAAERTLQLPIAA  350

Query  165  MD  170
             D
Sbjct  351  TD  352



>emb|CDY14996.1| BnaA10g08600D [Brassica napus]
Length=382

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM----QELPI  158
            ITA L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   +     QELPI
Sbjct  294  ITAFLGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDVVNPLDEKIVVGQELPI  349



>ref|XP_010479058.1| PREDICTED: WAT1-related protein At1g44800-like [Camelina sativa]
Length=371

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE-----KGKMQELPI  158
            ITA L  ++LAE I+ GS+IGA  IV+GLYSVVWGKSKD  N        K QELPI
Sbjct  290  ITAFLGALVLAEKIHLGSIIGAVFIVLGLYSVVWGKSKDVVNPLDVKVVTKDQELPI  346



>ref|XP_006393710.1| hypothetical protein EUTSA_v10011570mg [Eutrema salsugineum]
 gb|ESQ30996.1| hypothetical protein EUTSA_v10011570mg [Eutrema salsugineum]
Length=383

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK----MQELPIVMMD  170
            IT+ L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   +     QELPI  + 
Sbjct  294  ITSFLGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDLVNPLDEKIVVAQELPITNVV  353

Query  171  RES  179
            +++
Sbjct  354  KQT  356



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 11/80 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGK-MQELPIVMM  167
            ITA+L  I+LAE I+ GS+IGA  IV+GLY VVWGK+KD     TN+K     ELPI   
Sbjct  299  ITAILGSIVLAEQIHLGSIIGAIFIVMGLYLVVWGKAKDHINKLTNQKSNAATELPI---  355

Query  168  DRESVESKDTIKSKLQEKTP  227
               + E + T   +   K P
Sbjct  356  ---TNEPETTAAERCSSKAP  372



>ref|XP_008219662.1| PREDICTED: WAT1-related protein At1g21890-like [Prunus mume]
Length=381

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 7/64 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDET-------NEKGKMQELPIV  161
            ITA LA +ILAE I+ GS++G  +IVIGLY+VVWGKSKD T       +EK    ELP+ 
Sbjct  297  ITAALAAVILAEQIHLGSILGTILIVIGLYAVVWGKSKDPTASSLLIEDEKVVALELPVT  356

Query  162  MMDR  173
            + ++
Sbjct  357  VDNK  360



>ref|XP_009419851.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A++   ILAENIY G ++GA +IV+GLYSV+WGK KD   +K +  ++P+
Sbjct  296  IVAIMGSFILAENIYLGGVVGAVLIVVGLYSVLWGKHKDNKEKKPEAMDIPL  347



>ref|XP_008219763.1| PREDICTED: WAT1-related protein At4g08300 [Prunus mume]
Length=367

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPI  158
            ITA L  I+LAE ++ GS+IGA  IV GLY+VVWGKSKD        T+EK    ELP+
Sbjct  298  ITAALGAIVLAERVHLGSIIGAIFIVFGLYTVVWGKSKDPLASSAPLTDEKSNNLELPV  356



>gb|EYU22954.1| hypothetical protein MIMGU_mgv1a0088041mg [Erythranthe guttata]
Length=362

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 12/65 (18%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE------------TNEKGKMQ  146
            ITAVL  IIL+E ++ GSLIGA IIV+GLYSVVWGKSK+             T  + K  
Sbjct  276  ITAVLGAIILSEQVHLGSLIGAAIIVVGLYSVVWGKSKERSASASASASDKLTYNEEKAN  335

Query  147  ELPIV  161
            ELP+V
Sbjct  336  ELPVV  340



>gb|ABS52574.1| nodulin family protein [Gossypium hirsutum]
Length=385

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPI  158
            ITA L  +ILAE I+ GS++GA IIV GLY+VVWGKSKD    E  EK   +QELPI
Sbjct  298  ITAALGTVILAEKIHLGSILGAIIIVSGLYTVVWGKSKDVKTPELEEKSNGLQELPI  354



>gb|KHG29659.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITAVL  +ILAE I+ GS+IG  +I+ GLY+V+WGKSKD     T E GK  ELPI
Sbjct  292  ITAVLGSMILAEKIHLGSIIGTVLIIFGLYTVLWGKSKDRKSSNTEEGGKDIELPI  347



>gb|EPS61297.1| hypothetical protein M569_13502, partial [Genlisea aurea]
Length=92

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRES  179
            I A++   ILAE IY G +IGA IIV+GLY+V+WGKSK+E N+    +++     DR+S
Sbjct  34   IAAIMGCFILAEKIYLGGVIGAVIIVVGLYAVLWGKSKEEKNDDDDTEKIS---TDRKS  89



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 7/71 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            ITA L  I+LAE ++ GS+IGA  IV GLY+VVWGKSKD         +EK +  ELP+ 
Sbjct  293  ITAALGAIVLAEQVHLGSVIGAICIVFGLYTVVWGKSKDPLASSAPLKDEKTRNLELPVS  352

Query  162  MMDRESVESKD  194
                 S+  + 
Sbjct  353  ADHHNSINDRT  363



>gb|KHG10292.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=388

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA L   +L E ++ GS++GA IIV GLY+VVWGKSKD    E+++K K +QELPI   
Sbjct  298  ITAALGTFVLVEKVHLGSILGAIIIVSGLYTVVWGKSKDGRNLESDKKSKGLQELPIT-N  356

Query  168  DRESVESKDTI  200
            + +S+   D+I
Sbjct  357  NAKSINVNDSI  367



>ref|XP_004290852.1| PREDICTED: WAT1-related protein At4g08300-like [Fragaria vesca 
subsp. vesca]
Length=368

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 8/60 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKM-QELPI  158
            ITAVL  I+LAE ++ GS++GA +IV GLY+VVWGKSKD         +EKG +  ELP+
Sbjct  298  ITAVLGAIVLAEQVHLGSILGAILIVFGLYTVVWGKSKDPLPLDEPLKDEKGSVNHELPV  357



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            +TAVL  I+LAE I  GS+IGA +IVIGLYS++WGKSKD      E++EK    ELP  +
Sbjct  566  VTAVLGSIVLAEEITLGSVIGAAVIVIGLYSLIWGKSKDHLKQHSESSEKKGEFELPTAI  625

Query  165  MD  170
             D
Sbjct  626  AD  627



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM-QELPIVMMDRES  179
            I A+L  IILAE +Y G ++GA +IV+GLYSV+WGKSKDE +    M +ELP+ +  + +
Sbjct  288  IVAILGSIILAEVMYLGRILGAIVIVLGLYSVLWGKSKDEPSSFLDMDKELPLSIRSKAN  347

Query  180  VE  185
             E
Sbjct  348  AE  349



>ref|XP_003601062.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES71313.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=399

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 12/86 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD--ETNEK-------GKMQELP  155
            I A L    L EN+Y GS+IGA II +GLY+VVWGK+KD  E++ K       G+ + +P
Sbjct  296  IVACLGSFFLGENLYLGSMIGAVIIALGLYTVVWGKAKDYSESDTKLPSSTIEGETKSMP  355

Query  156  IVMMDRESVESKDTIKSKLQEKTPQE  233
            I  +D   +   D I   L+ + P +
Sbjct  356  ITAIDDPKI---DIIAVNLENQPPSK  378



>ref|XP_009123503.1| PREDICTED: WAT1-related protein At1g44800-like [Brassica rapa]
Length=382

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM----QELPI  158
            IT+ L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   +     QELPI
Sbjct  294  ITSFLGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDVVNPLDEKIVVGQELPI  349



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--------TNEKGKMQ-ELP  155
            ITA L  ++L+E I  GS+IGA +IV GLY+VVWGKSKD         TNEKG  Q +LP
Sbjct  298  ITAALGSVVLSEQIRLGSIIGAVLIVFGLYTVVWGKSKDSISSSTMELTNEKGGPQDQLP  357

Query  156  I  158
            I
Sbjct  358  I  358



>emb|CDY12554.1| BnaC06g00800D [Brassica napus]
Length=382

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM----QELPI  158
            ITA L  ++LAE I+ GS+IGA  IVIGLYSVVWGKSKD  N   +     Q+LPI
Sbjct  294  ITAFLGALVLAEKIHLGSIIGAIFIVIGLYSVVWGKSKDVVNPLDEKIIVGQDLPI  349



>emb|CDY00403.1| BnaC07g14230D [Brassica napus]
Length=379

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+       +ELP+ +  +E V
Sbjct  293  ITAALGVVVLSESIHLGSVIGTIFIIVGLYTVVWGKGKDKRMTDDDSKELPVKISVKE-V  351

Query  183  ESKDTIKSKLQEKTPQ  230
            ++   +  KL+ KT +
Sbjct  352  DANRVLAGKLEMKTKE  367



>gb|KJB59206.1| hypothetical protein B456_009G244800 [Gossypium raimondii]
Length=385

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNE-KGK---MQELPIVMM  167
            ITA L  +ILAE I+ GS++GA IIV GLY+VVWGKSKD +T E +GK   +QELPI   
Sbjct  298  ITAALGTVILAEKIHLGSILGAIIIVSGLYTVVWGKSKDVKTPELEGKSNGLQELPITDN  357

Query  168  DRE  176
             R 
Sbjct  358  GRS  360



>gb|KJB64440.1| hypothetical protein B456_010G049500 [Gossypium raimondii]
Length=377

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE----TNEKGKMQELPI  158
            ITAVL  +ILAE I+ GS+IG  +I+ GLY+V+WGKSKD     T E GK  +LPI
Sbjct  292  ITAVLGSMILAEKIHLGSIIGTVLIIFGLYTVLWGKSKDRKSSNTEEGGKDIQLPI  347



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 9/76 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD--------ETNEK-GKMQELP  155
            ITA L   ILAE ++ GS++GA +IV+GLYSVVWGKSK+         T+EK G   ELP
Sbjct  298  ITAALGSFILAEKLHLGSILGAAVIVVGLYSVVWGKSKEARSSASQAPTDEKAGGSHELP  357

Query  156  IVMMDRESVESKDTIK  203
            +    + S+   + ++
Sbjct  358  VASSTKPSIVHNNNME  373



>ref|XP_006397314.1| hypothetical protein EUTSA_v10028745mg [Eutrema salsugineum]
 gb|ESQ38767.1| hypothetical protein EUTSA_v10028745mg [Eutrema salsugineum]
Length=368

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE I+ GS+IGA +IV GLYSVVWGK+++E     +K  +QELPI  + +
Sbjct  295  ITAFLGALVLAEKIHLGSIIGAVLIVFGLYSVVWGKAEEEVLSVEKKIGLQELPITNISK  354



>ref|XP_010682440.1| PREDICTED: WAT1-related protein At4g08300-like [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ-ELPI  158
            ITA L  +IL E ++ GS+IGA +IVIGLY+VVWGKSKD     GK   ELPI
Sbjct  299  ITAALGSLILHELLHLGSIIGALVIVIGLYTVVWGKSKDLPISNGKAHPELPI  351



>ref|XP_009340891.1| PREDICTED: WAT1-related protein At4g08290-like [Pyrus x bretschneideri]
Length=394

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 23/95 (24%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD---------ETNEKGKMQELP  155
            I ++L  IILAE ++ GS+IG  +I  GLYSVVWGKSKD          T  K + QELP
Sbjct  303  IVSILGSIILAEKLHLGSIIGGMVIAFGLYSVVWGKSKDYGTNPAVQSNTTVKDEAQELP  362

Query  156  I----------VMMDRESVESKDTIKSKLQEKTPQ  230
            I          +++D+ S++      S++Q KT Q
Sbjct  363  ITNANAISGGKLVIDKNSIDQ----PSQMQLKTVQ  393



>gb|ACU18438.1| unknown [Glycine max]
Length=118

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVM  164
            I AV++  ILAE ++ G +IGA II +GLY+VVWGKSKD +      QE PI++
Sbjct  28   IVAVMSYFILAEQVFLGRVIGAVIICLGLYAVVWGKSKDCSPRSPNTQE-PILL  80



>emb|CDY01310.1| BnaA07g10830D [Brassica napus]
Length=388

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+       +ELP+ +  +E V
Sbjct  302  ITAALGVVVLSESIHLGSVIGTIFIIVGLYTVVWGKGKDKRMTDDDSKELPVKISVKE-V  360

Query  183  ESKDTIKSKLQEKTPQ  230
            ++   +  +L+ KT +
Sbjct  361  DANRVLAGRLEMKTKE  376



>ref|XP_009103277.1| PREDICTED: WAT1-related protein At1g21890 [Brassica rapa]
Length=389

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+       +ELP+ +  +E V
Sbjct  303  ITAALGVVVLSESIHLGSVIGTIFIIVGLYTVVWGKGKDKRMTDDDSKELPVKISVKE-V  361

Query  183  ESKDTIKSKLQEKTPQ  230
            ++   +  +L+ KT +
Sbjct  362  DANRVLAGRLEMKTKE  377



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 12/60 (20%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--------TNEKGKMQELPI  158
            ITA L  IILAE +  GS+IGA +IVIGLY+VVWGK+KD+        TNEK    ELPI
Sbjct  300  ITAALGTIILAEQLRLGSIIGAILIVIGLYTVVWGKTKDKRISATPALTNEK----ELPI  355



>ref|XP_009340894.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=363

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 7/71 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            ITA L  I+LAE ++ GS+IGA  IV GLY+VVWGKSKD         +EK +  ELP+ 
Sbjct  293  ITAGLGAIVLAEQVHLGSIIGAICIVFGLYTVVWGKSKDPLASSAPLKDEKTRNLELPVS  352

Query  162  MMDRESVESKD  194
            +    S   + 
Sbjct  353  VDHHNSTNERT  363



>gb|EAY76186.1| hypothetical protein OsI_04119 [Oryza sativa Indica Group]
Length=151

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A +   ILAE IY G ++GA +IV+GLYSV+WGK K+   +   M ELP+
Sbjct  56   IVAGMGSFILAEKIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPV  107



>ref|XP_007223359.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
 gb|EMJ24558.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
Length=367

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPI  158
            ITA L  I+LAE ++ GS+IGA  IV GLY+VVWGKSKD         +EK    ELP+
Sbjct  298  ITAALGAIVLAEKVHLGSIIGAIFIVFGLYTVVWGKSKDPLASSAPLKDEKSNNLELPV  356



>ref|XP_010916579.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=376

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I AVL  I+L E I  G +IGA IIVIGLYS++WGKSKD      ET EK    +LPI  
Sbjct  291  IVAVLGSIVLGEEITVGRVIGASIIVIGLYSLIWGKSKDHLTQPSETGEKEGALKLPIAA  350

Query  165  MDRESVESKD  194
             D     S D
Sbjct  351  TDAIKSNSAD  360



>ref|XP_010091381.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB44371.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=368

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKG-----KMQELPI  158
            IT  L  I+LAE ++ GS++GA  IV GLY+VVWGKSKD           K QELPI
Sbjct  281  ITFALGAIVLAEQVHLGSIVGAIFIVFGLYTVVWGKSKDPIASTAPLKDDKTQELPI  337



>ref|XP_010554433.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=355

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM-QELPIVMMDR-E  176
            I A+L   +LAE ++ G ++GA +IV+GLYSV+WGKSKDE      M  ELP+  + + E
Sbjct  276  IVAILGSFLLAEVMFLGRILGAVVIVLGLYSVLWGKSKDEPASFSDMDNELPLSHVQQVE  335

Query  177  SVESKDT  197
             V SK T
Sbjct  336  GVSSKAT  342



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDR  173
            I A++   ILAE ++ G +IGA II +GLYSVVWGKSKD +      +E PIV MD 
Sbjct  292  IVAIMGFFILAEQVFLGRMIGAIIICLGLYSVVWGKSKDYSPSDPNTEE-PIVDMDN  347



>ref|XP_006471332.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
 gb|KDO44353.1| hypothetical protein CISIN_1g015299mg [Citrus sinensis]
Length=409

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELP  155
            I A++   ILAENIY GS++GA +IV+GLYSV+WGK K++  E G + E+P
Sbjct  300  IVAIMGSFILAENIYLGSVLGAILIVVGLYSVLWGKHKEKMEEFG-VDEIP  349



>ref|XP_006432378.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
 gb|ESR45618.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
Length=409

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELP  155
            I A++   ILAENIY GS++GA +IV+GLYSV+WGK K++  E G + E+P
Sbjct  300  IVAIMGSFILAENIYLGSVLGAILIVVGLYSVLWGKHKEKMEEFG-VDEIP  349



>gb|AFK39842.1| unknown [Medicago truncatula]
Length=363

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            IT  L   + AE ++ GS+IGA II +GLYSVVWGK+KD  ++   +   P+ M   E
Sbjct  296  ITCALGSFLFAEQLHLGSIIGALIIAVGLYSVVWGKAKDYLSDTTTLPPSPVAMKQTE  353



>gb|AGZ85011.1| hypothetical protein 6 [Cicer arietinum]
Length=393

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 7/74 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQE----LPIV  161
            ITA L  ++LAE ++ GS+ GA +IVIGLY+VVWGKSKD    T + GK+ E    LPI 
Sbjct  300  ITAALGSLVLAELVHLGSVFGAILIVIGLYTVVWGKSKDRRDNTIDTGKLSEGQDQLPIK  359

Query  162  MMDRESVESKDTIK  203
               +   E+ D I+
Sbjct  360  DATKSDSENFDGIE  373



>gb|AES71306.2| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=291

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQ---ELPI  158
            ITA L  ++LAE ++ GS+ GA IIVIGLY+VVWGKSKD     +E GK +   +LPI
Sbjct  199  ITAALGSLVLAEQVHLGSIFGAIIIVIGLYTVVWGKSKDRRESADEIGKGESKDQLPI  256



>ref|XP_003601058.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES71309.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=363

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            IT  L   + AE ++ GS+IGA II +GLYSVVWGK+KD  ++   +   P+ M   E
Sbjct  296  ITCALGSFLFAEQLHLGSIIGALIIAVGLYSVVWGKAKDYLSDTTTLPPSPVAMKQTE  353



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM-QELPIVMMDRES  179
            I A+L  IIL+E +Y G ++GA +IVIGLYSV+WGKSKDE +    + +ELP+      +
Sbjct  288  IVAILGSIILSEVMYLGRILGAIVIVIGLYSVLWGKSKDEPSNSFDLDKELPLSNPQILT  347

Query  180  VESKDTIK  203
              SK  ++
Sbjct  348  FSSKANVE  355



>ref|XP_011085946.1| PREDICTED: WAT1-related protein At5g07050 [Sesamum indicum]
Length=397

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK--MQELPIVMMD  170
            I A++   ILAE IY G +IG+ IIV+GLYSV+WGK ++E  EK K  +QE+P  + D
Sbjct  302  IVAIMGSFILAEKIYLGGVIGSVIIVVGLYSVLWGKYREEKEEKIKRQLQEIPEAIKD  359



>ref|XP_009388785.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            ITA++  IILAE I  G ++GA IIVIGLYS++WGKSKD   E  + +E
Sbjct  290  ITAIMGSIILAEEITLGRVLGAVIIVIGLYSLIWGKSKDHLTEPSQPRE  338



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK--MQELP  155
            I AV+  IILAE IY GS++GA +IV+GLY+V+WGK KD     GK  +Q LP
Sbjct  300  IVAVMGSIILAETIYLGSVLGAILIVVGLYAVLWGKVKDHKIPSGKNSLQVLP  352



>gb|KHG23400.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=385

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA L   +L E ++ GS++GA IIV GLY+VVWGKSKD    E  EK   +QELPI   
Sbjct  298  ITAALGAFVLNEKVHLGSILGAIIIVAGLYTVVWGKSKDVKTPELEEKSNGLQELPITDN  357

Query  168  DRE  176
             R 
Sbjct  358  GRS  360



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 7/66 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A+L  IILAE ++ G ++GA +IV+GLYSV+WGKSKDE +        P   MDRE  
Sbjct  288  IVAILGSIILAEVMFLGRILGAIVIVLGLYSVLWGKSKDEPSS-------PFPDMDRELP  340

Query  183  ESKDTI  200
             S   I
Sbjct  341  LSSPQI  346



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 37/61 (61%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---------TNEKGKMQELP  155
            ITA L  I+LAE I+ GS+IGA  IV GLY VVWGKSKD           +EK    ELP
Sbjct  298  ITAALGAIVLAETIHLGSIIGAIFIVCGLYIVVWGKSKDRQAESTTALMPDEKVPTSELP  357

Query  156  I  158
            I
Sbjct  358  I  358



>ref|XP_002309380.1| hypothetical protein POPTR_0006s19160g [Populus trichocarpa]
 gb|EEE92903.1| hypothetical protein POPTR_0006s19160g [Populus trichocarpa]
Length=348

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I  + + ++L E  YAGSLIGA  ++IGLY+V+WGK+KD      E +++ +  + P+ +
Sbjct  262  IVGIFSAVVLHEETYAGSLIGALAVIIGLYAVLWGKAKDLEEIKNEMHQQQQNDQSPVQL  321

Query  165  MDRESVESKDT  197
            +  ES E K+ 
Sbjct  322  LIDESPEKKNC  332



>ref|XP_004500562.1| PREDICTED: WAT1-related protein At4g08300-like isoform X1 [Cicer 
arietinum]
Length=317

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 9/71 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            ITA L  ++LAE ++ GS+ GA +IVIGLY+VVWGKSKD    T + GK+ E       +
Sbjct  224  ITAALGSLVLAELVHLGSVFGAILIVIGLYTVVWGKSKDRRDNTIDTGKLSE------GQ  277

Query  174  ESVESKDTIKS  206
            + +  KD  KS
Sbjct  278  DQLPIKDATKS  288



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A++A IILAENI+ GS++G  +IVIGLY+V+WGK KD             ++ D+ S 
Sbjct  290  IVAIMASIILAENIFLGSVLGGVLIVIGLYAVLWGKVKDSK-----------ILTDKNST  338

Query  183  ESKDTIKSKLQEKTPQEA*NIEFTIKKKLC  272
            E     +  L E    +A +IE   K  +C
Sbjct  339  EVLSNSQVMLPENQ-NKADDIEAASKNLMC  367



>ref|XP_003601053.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES71304.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=394

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQ---ELPI  158
            ITA L  ++LAE ++ GS+ GA IIVIGLY+VVWGKSKD     +E GK +   +LPI
Sbjct  302  ITAALGSLVLAEQVHLGSIFGAIIIVIGLYTVVWGKSKDRRESADEIGKGESKDQLPI  359



>gb|KJB59208.1| hypothetical protein B456_009G244900 [Gossypium raimondii]
Length=385

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMM  167
            ITA L   +L E ++ GS++GA IIV GLY+VVWGKSKD    E  EK   +QELPI   
Sbjct  298  ITAALGAFVLNEKVHLGSILGAIIIVSGLYTVVWGKSKDVKTPELEEKSNGLQELPITDN  357

Query  168  DRE  176
             R 
Sbjct  358  GRS  360



>ref|XP_010544709.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544717.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN------EKGK-MQELPI  158
            + AVLA  IL E I+ GS+IG  +I +GLYSVVWGK KD T       EK K +QELPI
Sbjct  294  LVAVLASFILHEQIHLGSVIGGVVIAVGLYSVVWGKGKDYTEAGLVIPEKNKNLQELPI  352



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE-LPIVMMDRES  179
            + AV+   IL+E IY G ++G+ +IVIGLYSV+WGK K+   E   ++E LP+ M    S
Sbjct  298  VVAVMGSFILSEKIYLGGILGSVLIVIGLYSVLWGKHKETQAESAALREALPMAMASSNS  357

Query  180  VESKDTIKSKLQE  218
                D ++    E
Sbjct  358  KGEGDAVQGHDPE  370



>ref|XP_006644860.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=394

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A +   ILAE IY G ++GA +IVIGLYSV+WGK K+   ++  M ELP+
Sbjct  299  IVAGMGSFILAEKIYLGGVLGAVLIVIGLYSVLWGKHKETQEQEAAMMELPV  350



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            I A+L  IIL+E +Y G ++GA +IV+GLYSV+WGKSKDE       T+++  +  + +V
Sbjct  288  IVAILGSIILSEVMYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPLSNIQVV  347

Query  162  MMDRESVESKDTIKSKL  212
                ++   KDT+ + +
Sbjct  348  SFSSKANADKDTMDANV  364



>gb|KJB29232.1| hypothetical protein B456_005G090300 [Gossypium raimondii]
Length=379

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = +3

Query  15   LAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD----ETNEKGK-MQELPIVMMDRES  179
            L  IILAE I+ GS++GA IIV GLY+VVWGKSKD    ET+ K   +QELPI    +  
Sbjct  293  LWAIILAEKIHLGSILGAIIIVTGLYTVVWGKSKDGENSETDVKCNGLQELPITGNAKSI  352

Query  180  VESKDTIK  203
             +  D I 
Sbjct  353  TDDDDDIN  360



>ref|XP_010910818.1| PREDICTED: WAT1-related protein At4g08290-like [Elaeis guineensis]
Length=327

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I A++  IILAE I  G ++GA IIVIGLYS++WGKSKD      + +EK    ELPI  
Sbjct  245  IVAIMGSIILAEEITLGRVVGATIIVIGLYSLMWGKSKDHLTQSSDDDEKKGAFELPISA  304

Query  165  MDRESVESKD  194
             D     S D
Sbjct  305  TDAMKSNSAD  314



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM-QELPIVMMDR-E  176
            I A+L   +LAE ++ G+++GA +IV+GLYSV+WGKSKD+      +  ELP+  + + E
Sbjct  295  IVAILGSFVLAEVMFLGTILGAIVIVLGLYSVLWGKSKDDNASFSDIDNELPLSHIHQVE  354

Query  177  SVESKDTIKSKLQEKTPQEA  236
            SV SK     + Q +   E+
Sbjct  355  SVSSKANRGVEPQARPNNES  374



>ref|XP_002324505.1| hypothetical protein POPTR_0018s10840g [Populus trichocarpa]
 gb|EEF03070.1| hypothetical protein POPTR_0018s10840g [Populus trichocarpa]
Length=371

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 7/73 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I  +LA I L E IY GSLIGA  ++IGLY V+WGK+KD T E+ K+         +  +
Sbjct  278  IVTILAAIFLHEEIYTGSLIGAVAVIIGLYIVLWGKAKDFTKEEDKVD-------PKLEI  330

Query  183  ESKDTIKSKLQEK  221
            + + T+K  ++E 
Sbjct  331  DERQTVKITIEES  343



>ref|NP_001044551.1| Os01g0803300 [Oryza sativa Japonica Group]
 dbj|BAF06465.1| Os01g0803300, partial [Oryza sativa Japonica Group]
Length=331

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A +   ILAE IY G ++GA +IV+GLYSV+WGK K+   +   M ELP+
Sbjct  236  IVAGMGSFILAEKIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPV  287



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 10/64 (16%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE----------KGKMQEL  152
            ITA++  IIL E I  GS+IGA IIV+GLY+++WGKSKDE N+            K  EL
Sbjct  292  ITAIMGSIILKEEITRGSVIGAAIIVLGLYALIWGKSKDEVNQVADVSASGGCGSKGGEL  351

Query  153  PIVM  164
            PI +
Sbjct  352  PITL  355



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-TNEKGKMQ-ELP  155
            I A+L  IILAE +Y G ++GA +IV+GLYSV+WGKSKDE +N    M  ELP
Sbjct  289  IVAILGSIILAEVMYLGRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIELP  341



>ref|XP_010554592.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=378

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKM-QELPIVMMDR-E  176
            I A+L   +LAE  + G+++GA +IV+GLYSV+WGKSKDE      M  ELP+  + + E
Sbjct  295  IVAILGSFVLAEVFFLGTVLGAIVIVLGLYSVLWGKSKDEPAPFSDMDNELPLGRIQQVE  354

Query  177  SVESKDTIKSK  209
            SV S+   + K
Sbjct  355  SVSSEARPQVK  365



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-TNEKGKMQ-ELP  155
            I A+L  IILAE +Y G ++GA +IV+GLYSV+WGKSKDE +N    M  ELP
Sbjct  288  IVAILGSIILAEVMYLGRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIELP  340



>dbj|BAB92246.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ13862.1| hypothetical protein OsJ_03785 [Oryza sativa Japonica Group]
Length=398

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A +   ILAE IY G ++GA +IV+GLYSV+WGK K+   +   M ELP+
Sbjct  303  IVAGMGSFILAEKIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPV  354



>gb|EEC71658.1| hypothetical protein OsI_04113 [Oryza sativa Indica Group]
Length=398

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A +   ILAE IY G ++GA +IV+GLYSV+WGK K+   +   M ELP+
Sbjct  303  IVAGMGSFILAEKIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPV  354



>gb|AFK33380.1| unknown [Medicago truncatula]
Length=286

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A++   ILAE IY+G ++GA +IVIGLYSV+WGK K+E   K     LPI
Sbjct  189  IVAIMGSFILAEQIYSGGVMGAILIVIGLYSVLWGKHKEEIERKVDDIPLPI  240



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            I A L  I+LAE ++ GS+IGA  IV GLY+VVWGKSKD         +E  +  ELP+ 
Sbjct  293  IPAALGAIVLAEQVHLGSIIGAICIVFGLYTVVWGKSKDPLASSAPLKDENTRNLELPVS  352

Query  162  MMDRESVESKD  194
                 S+  + 
Sbjct  353  ADHHNSINDRT  363



>ref|XP_002528210.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF34167.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=380

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKG---KMQE----LPI  158
            ITA++A I L E  Y GSLIGA  ++IGLY V+WGK+KD E   KG   K+Q     +  
Sbjct  285  ITAIIAAIFLHEETYLGSLIGALAVIIGLYVVLWGKAKDLEEVNKGTHLKLQNDGSGIVQ  344

Query  159  VMMDRESVESKDTIKSKLQEK  221
            V++D ES E K+  ++ L+E 
Sbjct  345  VIVDDESFEKKNC-RADLEEP  364



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-TNEKGKMQ-ELP-----IV  161
            I A+L  IILAE +Y G ++GA +IV+GLYSV+WGKSKDE +N    M  E P     +V
Sbjct  289  IVAILGSIILAEVMYLGRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIEFPRSTPQVV  348

Query  162  MMDRESVESKDTIKSKL  212
                +S    DT+ + +
Sbjct  349  TFSLKSNTETDTMDASV  365



>ref|XP_003537193.1| PREDICTED: WAT1-related protein At2g37460-like isoform 1 [Glycine 
max]
Length=379

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVM  164
            I AV++  ILAE ++ G +IGA II +GLY+VVWGKSKD +      QE PI++
Sbjct  289  IVAVMSYFILAEQVFLGRVIGAVIICLGLYAVVWGKSKDCSPRSPNTQE-PILL  341



>gb|KHN05928.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVM  164
            I AV++  ILAE ++ G +IGA II +GLY+VVWGKSKD +      QE PI++
Sbjct  289  IVAVMSYFILAEQVFLGRVIGAVIICLGLYAVVWGKSKDCSPRSPNTQE-PILL  341



>ref|XP_009346345.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=388

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  36   ENIYAGSLIGAFIIVIGLYSVVWGKSKDETN-------EKGKMQELPIVMMDRESVESKD  194
            E +  GS++G  +IVIGLY+VVWGKSKD T        EK    ELPI   +R S+   D
Sbjct  307  EQVRLGSILGTILIVIGLYAVVWGKSKDPTTSALLIKGEKAVAHELPITDSNRSSITVDD  366

Query  195  TIK  203
             IK
Sbjct  367  NIK  369



>gb|KEH32583.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=262

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            ITA+++ I L E +Y GSL+GAF ++ GLY V+WGK+KD    K   QELP   M  + +
Sbjct  181  ITALVSAIFLQEELYIGSLVGAFGVISGLYIVLWGKAKDFDETK---QELPQSQMQDDDI  237

Query  183  ESKDTIKSKL  212
             ++  ++  L
Sbjct  238  SNRVDLEEPL  247



>ref|XP_010926422.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=374

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 46/83 (55%), Gaps = 8/83 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I  ++  IILAE I  G ++GA IIVIGLYS++WGKSKD      + +EK    ELPI  
Sbjct  292  IVTIMGSIILAEEITLGRVVGATIIVIGLYSLIWGKSKDHLTQSSDDDEKKGAFELPISA  351

Query  165  MDRESVESKD--TIKSKLQEKTP  227
             D     S D  T+      K+P
Sbjct  352  TDAMKSNSADHGTVAEIPSAKSP  374



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A+L  ++L E++Y GSLIGA +IV+GLY V+WGK+KDE          P  +   +S 
Sbjct  294  IIAILGSLVLDEHMYLGSLIGAIVIVVGLYLVLWGKTKDEP---------PSQLSKTQSQ  344

Query  183  ESKDTIKSKLQEKTPQEA*NIE  248
             + + I +  Q+  P+   +IE
Sbjct  345  PNDEPITTSQQQMMPEGGLDIE  366



>ref|XP_006651043.1| PREDICTED: WAT1-related protein At2g39510-like [Oryza brachyantha]
Length=439

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A+LA  I  EN+Y GS+IG  ++++GLY ++WGK KD+     K QE  +    +  +
Sbjct  363  MVAILAYFIFGENLYVGSIIGGVVVILGLYMLLWGKDKDQGYNADKEQESDLDCEKQAKI  422

Query  183  ESKDTIKSKLQE  218
                 ++S L+E
Sbjct  423  TDFSAVQSDLEE  434



>ref|XP_003628011.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AET02487.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=395

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A++   ILAE IY+G ++GA +IVIGLYSV+WGK K+E   K     LPI
Sbjct  298  IVAIMGSFILAEQIYSGGVMGAILIVIGLYSVLWGKHKEEIERKVDDIPLPI  349



>ref|XP_002534331.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28049.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I AV++ IILAE ++ G +IGA IIV GLY V+WGKSKD  +        P   +D + +
Sbjct  139  IVAVMSSIILAEQMFLGRVIGAAIIVGGLYLVIWGKSKDHKS--------PPPTVDDQII  190

Query  183  ESKDTIKSKLQEK--TPQEA  236
             +K T   +  EK  + QEA
Sbjct  191  PTKQTTNERSHEKENSDQEA  210



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE--KGKMQELPIVMMDRE  176
            I A+L  IILAE ++ G ++GA +IV+GLYSV+WGKSKDE +       +ELP+      
Sbjct  288  IVAILGSIILAEVMFLGRILGAIVIVLGLYSVLWGKSKDEPSSSFSDTDKELPLSTPQIV  347

Query  177  SVESKDTIK  203
            ++ SK   K
Sbjct  348  TLPSKANAK  356



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 7/58 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            I A+L  IILAE ++ G ++GA +IV+GLYSV+WGKSKDE +        P   MD+E
Sbjct  288  IVAILGSIILAEVMFLGRILGAIVIVLGLYSVLWGKSKDEPSS-------PFPDMDKE  338



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK--MQELPIVMMDRE  176
            I A+L  IILAE +Y G ++GA +IV+GLYSV+WGKSKD+ +       +ELP+      
Sbjct  289  IVAILGSIILAEVMYLGRILGAVVIVLGLYSVLWGKSKDQPSSSFPDMDKELPLSTPQTV  348

Query  177  SVESK  191
            +  SK
Sbjct  349  TFSSK  353



>ref|XP_010534681.1| PREDICTED: WAT1-related protein At1g21890 isoform X2 [Tarenaya 
hassleriana]
Length=361

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD---ETNEKGKMQELPIVMMDR  173
            ITA L   +L+E+I+ GS+IG   I++GLY+VVWGKSKD   + +E     ELPI    +
Sbjct  270  ITAALGVFVLSESIHLGSVIGTVFIIVGLYTVVWGKSKDRMIQDDEPSNSGELPITSPVK  329

Query  174  ESVES  188
             +V++
Sbjct  330  PAVDA  334



>ref|NP_001041856.1| Os01g0117900 [Oryza sativa Japonica Group]
 dbj|BAB17350.1| putative nodulin-like protein 5NG4 [Oryza sativa Japonica Group]
 dbj|BAB55472.1| putative nodulin-like protein 5NG4 [Oryza sativa Japonica Group]
 dbj|BAF03770.1| Os01g0117900 [Oryza sativa Japonica Group]
 gb|EAZ10323.1| hypothetical protein OsJ_00158 [Oryza sativa Japonica Group]
 dbj|BAG87905.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96818.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96831.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  9    AVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            AV+A IIL + +Y+G +IGA +IVIGLY V+WGKS+++ ++   +Q+ P+
Sbjct  294  AVMAAIILGDQLYSGGIIGAVLIVIGLYFVLWGKSEEKKSKNNNLQDQPV  343



>ref|XP_007137398.1| hypothetical protein PHAVU_009G123700g [Phaseolus vulgaris]
 gb|ESW09392.1| hypothetical protein PHAVU_009G123700g [Phaseolus vulgaris]
Length=362

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKG-------KMQELPI  158
            IT  L   + AE ++ G++IGA IIV+GLYSVVWGK KD +N          + Q+LPI
Sbjct  299  ITCALGSFLFAEQLHLGNIIGAIIIVLGLYSVVWGKGKDHSNPTPSSTAKQIEAQQLPI  357



>ref|XP_004511088.1| PREDICTED: WAT1-related protein At5g07050-like [Cicer arietinum]
Length=403

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A++   ILAE IY G +IGA +IVIGLYSV+WGK K E NEK    ++P+
Sbjct  298  IVAIMGSFILAEQIYLGGVIGAILIVIGLYSVLWGKHK-EQNEKKVEDDIPL  348



>gb|KDO35805.1| hypothetical protein CISIN_1g041924mg [Citrus sinensis]
Length=66

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE  122
            I A+ + I  AE ++ GSLIGAF+IV+GLY V+WGK KD 
Sbjct  9    IVALFSAIAFAERLHLGSLIGAFLIVVGLYCVLWGKKKDR  48



>ref|XP_011012129.1| PREDICTED: WAT1-related protein At4g30420-like isoform X1 [Populus 
euphratica]
 ref|XP_011014490.1| PREDICTED: WAT1-related protein At4g30420-like [Populus euphratica]
Length=371

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ------ELPIVM  164
            I  + + ++L E  YAGSLIGA  ++IGLY+V+WGK+KD    K +M       + P+ +
Sbjct  285  IVGIFSAVVLHEETYAGSLIGALAVIIGLYAVLWGKAKDLEEIKNEMHPQLQNDQSPVQL  344

Query  165  MDRESVESKDT  197
            +  ES E K+ 
Sbjct  345  LIDESPEKKNC  355



>ref|XP_008452363.1| PREDICTED: WAT1-related protein At4g30420 [Cucumis melo]
Length=371

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            +T +LA I+L E I+ GSL+G   ++IGLY V+WGK+KD   E+ K        + + S 
Sbjct  291  VTTILAAIVLHEQIFTGSLLGGVAVIIGLYIVLWGKAKDYVKEEAK--------LGKPSF  342

Query  183  ESKDTIKSKLQEKTPQE  233
            + K+ I   L+ ++  +
Sbjct  343  DQKEEICESLERRSTDQ  359



>gb|EYU26922.1| hypothetical protein MIMGU_mgv1a007458mg [Erythranthe guttata]
Length=406

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE--KGKMQELPIVMMD  170
            I AV+   ILAE IY G +IG+ IIV+GLY+V+WGK K+E  E  K K+ E+P  + D
Sbjct  301  IVAVMGSFILAEKIYLGGVIGSVIIVVGLYAVLWGKYKEEKEESQKRKLLEIPEAIKD  358



>gb|ABA29159.1| nodulin-like protein [Pisum sativum]
Length=204

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIV-MMDRES  179
            ITA++A   L E +Y GSL+GA  + +GLY V+WGK+KD     G  QELP   M+D E 
Sbjct  123  ITALVAATFLEEKLYVGSLVGAIGVTVGLYIVLWGKAKD---FDGTKQELPQSNMVDDER  179

Query  180  VESKDTIKSKLQEKT  224
                D  +  L EK+
Sbjct  180  SNRTDLEEPLLAEKS  194



>ref|XP_008219762.1| PREDICTED: WAT1-related protein At4g08290 [Prunus mume]
Length=385

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE---------KGKMQELP  155
            I ++L  IILAE ++ GS+IG  IIV+GLYSVVWGKSKD             K +  ELP
Sbjct  293  IVSILGSIILAEKLHLGSIIGGVIIVLGLYSVVWGKSKDYCKSSAVPSSPAMKDEAHELP  352

Query  156  I  158
            I
Sbjct  353  I  353



>gb|ABA29160.1| nodulin-like protein [Pisum sativum]
Length=204

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIV-MMDRES  179
            ITA++A   L E +Y GSL+GA  + +GLY V+WGK+KD     G  QELP   M+D E 
Sbjct  123  ITALVAATFLEEKLYVGSLVGAIGVTVGLYIVLWGKAKD---FDGTKQELPQSNMVDDER  179

Query  180  VESKDTIKSKLQEKT  224
                D  +  L EK+
Sbjct  180  SNRTDLEEPLLAEKS  194



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQEL  152
            I A++  IILAE+IY GS++G  +IV+GLY+V+WGK KD     GK   L
Sbjct  300  IVAIMGSIILAESIYLGSVVGGVLIVLGLYAVLWGKVKDHKISSGKQHSL  349



>gb|EMT31802.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=387

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE-LPIVMMDRES  179
            + AV+   IL+E IY G ++G+ +IVIGLYSV+WGK K+   E   ++E LP+ M    S
Sbjct  294  VVAVMGSFILSEKIYLGGVLGSVLIVIGLYSVLWGKHKETQAESAALREALPMAMASYTS  353

Query  180  VESKD  194
              + D
Sbjct  354  KVTGD  358



>ref|XP_010534673.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Tarenaya 
hassleriana]
Length=414

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD---ETNEKGKMQELPIVMMDR  173
            ITA L   +L+E+I+ GS+IG   I++GLY+VVWGKSKD   + +E     ELPI    +
Sbjct  323  ITAALGVFVLSESIHLGSVIGTVFIIVGLYTVVWGKSKDRMIQDDEPSNSGELPITSPVK  382

Query  174  ESVES  188
             +V++
Sbjct  383  PAVDA  387



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            I A++  IIL+E +Y G ++GA +IV+GLYSV+WGKSKDE       T+++  +  + +V
Sbjct  288  IVAIMGSIILSEVMYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQVV  347

Query  162  MMDRESVESKDTIKSKL  212
                ++   KDT+ + +
Sbjct  348  SFSSKANADKDTMDANV  364



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-------TNEKGKMQELPIV  161
            I A++  IIL+E +Y G ++GA +IV+GLYSV+WGKSKDE       T+++  +  + +V
Sbjct  288  IVAIMGSIILSEVMYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQVV  347

Query  162  MMDRESVESKDTIKSKL  212
                ++   KDT+ + +
Sbjct  348  SFSSKANADKDTMDANV  364



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE-LPIVMMDRES  179
            + AV+   IL+E IY G ++G+ +IVIGLYSV+WGK K+   E   ++E LP+ M    S
Sbjct  294  VVAVMGSFILSEKIYLGGVLGSVLIVIGLYSVLWGKHKETQAESAALREALPMAMASCSS  353

Query  180  VESKD  194
              + D
Sbjct  354  KVTGD  358



>ref|XP_007223097.1| hypothetical protein PRUPE_ppa007061mg [Prunus persica]
 gb|EMJ24296.1| hypothetical protein PRUPE_ppa007061mg [Prunus persica]
Length=384

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE---------KGKMQELP  155
            I ++L  IILAE ++ GS+IG  IIV GLYSVVWGKSKD             K +  ELP
Sbjct  293  IVSILGSIILAEKLHLGSIIGGVIIVFGLYSVVWGKSKDYCKSSAVPSSPAMKDEAHELP  352

Query  156  I  158
            I
Sbjct  353  I  353



>ref|XP_008388240.1| PREDICTED: WAT1-related protein At1g21890 [Malus domestica]
Length=388

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 11/84 (13%)
 Frame = +3

Query  36   ENIYAGSLIGAFIIVIGLYSVVWGKSKDET-------NEKGKMQELPIVMMDRESVESKD  194
            E +  GS++G  +IVIGLY+VVWGKSKD T       +EK    ELPI    R S+    
Sbjct  307  EQVRLGSILGTILIVIGLYAVVWGKSKDPTTSALLIKDEKAVAHELPITDSKRSSI----  362

Query  195  TIKSKLQEKTPQEA*NIEFTIKKK  266
            T+ +  ++ T   A + +F IK +
Sbjct  363  TVDNNTKDSTTGTAGDFKFPIKAQ  386



>gb|KEH32584.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=369

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            ITA+++ I L E +Y GSL+GAF ++ GLY V+WGK+KD    K   QELP   M  + +
Sbjct  288  ITALVSAIFLQEELYIGSLVGAFGVISGLYIVLWGKAKDFDETK---QELPQSQMQDDDI  344

Query  183  ESKDTIKSKL  212
             ++  ++  L
Sbjct  345  SNRVDLEEPL  354



>ref|XP_002323220.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
 gb|EEF04981.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
Length=402

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 4/65 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A++   ILAENIY G ++GA +IV GLY+V+WGK K++  ++ ++   PI    +E+ 
Sbjct  295  IVAIMGSFILAENIYVGGVLGAILIVAGLYAVLWGKHKEQKEKEAEIIPEPI----KENG  350

Query  183  ESKDT  197
            E+ DT
Sbjct  351  ENGDT  355



>ref|XP_004962102.1| PREDICTED: WAT1-related protein At5g07050-like [Setaria italica]
Length=401

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A++   ILAENIY G ++G+ +IV GLYSV+WGK K+   ++ +  E+P+
Sbjct  300  IVAIMGSFILAENIYLGGILGSVLIVAGLYSVLWGKHKENLEKEAEAMEIPV  351



>gb|KCW70586.1| hypothetical protein EUGRSUZ_F03775 [Eucalyptus grandis]
Length=228

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---------TNEKGKMQELP  155
            ITA L+ I+LAE ++ GS+IGA  IV GLY V+WGKSK+           +EK    ELP
Sbjct  145  ITAALSAIVLAEKLHLGSIIGAIFIVCGLYIVLWGKSKERQAESTAALMPDEKVPTSELP  204

Query  156  I  158
            I
Sbjct  205  I  205



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN---EKGKMQEL  152
            ITAV++  ILAE +Y G +IGA +IVIGLY V+WGKSKD+     EK   +EL
Sbjct  289  ITAVMSSFILAEIMYLGRVIGAMVIVIGLYMVLWGKSKDQLPSELEKDDKREL  341



>ref|XP_010919069.1| PREDICTED: WAT1-related protein At5g64700-like [Elaeis guineensis]
Length=365

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 11/77 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I  + +    AE ++ GSL+GAFII++GLY V+WGKS++ +NE G          D+E  
Sbjct  292  IVGIFSAFFFAERLHTGSLVGAFIIIVGLYCVLWGKSRN-SNENG----------DKEHE  340

Query  183  ESKDTIKSKLQEKTPQE  233
              K + KS L   + ++
Sbjct  341  TGKTSPKSILHMSSNED  357



>ref|NP_001239827.1| uncharacterized protein LOC100804390 [Glycine max]
 gb|ACU18044.1| unknown [Glycine max]
 gb|KHN37729.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            I A++   ILAE IY G +IGA +IVIGLYSV+WGK K++   K    E+P+ + D +
Sbjct  300  IVAIMGSFILAEQIYLGGVIGAILIVIGLYSVLWGKHKEQIESK-VADEIPLPVKDSQ  356



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE  131
            ITAV+  IIL E I  GS+IGA IIV+GLY ++WGKSKD+ N+
Sbjct  291  ITAVMGSIILKEEITLGSVIGAVIIVVGLYFLIWGKSKDKVNQ  333



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE-TNEKGKMQELPIVMMDRES  179
            I A+L   ILAE +Y GS+IGA +IV+GLY VVWGKSKD   +     Q++  V +   S
Sbjct  300  IVAILGSFILAEEMYLGSVIGATVIVVGLYLVVWGKSKDHIPSSPSTNQQIAPVELKASS  359

Query  180  VES  188
            +++
Sbjct  360  IDT  362



>gb|EMS52511.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=195

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ-----ELPIVMM  167
            +TAV+  IIL E I  GS+IGA IIV GLY ++WGKSKDE N+   +      ELP+  +
Sbjct  104  VTAVMGSIILKEEINLGSVIGAAIIVGGLYFLIWGKSKDEINKVSDVSVKGAGELPLTSV  163

Query  168  DRESVESKD  194
              +    K 
Sbjct  164  TNDHGHGKQ  172



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 8/73 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A+++  ILAE IY G +IGA +I++GLY VVWGKSKD         + P  ++  E +
Sbjct  294  IVAIMSPFILAEKIYLGRVIGAVVIILGLYLVVWGKSKD--------YDRPSPIIKDEIL  345

Query  183  ESKDTIKSKLQEK  221
             +K TI++  +EK
Sbjct  346  PAKQTIENNDKEK  358



>gb|KHG05804.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=349

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A+L   +L E +Y GS++G  I++IGLY V+WGK +D+  + G   ELP +  D ++ 
Sbjct  273  LVALLGYFVLGERLYMGSILGGAIVIIGLYLVLWGKDRDQEAQIGT-AELPYLAYDHKND  331

Query  183  ESKDTIKSKLQEKTPQE  233
                 I S  +E  P E
Sbjct  332  TKAHKILSVEREAPPSE  348



>ref|XP_007133643.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
 gb|ESW05637.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
Length=391

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 12/91 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRES-  179
            I+A++   ILAE IY G +IGA +IVIGLYSV+WGK K++   K    E+P  + D ES 
Sbjct  292  ISAIMGYFILAEKIYLGGVIGAILIVIGLYSVLWGKHKEQIESKVA-DEIP--LPDAESS  348

Query  180  -----VESKDTI-KSKLQEKTPQEA*NIEFT  254
                  +++D   + K  EK  +E  NI+F+
Sbjct  349  VIEELFDARDNFSEEKCVEK--EEPINIKFS  377



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 8/73 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A+++  ILAE IY G +IGA +I++GLY VVWGKSKD         + P  ++  E +
Sbjct  294  IVAIMSPFILAEKIYLGRVIGAVVIILGLYLVVWGKSKD--------YDRPSPIIKDEIL  345

Query  183  ESKDTIKSKLQEK  221
             +K TI++  +EK
Sbjct  346  PAKQTIENNDKEK  358



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE  122
            ITAV++  ILAE +Y G +IGA +IVIGLY V+WGKSKD+
Sbjct  289  ITAVMSSFILAEIMYLGRVIGAMVIVIGLYMVLWGKSKDQ  328



>ref|XP_006846484.1| hypothetical protein AMTR_s00018p00136220 [Amborella trichopoda]
 gb|ERN08159.1| hypothetical protein AMTR_s00018p00136220 [Amborella trichopoda]
Length=200

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 13/76 (17%)
 Frame = +3

Query  6    TAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESVE  185
             A+L+ I+  E ++ GSLIGA +IVIG Y V+WGK KDE                R S+E
Sbjct  134  AALLSAILFLERLHLGSLIGACVIVIGFYCVLWGKKKDEYQH-------------RSSLE  180

Query  186  SKDTIKSKLQEKTPQE  233
            + +     ++E  P+E
Sbjct  181  NPNHNLQAIEEPPPKE  196



>gb|EMS57240.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=343

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 8/77 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQ----ELPIVMMD  170
            ITAV+  IIL E I  GS+IGA IIV GLY ++WGKSKDE ++ G       ELP+  + 
Sbjct  259  ITAVMGSIILKEEINLGSVIGAAIIVGGLYFLIWGKSKDEISKAGGSSKGAGELPLTSL-  317

Query  171  RESVESKDTIKSKLQEK  221
               + S D I S   E+
Sbjct  318  ---LASYDPIMSCESER  331



>gb|EPS73987.1| hypothetical protein M569_00767, partial [Genlisea aurea]
Length=319

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD  119
            ITAVL  I+LAE +  GSLIGA IIV GLYSVVWGKSK+
Sbjct  279  ITAVLGAIVLAEKVRLGSLIGAAIIVSGLYSVVWGKSKE  317



>ref|XP_004955229.1| PREDICTED: WAT1-related protein At1g21890-like [Setaria italica]
Length=395

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE-----KGKMQ---ELPI  158
            +T+V+  IIL E I  GS+IGA IIV+GLY+++WGKSKD  N+     KG      ELPI
Sbjct  304  VTSVMGSIILKEEITLGSVIGAVIIVLGLYALIWGKSKDHENQVADVSKGAAAAGGELPI  363

Query  159  VM  164
             +
Sbjct  364  TL  365



>ref|XP_003545806.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN11194.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRE  176
            I A++   ILAE IY G +IGA +IVIGLYSV+WGK K++   K    E+P+ + D +
Sbjct  300  IVAIMGSFILAEQIYLGGVIGAILIVIGLYSVLWGKHKEQIESKVA-DEIPLPVKDAQ  356



>ref|XP_008362204.1| PREDICTED: WAT1-related protein At4g30420-like [Malus domestica]
Length=156

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-----GKMQELPIVMM  167
            IT ++A + L E +Y GSL+G   +VIGLY V+WGK+KD+   K      + + +  +++
Sbjct  70   ITTIVAAVFLHEELYLGSLVGGVAVVIGLYIVLWGKAKDQQKTKQETDPNQSRTVDQILI  129

Query  168  DRESVESKDTIKSKLQE  218
            D +S E K + K  L+E
Sbjct  130  DDDSTE-KTSCKIDLEE  145



>gb|AFW81938.1| hypothetical protein ZEAMMB73_476289 [Zea mays]
Length=476

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK-MQELPIVM  164
            I A++   ILAENIY G +IG+ +IV GLYSV+WGK K+   ++G+   E+P+ +
Sbjct  368  IVAIMGSFILAENIYLGGIIGSVLIVAGLYSVLWGKHKENEEKEGEAAMEIPVAI  422



>ref|XP_002306625.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
 gb|EEE93621.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
Length=363

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 9/64 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE--------KGKMQELPI  158
            I A L  +ILAE ++ GS++G  II IGLYSVVWGK KD T+         KG  QELPI
Sbjct  297  IVAALGSLILAEKLHLGSVLGGIIIAIGLYSVVWGKRKDYTSPEELSTTAAKGN-QELPI  355

Query  159  VMMD  170
               +
Sbjct  356  ATTN  359



>gb|KJB28448.1| hypothetical protein B456_005G049000 [Gossypium raimondii]
 gb|KJB28449.1| hypothetical protein B456_005G049000 [Gossypium raimondii]
 gb|KJB28450.1| hypothetical protein B456_005G049000 [Gossypium raimondii]
Length=370

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A+L   +L E +Y GS++G  I++IGLY V+WGK +D+  + G   ELP +  D ++ 
Sbjct  294  LVALLGYFVLGERLYMGSILGGAIVIIGLYLVLWGKDRDQEAQIGT-AELPYLAYDHKND  352

Query  183  ESKDTIKSKLQEKTPQE  233
                 I S  +E  P E
Sbjct  353  TKAHKILSVEREAPPSE  369



>ref|NP_001150619.1| nodulin-like protein [Zea mays]
 gb|ACG39776.1| nodulin-like protein [Zea mays]
Length=413

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKGKMQELPIV  161
            I AV+   ILAE I+ G ++GA +IVIGLYSV+WGK K+ +  E  +  ELP+V
Sbjct  301  IVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWGKHKETQDKEDDETTELPVV  354



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE  122
            ITAV++  ILAE +Y G +IGA +IVIGLY V+WGKSKD+
Sbjct  281  ITAVMSSFILAEIMYLGRVIGAMVIVIGLYMVLWGKSKDQ  320



>gb|ACL54205.1| unknown [Zea mays]
 tpg|DAA57217.1| TPA: nodulin-like protein [Zea mays]
Length=413

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD-ETNEKGKMQELPIV  161
            I AV+   ILAE I+ G ++GA +IVIGLYSV+WGK K+ +  E  +  ELP+V
Sbjct  301  IVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWGKHKETQDKEDDETTELPVV  354



>gb|AFK43964.1| unknown [Medicago truncatula]
Length=291

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            I A++   +LAE ++ G +IGAFII +GLY VVWGKSKD  N    + E
Sbjct  221  IVAIMGYFLLAEQMFLGRVIGAFIICLGLYLVVWGKSKDYNNPSNAISE  269



>gb|KGN61082.1| hypothetical protein Csa_2G042770 [Cucumis sativus]
Length=268

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            +T +LA I+L E I+ GSL+G   ++IGLY V+WGK+KD      K        +++ S+
Sbjct  190  VTTILAAIVLHEEIFTGSLLGGVAVIIGLYIVLWGKAKDYAKVGAK--------LEKPSL  241

Query  183  ESKDTIKSKLQEKTPQ  230
            + K+ +   L+  T Q
Sbjct  242  DQKEEVCESLERSTDQ  257



>ref|XP_006838307.1| hypothetical protein AMTR_s00103p00127060 [Amborella trichopoda]
 gb|ERN00876.1| hypothetical protein AMTR_s00103p00127060 [Amborella trichopoda]
Length=347

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK  134
            I A+L+ +IL E ++ GS+IG  +I++G Y V+WGKSKD+ NEK
Sbjct  288  IAAILSALILKERLHLGSVIGGCLIILGFYCVMWGKSKDDNNEK  331



>gb|EMT33815.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNE  131
            ITAV+  IIL E I  GS+IGA IIV+GLY ++WGKSKD  N+
Sbjct  291  ITAVMGSIILKEEITLGSVIGAVIIVVGLYFLIWGKSKDNVNQ  333



>ref|NP_001048972.2| Os03g0149300 [Oryza sativa Japonica Group]
 dbj|BAF10886.2| Os03g0149300 [Oryza sativa Japonica Group]
Length=86

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            + A+LA  +  EN+Y GS+IG  ++++GLY ++WGK KD+     K QE
Sbjct  9    MVAILAYFMFGENLYVGSIIGGVVVILGLYMLLWGKDKDQEYNANKQQE  57



>ref|XP_011077436.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            + A+L+  ILAE +Y G +IGA +I++GLY VVWGK KD        QE P+
Sbjct  299  LVAILSSFILAEKLYLGRVIGAMVIIVGLYFVVWGKRKDYKPPSAGEQEPPV  350



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQEL-PIVMMDRES  179
            I A+L   ILAE ++ GS+IGA +IV+GLY VVWGK KD         EL P+  +D + 
Sbjct  299  IVAILGSFILAEQMFVGSVIGAIVIVVGLYLVVWGKIKDHVPSSPADNELIPVTPVDDKI  358

Query  180  VESKDTIKSKLQEKTPQEA*NIEF  251
                 +I   +  K  ++  + EF
Sbjct  359  QMKTGSISDGVDRKENEKPDHHEF  382



>ref|XP_006453497.1| hypothetical protein CICLE_v10010601mg [Citrus clementina]
 gb|ESR66737.1| hypothetical protein CICLE_v10010601mg [Citrus clementina]
Length=347

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I  VLAG+ L E I+ GSLIGAF ++IGLY V+WGK++D      +T+ K +  +   V 
Sbjct  253  IVTVLAGLFLDEEIFMGSLIGAFAVIIGLYVVLWGKAEDLEEIEHKTDTKLQNDQTRTVQ  312

Query  165  MDRESVESKDTIKSKLQEK  221
            +  E    K + K+ L+E 
Sbjct  313  VVIEEPSVKKSYKNNLEEP  331



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK-GKM-QELPI  158
            I A+L  IILAE ++ G ++GA +IV+GLYSV+WGKSKDE +     M +ELP+
Sbjct  288  IVAILGSIILAEVMFLGRILGAIVIVLGLYSVLWGKSKDEPSSSFSDMDKELPL  341



>gb|EMS45454.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=370

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 10/91 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I  VL   IL+E I  G + GA IIV+GLY+++WGKSKD  N+  +           ++ 
Sbjct  279  IVTVLGSFILSEVITLGRITGAMIIVVGLYALIWGKSKDHVNQVER----------NDNF  328

Query  183  ESKDTIKSKLQEKTPQEA*NIEFTIKKKLCA  275
            E  ++ +      T  +A N++ TI    C+
Sbjct  329  EKHNSFELPFTTTTITKASNLDMTITVAACS  359



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            I A++   +LAE ++ G +IGAFII +GLY VVWGKSKD  N    + E
Sbjct  294  IVAIMGYFLLAEQMFLGRVIGAFIICLGLYLVVWGKSKDYNNPSNAISE  342



>ref|NP_001170095.1| hypothetical protein [Zea mays]
 gb|ACN35775.1| unknown [Zea mays]
Length=449

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGK-MQELPIVM  164
            I A++   ILAENIY G +IG+ +IV GLYSV+WGK K+   ++G+   E+P+ +
Sbjct  341  IVAIMGSFILAENIYLGGIIGSVLIVAGLYSVLWGKHKENEEKEGEAAMEIPVAI  395



>gb|KDO62356.1| hypothetical protein CISIN_1g017523mg [Citrus sinensis]
Length=370

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I  VLAG+ L E I+ GSLIGAF ++IGLY V+WGK++D      +T+ K +  +   V 
Sbjct  276  IVTVLAGLFLDEEIFMGSLIGAFAVIIGLYVVLWGKAEDLEEIEHKTDTKLQNDQTRTVQ  335

Query  165  MDRESVESKDTIKSKLQEK  221
            +  E    K + K+ L+E 
Sbjct  336  VVIEEPSVKKSYKNNLEEP  354



>gb|EYU29713.1| hypothetical protein MIMGU_mgv11b0165801mg, partial [Erythranthe 
guttata]
Length=70

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 20/83 (24%)
 Frame = +3

Query  3    ITAVLAGII-LAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRES  179
            + AV+ G+I + E +Y GSL+GAF+++IG Y+V+WGKSK+   EKG              
Sbjct  5    VVAVVIGVIFMKEVLYIGSLVGAFVLIIGFYAVMWGKSKEGKIEKG--------------  50

Query  180  VESKDTIKSKLQEKTPQEA*NIE  248
                D   S LQE   QE  NIE
Sbjct  51   ---SDESSSNLQEPLLQE--NIE  68



>emb|CDX99013.1| BnaC09g48220D [Brassica napus]
Length=156

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A++   ILAE I+ G +IGA +IVIGLY+V+WGK K+      ++ E P   +D  S 
Sbjct  56   IVAIMGSFILAEKIFLGGVIGAVLIVIGLYAVLWGKQKENEVTHCEILERPTKNIDPSSK  115

Query  183  ESKD  194
             ++D
Sbjct  116  VTED  119



>ref|NP_173607.1| WAT1-related protein [Arabidopsis thaliana]
 sp|F4HZQ7.1|WTR5_ARATH RecName: Full=WAT1-related protein At1g21890 [Arabidopsis thaliana]
 gb|AEE30169.1| WAT1-related protein [Arabidopsis thaliana]
Length=389

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 11/85 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--TNEKGKMQELPIVMMDRE  176
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+  T++    + LPI    + 
Sbjct  299  ITAALGVVVLSESIHLGSVIGTLFIIVGLYTVVWGKGKDKRMTDDDEDCKGLPI----KS  354

Query  177  SVESKDTIKS-----KLQEKTPQEA  236
             V+  DT K      +++ K  QEA
Sbjct  355  PVKPVDTGKGLAAELEMKSKEGQEA  379



>gb|AAL38712.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAM91775.1| putative nodulin protein [Arabidopsis thaliana]
Length=389

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 11/85 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--TNEKGKMQELPIVMMDRE  176
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+  T++    + LPI    + 
Sbjct  299  ITAALGVVVLSESIHLGSVIGTLFIIVGLYTVVWGKGKDKRMTDDDEDCKGLPI----KS  354

Query  177  SVESKDTIKS-----KLQEKTPQEA  236
             V+  DT K      +++ K  QEA
Sbjct  355  PVKPVDTGKGLAAELEMKSKEGQEA  379



>ref|XP_006474620.1| PREDICTED: WAT1-related protein At4g28040-like [Citrus sinensis]
Length=380

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD------ETNEKGKMQELPIVM  164
            I  VLAG+ L E I+ GSLIGAF ++IGLY V+WGK++D      +T+ K +  +   V 
Sbjct  286  IVTVLAGLFLDEEIFMGSLIGAFAVIIGLYVVLWGKAEDLEEIEHKTDTKLQNDQTRTVQ  345

Query  165  MDRESVESKDTIKSKLQEK  221
            +  E    K + K+ L+E 
Sbjct  346  VVIEEPSVKKSYKNNLEEP  364



>gb|AAF16542.1|AC013482_16 T26F17.11 [Arabidopsis thaliana]
Length=391

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 11/85 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--TNEKGKMQELPIVMMDRE  176
            ITA L  ++L+E+I+ GS+IG   I++GLY+VVWGK KD+  T++    + LPI    + 
Sbjct  301  ITAALGVVVLSESIHLGSVIGTLFIIVGLYTVVWGKGKDKRMTDDDEDCKGLPI----KS  356

Query  177  SVESKDTIKS-----KLQEKTPQEA  236
             V+  DT K      +++ K  QEA
Sbjct  357  PVKPVDTGKGLAAELEMKSKEGQEA  381



>ref|XP_004162696.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=365

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            +T +LA I+L E I+ GSL+G   ++IGLY V+WGK+KD      K        +++ S+
Sbjct  287  VTTILAAIVLHEEIFTGSLLGGVAVIIGLYIVLWGKAKDYAKVGAK--------LEKPSL  338

Query  183  ESKDTIKSKLQEKTPQ  230
            + K+ +   L+  T Q
Sbjct  339  DQKEEVCESLERSTDQ  354



>ref|XP_010064999.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
Length=381

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 9/61 (15%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---------TNEKGKMQELP  155
            ITA L+ I+LAE ++ GS+IGA  IV GLY V+WGKSK+           +EK    ELP
Sbjct  298  ITAALSAIVLAEKLHLGSIIGAIFIVCGLYIVLWGKSKERQAESTAALMPDEKVPTSELP  357

Query  156  I  158
            I
Sbjct  358  I  358



>ref|XP_004302750.1| PREDICTED: WAT1-related protein At2g37460-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEK  134
            I AV++  IL E ++ G L+GAF+I+IGLY VVWGKSK+++ E+
Sbjct  295  IVAVMSSFILREQLFLGRLLGAFVIIIGLYLVVWGKSKEKSPEE  338



>ref|XP_004144705.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=369

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            +T +LA I+L E I+ GSL+G   ++IGLY V+WGK+KD      K        +++ S+
Sbjct  291  VTTILAAIVLHEEIFTGSLLGGVAVIIGLYIVLWGKAKDYAKVGAK--------LEKPSL  342

Query  183  ESKDTIKSKLQEKTPQ  230
            + K+ +   L+  T Q
Sbjct  343  DQKEEVCESLERSTDQ  358



>ref|XP_004985690.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Setaria 
italica]
Length=374

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A+LA  I  EN+Y GS+IG  ++++GLY ++WGK KD+ +   K QEL +   ++++ 
Sbjct  296  MVAILAYFIFGENLYVGSIIGGVVVILGLYMLLWGKEKDQVHGASKDQELELD-CEKQAR  354

Query  183  ESKD  194
            +++D
Sbjct  355  KARD  358



>ref|XP_004985689.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Setaria 
italica]
Length=374

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A+LA  I  EN+Y GS+IG  ++++GLY ++WGK KD+ +   K QEL +   ++++ 
Sbjct  296  MVAILAYFIFGENLYVGSIIGGVVVILGLYMLLWGKEKDQVHGASKDQELELD-CEKQAR  354

Query  183  ESKD  194
            +++D
Sbjct  355  KARD  358



>gb|AFK37263.1| unknown [Lotus japonicus]
Length=386

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 7/73 (10%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            I A+L   ILAE +Y G +IGA +I++GLY VVWGK+KD  +        P  +++   +
Sbjct  296  IVAILGSFILAEQMYLGRVIGAIVILLGLYLVVWGKNKDYDSP-------PSPIINEHVL  348

Query  183  ESKDTIKSKLQEK  221
              K TI+S  ++K
Sbjct  349  PDKQTIESNAKDK  361



>gb|KHN47036.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=363

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 8/64 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN--------EKGKMQELPI  158
            IT+ L   + AE ++ GS+IGA II +GLYSVVWGK KD +N        +  +  +LPI
Sbjct  299  ITSALGSFLFAEQLHLGSIIGAVIIALGLYSVVWGKGKDYSNPTPSSPTTKHTETPQLPI  358

Query  159  VMMD  170
               D
Sbjct  359  TSSD  362



>ref|NP_001241603.1| uncharacterized protein LOC100812537 [Glycine max]
 gb|ACU22896.1| unknown [Glycine max]
Length=363

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 8/64 (13%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETN--------EKGKMQELPI  158
            IT+ L   + AE ++ GS+IGA II +GLYSVVWGK KD +N        +  +  +LPI
Sbjct  299  ITSALGSFLFAEQLHLGSIIGAVIIALGLYSVVWGKGKDYSNPTPSSPTTKHTETPQLPI  358

Query  159  VMMD  170
               D
Sbjct  359  TSSD  362



>ref|XP_003542469.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=379

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            I AV++  ILAE ++ G +IGA II +GLY VVWGKSKD +      QE
Sbjct  289  IVAVMSYFILAEQVFLGRMIGAVIICLGLYVVVWGKSKDYSPPNPNTQE  337



>gb|KHN48995.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQE  149
            I AV++  ILAE ++ G +IGA II +GLY VVWGKSKD +      QE
Sbjct  289  IVAVMSYFILAEQVFLGRMIGAVIICLGLYVVVWGKSKDYSPPNPNTQE  337



>ref|XP_010999362.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Populus 
euphratica]
Length=363

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKD--------ETNEKGKMQELPI  158
            I A L  +ILAE ++ GS++G  II IGLYSVVWGK KD         T  KG  QELPI
Sbjct  297  IVAALGSLILAEKLHLGSVLGGIIIAIGLYSVVWGKRKDYASPEDLSTTAAKGN-QELPI  355

Query  159  VMMD  170
               +
Sbjct  356  ATTN  359



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE--TNEKGKMQELPIVMMDRE  176
            I A+L  IILAE ++ G ++GA +IV+GLYSV+WGKSKDE  ++      ELP+      
Sbjct  288  IVAILGSIILAEVMFLGRILGAIVIVLGLYSVLWGKSKDEPPSSFPDMDTELPLSTPQIV  347

Query  177  SVESKDTIKSKLQEKT  224
            +  SK   +    + T
Sbjct  348  TFSSKANTEMDTNDAT  363



>ref|XP_010110114.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC25201.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=362

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPIVMMDRESV  182
            + A++A +IL + +Y+G ++GA +I++GLY V+WGK+++   E  + +   + ++D ES+
Sbjct  292  LVAIMATLILHDQLYSGGIVGAVLIMLGLYLVLWGKNRERRMENQR-EPFKVPLLDEESI  350

Query  183  ESKD  194
            E +D
Sbjct  351  EKQD  354



>ref|XP_006844156.1| hypothetical protein AMTR_s00006p00261210 [Amborella trichopoda]
 gb|ERN05831.1| hypothetical protein AMTR_s00006p00261210 [Amborella trichopoda]
Length=352

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDETNEKGKMQELPI  158
            I A+L+   L E ++ GS+IG  +I++G Y V+WGKSKD+ NEK +  ++PI
Sbjct  286  IAAILSAFFLKERLHLGSVIGGCLIILGFYCVMWGKSKDDNNEKAE-DKIPI  336



>gb|KHG27290.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=384

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +3

Query  3    ITAVLAGIILAENIYAGSLIGAFIIVIGLYSVVWGKSKDE---TNEKGKMQELPIVMMDR  173
            + A++A I L E  Y G +IGA +I++GLY V+WGKS++      EKG +Q  P    + 
Sbjct  304  VVAIMASIALGEEFYLGGIIGAVLIIVGLYLVLWGKSQERKFAAQEKGAIQSTP----EH  359

Query  174  ESVESKDTIKSKLQEK  221
             ++ +   IK+ L + 
Sbjct  360  SNIRTSSHIKASLTKP  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175