BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007B02 383 bp,:Filtered

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO61758.1|  hypothetical protein CISIN_1g042047mg                 94.4    2e-22   Citrus sinensis [Valencia orange]
ref|XP_009607066.1|  PREDICTED: auxin-responsive protein IAA28-li...  97.4    4e-22   Nicotiana tomentosiformis
ref|XP_009607065.1|  PREDICTED: auxin-responsive protein IAA28-li...  97.1    7e-22   Nicotiana tomentosiformis
ref|XP_009767739.1|  PREDICTED: auxin-responsive protein IAA28-li...  96.3    1e-21   Nicotiana sylvestris
ref|XP_009767738.1|  PREDICTED: auxin-responsive protein IAA28-li...  95.9    1e-21   Nicotiana sylvestris
ref|XP_006483377.1|  PREDICTED: auxin-responsive protein IAA29-like   93.6    7e-21   Citrus sinensis [Valencia orange]
ref|XP_006450408.1|  hypothetical protein CICLE_v10009245mg           90.9    1e-19   Citrus clementina
ref|XP_006353683.1|  PREDICTED: auxin-responsive protein IAA29-like   88.2    1e-18   Solanum tuberosum [potatoes]
ref|NP_001266091.1|  IAA29                                            87.0    2e-18   Solanum lycopersicum
ref|XP_010090614.1|  Auxin-responsive protein IAA29                   86.3    9e-18   Morus notabilis
ref|NP_001266100.1|  IAA36                                            85.5    1e-17   Solanum lycopersicum
ref|XP_010437931.1|  PREDICTED: auxin-responsive protein IAA29-li...  84.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010437929.1|  PREDICTED: auxin-responsive protein IAA29-li...  84.3    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002309635.1|  hypothetical protein POPTR_0006s27130g           84.0    4e-17   Populus trichocarpa [western balsam poplar]
emb|CDP13527.1|  unnamed protein product                              82.4    6e-17   Coffea canephora [robusta coffee]
ref|XP_010447414.1|  PREDICTED: auxin-responsive protein IAA29-li...  83.2    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006343525.1|  PREDICTED: auxin-responsive protein IAA29-like   82.8    8e-17   Solanum tuberosum [potatoes]
ref|XP_009126250.1|  PREDICTED: auxin-responsive protein IAA29 is...  82.4    1e-16   Brassica rapa
gb|EYU32350.1|  hypothetical protein MIMGU_mgv1a019829mg              82.0    2e-16   Erythranthe guttata [common monkey flower]
gb|KFK29835.1|  hypothetical protein AALP_AA7G185100                  82.0    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010250166.1|  PREDICTED: auxin-responsive protein IAA5-like    82.0    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006358296.1|  PREDICTED: auxin-responsive protein IAA20-like   81.6    2e-16   Solanum tuberosum [potatoes]
ref|XP_009126243.1|  PREDICTED: auxin-responsive protein IAA29 is...  81.6    2e-16   Brassica rapa
ref|XP_011039729.1|  PREDICTED: probable LRR receptor-like serine...  84.7    3e-16   Populus euphratica
ref|XP_009138073.1|  PREDICTED: auxin-responsive protein IAA29-like   81.6    3e-16   Brassica rapa
ref|XP_009767450.1|  PREDICTED: auxin-responsive protein IAA29-like   81.3    3e-16   Nicotiana sylvestris
gb|KJB55025.1|  hypothetical protein B456_009G058600                  81.3    3e-16   Gossypium raimondii
ref|XP_010656457.1|  PREDICTED: auxin-responsive protein IAA9-lik...  81.3    3e-16   Vitis vinifera
gb|KHG13019.1|  Auxin-responsive IAA29 -like protein                  81.3    3e-16   Gossypium arboreum [tree cotton]
emb|CBI28230.3|  unnamed protein product                              80.5    4e-16   Vitis vinifera
ref|XP_002285354.1|  PREDICTED: auxin-responsive protein IAA9-lik...  80.9    5e-16   Vitis vinifera
ref|XP_006577839.1|  PREDICTED: uncharacterized protein LOC100802...  80.5    5e-16   Glycine max [soybeans]
ref|XP_010041196.1|  PREDICTED: auxin-responsive protein IAA29-like   77.8    7e-16   Eucalyptus grandis [rose gum]
emb|CDX72351.1|  BnaC07g43730D                                        80.1    1e-15   Brassica napus [oilseed rape]
ref|XP_010432746.1|  PREDICTED: auxin-responsive protein IAA29-li...  80.1    1e-15   Camelina sativa [gold-of-pleasure]
gb|KHN07071.1|  Auxin-responsive protein IAA29                        79.7    1e-15   Glycine soja [wild soybean]
ref|XP_009623727.1|  PREDICTED: auxin-responsive protein IAA29-like   79.3    2e-15   Nicotiana tomentosiformis
emb|CDX68829.1|  BnaC01g06240D                                        79.3    2e-15   Brassica napus [oilseed rape]
ref|XP_004501338.1|  PREDICTED: auxin-responsive protein IAA29-like   79.0    2e-15   Cicer arietinum [garbanzo]
ref|XP_010648672.1|  PREDICTED: auxin-responsive protein IAA28        79.0    2e-15   Vitis vinifera
gb|AAK55727.1|AF380646_1  AT4g32280/F10M6_80                          77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284419.1|  hypothetical protein CARUB_v10005589mg           77.8    4e-15   Capsella rubella
gb|ADB93671.2|  indole-3-acetic acid inducible 29                     77.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280821.1|  auxin-responsive protein IAA29-like              78.2    5e-15   Malus domestica [apple tree]
gb|ADL70778.1|  indole-3-acetic acid inducible 29                     77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93673.2|  indole-3-acetic acid inducible 29                     77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70783.1|  indole-3-acetic acid inducible 29                     77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567891.1|  auxin-responsive protein IAA29                      77.8    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048188.1|  PREDICTED: auxin-induced protein 22D             77.4    8e-15   Eucalyptus grandis [rose gum]
ref|XP_006284420.1|  hypothetical protein CARUB_v10005589mg           77.4    8e-15   Capsella rubella
ref|NP_001266098.1|  IAA35                                            75.9    2e-14   Solanum lycopersicum
ref|XP_010241552.1|  PREDICTED: auxin-responsive protein IAA28-like   76.3    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009797130.1|  PREDICTED: auxin-responsive protein IAA29-like   75.9    3e-14   Nicotiana sylvestris
ref|XP_006412496.1|  hypothetical protein EUTSA_v10027347mg           75.9    3e-14   Eutrema salsugineum
ref|XP_011459850.1|  PREDICTED: probable LRR receptor-like serine...  79.0    3e-14   Fragaria vesca subsp. vesca
ref|XP_008466417.1|  PREDICTED: auxin-responsive protein IAA28        75.5    4e-14   Cucumis melo [Oriental melon]
ref|XP_009608871.1|  PREDICTED: auxin-responsive protein IAA20-like   75.1    4e-14   Nicotiana tomentosiformis
ref|XP_004136353.1|  PREDICTED: auxin-responsive protein IAA29-like   74.3    1e-13   Cucumis sativus [cucumbers]
ref|XP_004167111.1|  PREDICTED: auxin-responsive protein IAA8-like    74.3    1e-13   
ref|XP_002515504.1|  ATP binding protein, putative                    76.6    2e-13   
ref|XP_003603373.1|  Auxin-responsive protein IAA10                   72.8    3e-13   Medicago truncatula
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like   73.6    3e-13   Nicotiana sylvestris
ref|XP_008337261.1|  PREDICTED: auxin-responsive protein IAA20-like   71.6    8e-13   Malus domestica [apple tree]
ref|XP_006475894.1|  PREDICTED: auxin-responsive protein IAA29-like   71.2    1e-12   Citrus sinensis [Valencia orange]
ref|XP_010112480.1|  Auxin-responsive protein IAA29                   70.9    1e-12   Morus notabilis
ref|NP_001237212.1|  uncharacterized protein LOC100499872             70.9    1e-12   Glycine max [soybeans]
ref|XP_009363994.1|  PREDICTED: auxin-responsive protein IAA29        70.9    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...  70.9    2e-12   Glycine max [soybeans]
gb|KDP21371.1|  hypothetical protein JCGZ_21842                       70.5    2e-12   Jatropha curcas
ref|XP_007204725.1|  hypothetical protein PRUPE_ppa010871mg           70.5    2e-12   Prunus persica
ref|XP_010687936.1|  PREDICTED: auxin-responsive protein IAA29        70.9    2e-12   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007223809.1|  hypothetical protein PRUPE_ppa010683mg           70.5    2e-12   Prunus persica
ref|XP_011017813.1|  PREDICTED: auxin-induced protein 22D-like is...  70.5    2e-12   Populus euphratica
ref|XP_011017814.1|  PREDICTED: auxin-responsive protein IAA29-li...  70.5    2e-12   Populus euphratica
ref|XP_008451269.1|  PREDICTED: auxin-induced protein 22D-like        69.7    4e-12   Cucumis melo [Oriental melon]
ref|XP_002281696.1|  PREDICTED: auxin-induced protein 22D             69.3    4e-12   Vitis vinifera
ref|XP_006443922.1|  hypothetical protein CICLE_v10022370mg           69.3    5e-12   Citrus clementina
gb|KHN18839.1|  Auxin-induced protein 22D                             69.3    5e-12   Glycine soja [wild soybean]
gb|EPS72934.1|  hypothetical protein M569_01824                       68.6    5e-12   Genlisea aurea
ref|XP_008786091.1|  PREDICTED: auxin-induced protein 22D-like        69.3    5e-12   Phoenix dactylifera
gb|KHN03839.1|  Auxin-induced protein 22D                             68.9    6e-12   Glycine soja [wild soybean]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like   69.3    6e-12   Cicer arietinum [garbanzo]
ref|XP_002308067.2|  hypothetical protein POPTR_0006s06550g           69.3    6e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010923480.1|  PREDICTED: auxin-induced protein 22D-like        68.9    6e-12   Elaeis guineensis
sp|O24542.1|AX22D_VIGRR  RecName: Full=Auxin-induced protein 22D;...  68.9    6e-12   Vigna radiata var. radiata [golden gram]
ref|NP_001242395.1|  uncharacterized protein LOC100799875             68.9    6e-12   Glycine max [soybeans]
ref|NP_001242729.1|  uncharacterized protein LOC100780752             68.9    7e-12   Glycine max [soybeans]
ref|XP_006450872.1|  hypothetical protein CICLE_v10008935mg           70.1    7e-12   Citrus clementina
ref|XP_008219507.1|  PREDICTED: auxin-responsive protein IAA29        68.9    7e-12   Prunus mume [ume]
gb|ABD98054.1|  auxin-regulated protein                               69.7    8e-12   Striga asiatica [witchweed]
ref|XP_011078390.1|  PREDICTED: auxin-responsive protein IAA28-like   68.6    8e-12   Sesamum indicum [beniseed]
ref|XP_006604480.1|  PREDICTED: auxin-induced protein 22E-like        68.6    8e-12   Glycine max [soybeans]
ref|XP_011020165.1|  PREDICTED: auxin-responsive protein IAA29-like   68.9    8e-12   Populus euphratica
ref|XP_009764468.1|  PREDICTED: auxin-induced protein 22D-like        68.6    9e-12   Nicotiana sylvestris
ref|XP_002520979.1|  Auxin-induced protein 22E, putative              68.6    9e-12   Ricinus communis
ref|XP_006349740.1|  PREDICTED: auxin-induced protein 22D-like        68.2    1e-11   Solanum tuberosum [potatoes]
gb|AAD32145.1|AF123507_1  Nt-iaa4.5 deduced protein                   68.2    1e-11   Nicotiana tabacum [American tobacco]
ref|XP_008362893.1|  PREDICTED: auxin-responsive protein IAA29-like   68.6    1e-11   Malus domestica [apple tree]
ref|XP_007050424.1|  AUX/IAA transcriptional regulator family pro...  70.1    1e-11   Theobroma cacao [chocolate]
ref|XP_006355888.1|  PREDICTED: auxin-responsive protein IAA13-like   69.3    1e-11   Solanum tuberosum [potatoes]
dbj|BAJ85337.1|  predicted protein                                    68.6    2e-11   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009786590.1|  PREDICTED: auxin-induced protein 22D-like        67.4    2e-11   Nicotiana sylvestris
ref|XP_007144687.1|  hypothetical protein PHAVU_007G176700g           67.4    2e-11   Phaseolus vulgaris [French bean]
gb|KFK29404.1|  hypothetical protein AALP_AA7G129700                  67.8    2e-11   Arabis alpina [alpine rockcress]
emb|CDX92888.1|  BnaC07g41460D                                        69.3    2e-11   Brassica napus [oilseed rape]
ref|XP_003521267.1|  PREDICTED: auxin-induced protein 22E-like        67.4    2e-11   Glycine max [soybeans]
sp|O24543.1|AX22E_VIGRR  RecName: Full=Auxin-induced protein 22E;...  67.4    2e-11   Vigna radiata var. radiata [golden gram]
ref|XP_010038042.1|  PREDICTED: auxin-responsive protein IAA1-like    67.4    2e-11   Eucalyptus grandis [rose gum]
ref|NP_001239753.1|  uncharacterized protein LOC100781847             67.4    3e-11   Glycine max [soybeans]
gb|KHN22078.1|  Auxin-responsive protein IAA16                        67.4    3e-11   Glycine soja [wild soybean]
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...  67.0    3e-11   Theobroma cacao [chocolate]
ref|NP_001266065.1|  IAA12                                            68.2    3e-11   Solanum lycopersicum
gb|AFK44192.1|  unknown                                               67.4    3e-11   Medicago truncatula
gb|AAN16887.1|  Aux/IAA2                                              65.5    3e-11   Mirabilis jalapa
ref|XP_009589137.1|  PREDICTED: auxin-induced protein 22D-like        67.0    3e-11   Nicotiana tomentosiformis
gb|ACJ85999.1|  unknown                                               67.0    3e-11   Medicago truncatula
gb|ACF88333.1|  unknown                                               67.4    4e-11   Zea mays [maize]
ref|XP_010556867.1|  PREDICTED: auxin-responsive protein IAA10        67.0    4e-11   Tarenaya hassleriana [spider flower]
gb|ACF87179.1|  unknown                                               67.4    4e-11   Zea mays [maize]
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein               67.0    4e-11   Medicago truncatula
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein               67.0    4e-11   Medicago truncatula
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member   67.4    4e-11   Zea mays [maize]
gb|ABK95100.1|  unknown                                               65.1    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009137802.1|  PREDICTED: auxin-responsive protein IAA11-like   66.6    4e-11   Brassica rapa
gb|ADG60258.1|  IAA13-like protein                                    66.2    5e-11   Nicotiana tabacum [American tobacco]
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like   67.8    5e-11   Nicotiana tomentosiformis
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   66.6    5e-11   Cucumis sativus [cucumbers]
ref|XP_010235967.1|  PREDICTED: auxin-responsive protein IAA10 is...  67.0    5e-11   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                          66.2    5e-11   Solanum tuberosum [potatoes]
ref|XP_010447416.1|  PREDICTED: auxin-responsive protein IAA29-li...  66.6    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_003570401.1|  PREDICTED: auxin-responsive protein IAA10 is...  67.0    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like      66.6    5e-11   Malus domestica [apple tree]
ref|XP_009419087.1|  PREDICTED: auxin-responsive protein IAA9-lik...  66.2    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001266029.1|  IAA3 protein                                     66.2    6e-11   Solanum lycopersicum
emb|CDY35203.1|  BnaA01g08280D                                        66.6    6e-11   Brassica napus [oilseed rape]
ref|XP_009612823.1|  PREDICTED: auxin-induced protein 22D-like        65.9    6e-11   Nicotiana tomentosiformis
ref|XP_006352755.1|  PREDICTED: auxin-induced protein 22D-like        65.9    6e-11   Solanum tuberosum [potatoes]
gb|ABM53870.1|  IAA2                                                  65.9    6e-11   Cestrum elegans
emb|CAH59413.1|  auxin resistance protein                             66.2    6e-11   Plantago major [cart-track plant]
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1         66.2    6e-11   Populus euphratica
gb|AFK42473.1|  unknown                                               66.2    6e-11   Lotus japonicus
gb|ABI36487.1|  AUX/IAA7 A                                            65.9    6e-11   Malus domestica [apple tree]
ref|XP_002307625.1|  auxin-induced protein 22B                        65.9    7e-11   Populus trichocarpa [western balsam poplar]
gb|EPS58914.1|  hypothetical protein M569_15899                       65.1    7e-11   Genlisea aurea
ref|XP_004169589.1|  PREDICTED: auxin-responsive protein IAA4-like    65.1    7e-11   
gb|EMS48060.1|  Auxin-responsive protein IAA10                        65.5    7e-11   Triticum urartu
ref|XP_004495146.1|  PREDICTED: auxin-induced protein 22D-like is...  65.9    7e-11   Cicer arietinum [garbanzo]
ref|XP_004495145.1|  PREDICTED: auxin-induced protein 22D-like is...  65.9    7e-11   Cicer arietinum [garbanzo]
gb|KJB22939.1|  hypothetical protein B456_004G075000                  65.9    7e-11   Gossypium raimondii
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760        66.2    8e-11   Amborella trichopoda
ref|XP_010674856.1|  PREDICTED: auxin-responsive protein IAA4-like    65.9    8e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like      66.2    8e-11   Pyrus x bretschneideri [bai li]
ref|XP_010278166.1|  PREDICTED: auxin-responsive protein IAA4-like    65.9    8e-11   Nelumbo nucifera [Indian lotus]
gb|KJB56783.1|  hypothetical protein B456_009G135900                  67.8    8e-11   Gossypium raimondii
gb|KJB06503.1|  hypothetical protein B456_001G242800                  65.5    8e-11   Gossypium raimondii
ref|XP_010447413.1|  PREDICTED: auxin-responsive protein IAA29-li...  66.2    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like   65.1    8e-11   
emb|CDY51701.1|  BnaA03g58910D                                        65.9    8e-11   Brassica napus [oilseed rape]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  65.9    8e-11   
gb|ACR38138.1|  unknown                                               65.5    9e-11   Zea mays [maize]
ref|XP_004495060.1|  PREDICTED: auxin-responsive protein IAA12-li...  66.2    9e-11   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg           65.9    9e-11   Capsella rubella
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like      66.2    9e-11   Malus domestica [apple tree]
gb|AEE25654.1|  auxin-responsive protein                              65.9    9e-11   Gossypium hirsutum [American cotton]
gb|KJB22937.1|  hypothetical protein B456_004G075000                  65.5    9e-11   Gossypium raimondii
emb|CDP10441.1|  unnamed protein product                              65.9    1e-10   Coffea canephora [robusta coffee]
gb|KJB82525.1|  hypothetical protein B456_013G200700                  65.9    1e-10   Gossypium raimondii
gb|KJB06507.1|  hypothetical protein B456_001G242800                  65.5    1e-10   Gossypium raimondii
gb|ABM53872.1|  IAA4                                                  65.1    1e-10   Cestrum elegans
gb|EMT31544.1|  Auxin-responsive protein IAA10                        65.9    1e-10   Aegilops tauschii
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         67.0    1e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like      65.9    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like   65.5    1e-10   Nicotiana tomentosiformis
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like        65.5    1e-10   Cucumis sativus [cucumbers]
ref|XP_009767832.1|  PREDICTED: auxin-responsive protein IAA12-li...  66.6    1e-10   Nicotiana sylvestris
ref|NP_001142395.1|  uncharacterized protein LOC100274569             65.9    1e-10   Zea mays [maize]
gb|KGN60808.1|  hypothetical protein Csa_2G010920                     65.5    1e-10   Cucumis sativus [cucumbers]
ref|NP_001266052.1|  IAA8                                             66.2    1e-10   Solanum lycopersicum
emb|CBI28036.3|  unnamed protein product                              65.1    1e-10   Vitis vinifera
ref|XP_002528895.1|  transcription factor, putative                   67.4    1e-10   Ricinus communis
ref|XP_009767831.1|  PREDICTED: auxin-responsive protein IAA12-li...  66.6    1e-10   Nicotiana sylvestris
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...  67.4    1e-10   Eucalyptus grandis [rose gum]
gb|ACJ84551.1|  unknown                                               67.0    1e-10   Medicago truncatula
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like   65.9    1e-10   Eucalyptus grandis [rose gum]
gb|KDP23666.1|  hypothetical protein JCGZ_23499                       65.1    1e-10   Jatropha curcas
ref|XP_004964748.1|  PREDICTED: auxin-responsive protein IAA20-like   65.1    1e-10   Setaria italica
gb|KHG20616.1|  Auxin-induced 22D                                     65.1    1e-10   Gossypium arboreum [tree cotton]
ref|XP_009767830.1|  PREDICTED: auxin-responsive protein IAA12-li...  66.6    1e-10   Nicotiana sylvestris
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein           67.0    1e-10   Medicago truncatula
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   65.9    1e-10   Setaria italica
emb|CDY41894.1|  BnaC05g47100D                                        65.5    1e-10   Brassica napus [oilseed rape]
gb|AAL55414.1|  auxin-induced AUX/IAA1                                65.1    1e-10   Antirrhinum majus [garden snapdragon]
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  65.5    1e-10   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580        65.9    1e-10   Sorghum bicolor [broomcorn]
ref|XP_010691245.1|  PREDICTED: auxin-responsive protein IAA1         65.1    1e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDY38374.1|  BnaC01g09830D                                        65.5    1e-10   Brassica napus [oilseed rape]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg              65.5    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_008449351.1|  PREDICTED: auxin-induced protein AUX28-like      65.1    2e-10   
ref|XP_010440447.1|  PREDICTED: auxin-responsive protein IAA1-like    64.7    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative         65.5    2e-10   Ricinus communis
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        67.0    2e-10   Amborella trichopoda
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...  66.6    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010450024.1|  PREDICTED: auxin-responsive protein IAA1-like    64.7    2e-10   Camelina sativa [gold-of-pleasure]
dbj|BAK01326.1|  predicted protein                                    65.5    2e-10   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ84870.1|  predicted protein                                    65.5    2e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004493738.1|  PREDICTED: auxin-induced protein 22E-like        64.7    2e-10   Cicer arietinum [garbanzo]
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                   66.6    2e-10   Gossypium arboreum [tree cotton]
ref|XP_008808453.1|  PREDICTED: auxin-induced protein 22D-like        64.7    2e-10   Phoenix dactylifera
ref|XP_010542967.1|  PREDICTED: auxin-responsive protein IAA13-li...  65.5    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_009354869.1|  PREDICTED: auxin-induced protein 22D-like        64.7    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  66.6    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27        65.9    2e-10   Solanum tuberosum [potatoes]
ref|XP_007162489.1|  hypothetical protein PHAVU_001G156500g           64.7    2e-10   Phaseolus vulgaris [French bean]
ref|XP_009419086.1|  PREDICTED: auxin-responsive protein IAA9-lik...  64.7    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007050158.1|  Indole-3-acetic acid inducible 11, putative ...  65.9    2e-10   Theobroma cacao [chocolate]
ref|XP_004134103.1|  PREDICTED: auxin-induced protein 22B-like        64.7    2e-10   Cucumis sativus [cucumbers]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   65.1    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419085.1|  PREDICTED: auxin-responsive protein IAA9-lik...  64.7    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010542966.1|  PREDICTED: auxin-responsive protein IAA13-li...  65.1    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010529092.1|  PREDICTED: auxin-responsive protein IAA1-like    64.7    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g           65.1    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16             65.1    2e-10   Theobroma cacao [chocolate]
ref|XP_002279955.1|  PREDICTED: auxin-induced protein 22D             64.7    2e-10   Vitis vinifera
ref|XP_006282898.1|  hypothetical protein CARUB_v10007151mg           64.3    2e-10   Capsella rubella
ref|XP_010435109.1|  PREDICTED: auxin-responsive protein IAA1         64.3    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   65.1    2e-10   Glycine max [soybeans]
ref|XP_002299625.1|  auxin-induced protein IAA4                       64.7    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008235329.1|  PREDICTED: auxin-induced protein 22D-like        64.7    2e-10   Prunus mume [ume]
ref|XP_009621769.1|  PREDICTED: auxin-responsive protein IAA13 is...  65.9    2e-10   Nicotiana tomentosiformis
ref|XP_010679164.1|  PREDICTED: auxin-induced protein 22D             64.7    2e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006648120.1|  PREDICTED: auxin-responsive protein IAA10-li...  65.5    2e-10   Oryza brachyantha
gb|KHN31465.1|  Auxin-responsive protein IAA16                        65.1    2e-10   Glycine soja [wild soybean]
gb|ACU19136.1|  unknown                                               65.1    2e-10   Glycine max [soybeans]
ref|XP_006648119.1|  PREDICTED: auxin-responsive protein IAA10-li...  65.5    2e-10   Oryza brachyantha
gb|KJB38347.1|  hypothetical protein B456_006G250900                  66.2    2e-10   Gossypium raimondii
ref|XP_007201847.1|  hypothetical protein PRUPE_ppa011843mg           64.3    2e-10   Prunus persica
ref|XP_009382657.1|  PREDICTED: auxin-induced protein 22D-like        64.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009621768.1|  PREDICTED: auxin-responsive protein IAA13 is...  65.9    2e-10   Nicotiana tomentosiformis
ref|XP_009621767.1|  PREDICTED: auxin-responsive protein IAA13 is...  65.9    2e-10   Nicotiana tomentosiformis
gb|KDP32156.1|  hypothetical protein JCGZ_12617                       66.2    2e-10   Jatropha curcas
emb|CAN74317.1|  hypothetical protein VITISV_013837                   64.3    2e-10   Vitis vinifera
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like   64.7    2e-10   Populus euphratica
gb|KJB38349.1|  hypothetical protein B456_006G250900                  65.9    2e-10   Gossypium raimondii
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...  64.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...  64.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  66.6    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008788132.1|  PREDICTED: auxin-induced protein 22D-like        64.3    3e-10   Phoenix dactylifera
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  66.2    3e-10   Nelumbo nucifera [Indian lotus]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                   64.3    3e-10   Nicotiana tabacum [American tobacco]
ref|XP_006443729.1|  hypothetical protein CICLE_v10021493mg           65.1    3e-10   Citrus clementina
emb|CCQ38165.1|  auxin-responsive protein IAA1                        62.8    3e-10   Schiedea membranacea
gb|KJB11141.1|  hypothetical protein B456_001G242900                  64.7    3e-10   Gossypium raimondii
gb|KHG09585.1|  Auxin-induced 22B                                     64.3    3e-10   Gossypium arboreum [tree cotton]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g           65.1    3e-10   Phaseolus vulgaris [French bean]
gb|KJB11145.1|  hypothetical protein B456_001G242900                  64.7    3e-10   Gossypium raimondii
emb|CCQ38181.1|  auxin-responsive protein IAA1                        62.8    3e-10   Schiedea viscosa
gb|ADW10155.1|  putative auxin-responsive protein IAA1                63.2    3e-10   Schiedea membranacea
gb|KJB71166.1|  hypothetical protein B456_011G109000                  65.9    3e-10   Gossypium raimondii
ref|XP_008365945.1|  PREDICTED: auxin-responsive protein IAA13-like   64.3    3e-10   Malus domestica [apple tree]
gb|AAP13077.1|  auxin responsive protein IAA-Re                       62.8    3e-10   Gossypium barbadense [Egyptian cotton]
gb|KJB56779.1|  hypothetical protein B456_009G135900                  65.9    3e-10   Gossypium raimondii
ref|XP_002869489.1|  indoleacetic acid-induced protein 11             64.7    3e-10   Arabidopsis lyrata subsp. lyrata
emb|CBI35213.3|  unnamed protein product                              63.9    3e-10   Vitis vinifera
gb|KJB56782.1|  hypothetical protein B456_009G135900                  65.5    3e-10   Gossypium raimondii
gb|AEQ94167.1|  auxin induced family protein                          63.5    3e-10   Elaeis guineensis
ref|XP_008676802.1|  PREDICTED: hypothetical protein isoform X1       65.1    3e-10   Zea mays [maize]
ref|XP_010102292.1|  Auxin-responsive protein IAA16                   64.7    3e-10   Morus notabilis
gb|KJB71165.1|  hypothetical protein B456_011G109000                  65.9    3e-10   Gossypium raimondii
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                  65.5    3e-10   Gossypium arboreum [tree cotton]
gb|AEI70506.1|  auxin-responsive protein                              65.5    3e-10   Gossypium hirsutum [American cotton]
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28           65.1    3e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001141156.1|  hypothetical protein                             65.1    3e-10   Zea mays [maize]
gb|AFK49626.1|  unknown                                               65.9    3e-10   Medicago truncatula
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    65.5    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_011042428.1|  PREDICTED: auxin-induced protein 22E-like        63.9    3e-10   Populus euphratica
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg           64.3    3e-10   Citrus clementina
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like   64.3    3e-10   Nelumbo nucifera [Indian lotus]
ref|NP_001288048.1|  uncharacterized protein LOC103445716             63.9    3e-10   Malus domestica [apple tree]
emb|CDP00957.1|  unnamed protein product                              65.9    3e-10   Coffea canephora [robusta coffee]
ref|XP_004954380.1|  PREDICTED: auxin-responsive protein IAA10-li...  65.1    3e-10   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like   64.3    3e-10   
ref|XP_011100996.1|  PREDICTED: auxin-responsive protein IAA29        64.3    3e-10   
ref|XP_004954379.1|  PREDICTED: auxin-responsive protein IAA10-li...  65.1    3e-10   
ref|XP_002300804.2|  auxin-induced protein 22B                        63.9    3e-10   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17        64.3    3e-10   
gb|KDO53921.1|  hypothetical protein CISIN_1g029966mg                 63.2    4e-10   
gb|AAD32144.1|AF123506_1  Nt-iaa4.3 deduced protein                   63.9    4e-10   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                 64.3    4e-10   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                       64.3    4e-10   
ref|XP_009367751.1|  PREDICTED: auxin-induced protein 22D-like        63.5    4e-10   
ref|XP_002324639.1|  hypothetical protein POPTR_0018s12790g           63.9    4e-10   
ref|XP_004495059.1|  PREDICTED: auxin-responsive protein IAA12-li...  64.7    4e-10   
ref|NP_001268036.1|  uncharacterized protein LOC100250231             64.3    4e-10   
ref|XP_010433190.1|  PREDICTED: auxin-responsive protein IAA11-like   64.3    4e-10   
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1         63.9    4e-10   
ref|XP_010512011.1|  PREDICTED: auxin-responsive protein IAA2-like    63.5    4e-10   
gb|KJB55026.1|  hypothetical protein B456_009G058600                  63.9    4e-10   
gb|ACJ86152.1|  unknown                                               63.9    4e-10   
ref|XP_010432747.1|  PREDICTED: auxin-responsive protein IAA29-li...  63.9    4e-10   
gb|ADW10164.1|  putative auxin-responsive protein IAA1                62.8    4e-10   
gb|ADK98252.1|  auxin-responsive protein IAA1                         62.8    4e-10   
ref|XP_008349014.1|  PREDICTED: auxin-responsive protein IAA11-like   64.7    4e-10   
gb|ADL36586.1|  ARF domain class transcription factor                 64.7    4e-10   
ref|XP_006284432.1|  hypothetical protein CARUB_v10005601mg           64.3    4e-10   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16        63.9    4e-10   
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   64.3    4e-10   
gb|AAP44405.1|  auxin-induced protein 2                               65.1    4e-10   
gb|ADL36587.1|  ARF domain class transcription factor                 63.5    4e-10   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16        64.3    4e-10   
ref|XP_003590532.1|  Auxin-induced protein                            63.5    4e-10   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA  65.1    4e-10   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like    65.5    4e-10   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                    63.9    4e-10   
gb|ADW10158.1|  putative auxin-responsive protein IAA1                62.4    4e-10   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16        63.9    4e-10   
gb|KJB11146.1|  hypothetical protein B456_001G242900                  64.7    4e-10   
emb|CDX79522.1|  BnaC03g18580D                                        63.9    4e-10   
ref|XP_006281167.1|  hypothetical protein CARUB_v10027201mg           63.5    5e-10   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative            63.9    5e-10   
gb|ABI36493.1|  AUX/IAA16 A                                           63.2    5e-10   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                     63.9    5e-10   
gb|EYU34982.1|  hypothetical protein MIMGU_mgv1a018406mg              63.2    5e-10   
ref|XP_004150434.1|  PREDICTED: auxin-induced protein 22B-like        63.5    5e-10   
ref|XP_009335227.1|  PREDICTED: auxin-responsive protein IAA11-like   64.7    5e-10   
ref|XP_002881274.1|  indoleacetic acid-induced protein 13             63.9    5e-10   
ref|XP_003542633.1|  PREDICTED: auxin-responsive protein IAA29-like   63.5    5e-10   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    65.5    5e-10   
ref|XP_010447947.1|  PREDICTED: auxin-responsive protein IAA11        63.9    5e-10   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like   64.7    5e-10   
ref|NP_194593.1|  auxin-responsive protein IAA11                      63.9    5e-10   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                  63.9    5e-10   
gb|AAM20521.1|  early auxin-inducible protein 11                      63.9    5e-10   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16        63.9    5e-10   
ref|XP_011079948.1|  PREDICTED: auxin-induced protein 22D-like        63.5    5e-10   
gb|AAM12952.1|  auxin-regulated protein                               65.1    6e-10   
ref|NP_001266049.1|  IAA9 protein                                     63.9    6e-10   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like   65.1    6e-10   
ref|XP_009132920.1|  PREDICTED: auxin-responsive protein IAA13        63.5    6e-10   
gb|KHN30562.1|  Auxin-induced protein 22B                             63.2    6e-10   
ref|XP_006420092.1|  hypothetical protein CICLE_v10006002mg           63.2    6e-10   
ref|XP_010548738.1|  PREDICTED: auxin-responsive protein IAA11-like   63.5    6e-10   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like   64.3    6e-10   
gb|KJB44871.1|  hypothetical protein B456_007G276900                  63.2    6e-10   
ref|XP_010087759.1|  Auxin-responsive protein IAA4                    63.2    6e-10   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg              65.1    6e-10   
ref|XP_010466600.1|  PREDICTED: auxin-responsive protein IAA2 iso...  63.2    6e-10   
emb|CCQ38177.1|  auxin-responsive protein IAA1                        62.0    6e-10   
gb|KFK31058.1|  hypothetical protein AALP_AA6G062800                  63.5    6e-10   
ref|XP_009129458.1|  PREDICTED: auxin-responsive protein IAA11        64.3    6e-10   
gb|KFK31059.1|  hypothetical protein AALP_AA6G062800                  63.5    6e-10   
ref|XP_010323008.1|  PREDICTED: IAA2 isoform X1                       62.8    7e-10   
ref|XP_010432745.1|  PREDICTED: auxin-responsive protein IAA29-li...  63.5    7e-10   
gb|KJB42200.1|  hypothetical protein B456_007G141900                  63.5    7e-10   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like    65.1    7e-10   
ref|XP_006298679.1|  hypothetical protein CARUB_v10014772mg           62.8    7e-10   
gb|ADB93633.2|  indole-3-acetic acid inducible 16                     62.8    7e-10   
gb|KDP30258.1|  hypothetical protein JCGZ_17040                       63.2    7e-10   
ref|XP_003535418.1|  PREDICTED: auxin-induced protein 22B-like        62.4    7e-10   
ref|XP_002454782.1|  hypothetical protein SORBIDRAFT_04g037260        64.3    7e-10   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like   63.5    7e-10   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like   64.7    7e-10   
gb|ADL70676.1|  indole-3-acetic acid inducible 16                     62.8    7e-10   
gb|AFK47937.1|  unknown                                               62.8    7e-10   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                     62.8    7e-10   
gb|ADB93630.2|  indole-3-acetic acid inducible 16                     62.8    7e-10   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like   64.7    7e-10   
gb|ADB93634.2|  indole-3-acetic acid inducible 16                     62.8    7e-10   
gb|ADL70679.1|  indole-3-acetic acid inducible 16                     62.8    8e-10   
gb|ADB93632.2|  indole-3-acetic acid inducible 16                     62.8    8e-10   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                     62.8    8e-10   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  63.2    8e-10   
ref|XP_010469494.1|  PREDICTED: auxin-responsive protein IAA13 is...  63.5    8e-10   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                     62.8    8e-10   
emb|CAN72026.1|  hypothetical protein VITISV_014421                   63.9    8e-10   
ref|XP_010469495.1|  PREDICTED: auxin-responsive protein IAA13 is...  63.5    8e-10   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                     62.8    8e-10   
gb|ADL70677.1|  indole-3-acetic acid inducible 16                     62.4    8e-10   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...  64.7    8e-10   
gb|ADC29373.1|  indole-3-acetic acid inducible 4                      62.8    8e-10   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                     62.8    8e-10   
ref|XP_007034953.1|  AUX/IAA transcriptional regulator family pro...  62.8    8e-10   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16        63.5    8e-10   
gb|KJB27547.1|  hypothetical protein B456_005G046400                  62.4    8e-10   
ref|XP_010540916.1|  PREDICTED: auxin-responsive protein IAA11        63.2    8e-10   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27        64.3    9e-10   
gb|ADC29369.1|  indole-3-acetic acid inducible 4                      62.8    9e-10   
emb|CDY32934.1|  BnaA09g16590D                                        62.8    9e-10   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                     62.8    9e-10   
gb|AEV89263.1|  IAA9                                                  64.3    9e-10   
ref|XP_010024037.1|  PREDICTED: auxin-induced protein 22D-like        62.8    9e-10   
ref|XP_010509906.1|  PREDICTED: auxin-responsive protein IAA13-li...  63.2    9e-10   
gb|AAQ74955.1|  Gbiaa-Re                                              62.8    9e-10   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative          62.8    9e-10   
ref|XP_010509907.1|  PREDICTED: auxin-responsive protein IAA13-li...  63.2    9e-10   
gb|EEE53551.1|  hypothetical protein OsJ_36765                        62.8    9e-10   
ref|XP_009398378.1|  PREDICTED: auxin-responsive protein IAA4-like    62.8    9e-10   
gb|KJB18140.1|  hypothetical protein B456_003G035700                  64.7    9e-10   
gb|ADL70509.1|  indole-3-acetic acid inducible 4                      62.8    9e-10   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  63.2    9e-10   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                     62.4    9e-10   
ref|XP_002527176.1|  hypothetical protein RCOM_1074570                63.2    9e-10   
ref|NP_001130483.1|  IAA17-auxin-responsive Aux/IAA family member     63.2    9e-10   
ref|NP_199183.1|  auxin-responsive protein IAA4                       62.8    9e-10   
gb|AFK35603.1|  unknown                                               62.0    1e-09   
ref|XP_009339009.1|  PREDICTED: auxin-responsive protein IAA1         62.8    1e-09   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                     62.4    1e-09   
gb|KJB27544.1|  hypothetical protein B456_005G046400                  62.0    1e-09   
ref|XP_007011844.1|  Leucine-rich repeat transmembrane protein ki...  65.5    1e-09   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like    64.3    1e-09   
ref|XP_008377585.1|  PREDICTED: auxin-responsive protein IAA1         62.8    1e-09   
gb|AAP44407.1|  auxin-induced protein 4                               62.8    1e-09   
gb|ABM53873.1|  IAA5                                                  62.0    1e-09   
gb|ADC29372.1|  indole-3-acetic acid inducible 4                      62.4    1e-09   
gb|KCW60452.1|  hypothetical protein EUGRSUZ_H03171                   62.0    1e-09   
gb|ADL70520.1|  indole-3-acetic acid inducible 4                      62.4    1e-09   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17        62.8    1e-09   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                  63.9    1e-09   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg           63.9    1e-09   
gb|ADL70513.1|  indole-3-acetic acid inducible 4                      62.4    1e-09   
emb|CDY15493.1|  BnaA08g27770D                                        62.8    1e-09   
ref|XP_004960656.1|  PREDICTED: auxin-responsive protein IAA17-like   63.2    1e-09   
gb|KJB07754.1|  hypothetical protein B456_001G043900                  62.8    1e-09   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like   62.8    1e-09   
ref|XP_006403206.1|  hypothetical protein EUTSA_v10003276mg           62.4    1e-09   
gb|KJB44873.1|  hypothetical protein B456_007G276900                  63.2    1e-09   
ref|XP_006410469.1|  hypothetical protein EUTSA_v10017143mg           62.8    1e-09   
dbj|BAJ34122.1|  unnamed protein product                              62.8    1e-09   
ref|XP_011082600.1|  PREDICTED: auxin-induced protein 22D-like        62.4    1e-09   
gb|KJB27543.1|  hypothetical protein B456_005G046400                  62.4    1e-09   
ref|NP_001266042.1|  IAA2                                             62.0    1e-09   
ref|XP_010425396.1|  PREDICTED: auxin-responsive protein IAA13-li...  62.8    1e-09   
ref|XP_002865407.1|  indoleacetic acid-induced protein 4              62.4    1e-09   
emb|CDY18214.1|  BnaC05g02370D                                        62.8    1e-09   
gb|ADE62383.1|  IAA1 protein                                          62.0    1e-09   
gb|EYU46511.1|  hypothetical protein MIMGU_mgv1a014434mg              62.4    1e-09   
gb|AFK42559.1|  unknown                                               62.4    1e-09   
sp|A2XB18.2|IAA10_ORYSI  RecName: Full=Auxin-responsive protein I...  63.5    1e-09   
ref|XP_010425397.1|  PREDICTED: auxin-responsive protein IAA13-li...  62.8    1e-09   
ref|XP_010413892.1|  PREDICTED: auxin-responsive protein IAA13-li...  62.8    1e-09   
ref|XP_010413890.1|  PREDICTED: auxin-responsive protein IAA13-li...  62.8    1e-09   
ref|NP_001280944.1|  auxin-induced protein 22D-like                   62.4    1e-09   
emb|CDP03299.1|  unnamed protein product                              63.9    1e-09   
sp|Q0DWF2.2|IAA10_ORYSJ  RecName: Full=Auxin-responsive protein I...  63.5    1e-09   
ref|NP_187124.1|  auxin-responsive protein IAA16                      62.8    1e-09   
ref|XP_010488344.1|  PREDICTED: auxin-responsive protein IAA2-like    62.4    1e-09   
gb|AID21717.1|  auxin-responsive IAA29-like protein                   62.8    1e-09   
gb|EYU17895.1|  hypothetical protein MIMGU_mgv1a014074mg              62.4    1e-09   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        62.8    1e-09   
ref|NP_001048522.1|  Os02g0817600                                     63.2    1e-09   
ref|NP_001266077.1|  IAA15                                            62.8    1e-09   
gb|ADC29407.1|  indole-3-acetic acid inducible 11                     62.4    1e-09   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   62.8    1e-09   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member          62.4    1e-09   
ref|XP_008449289.1|  PREDICTED: auxin-induced protein 22B             62.4    1e-09   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   62.8    1e-09   
gb|ADC29363.1|  indole-3-acetic acid inducible 2                      62.0    1e-09   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...  63.9    1e-09   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    63.9    1e-09   
ref|XP_010481836.1|  PREDICTED: auxin-responsive protein IAA4         62.4    1e-09   
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...  63.5    1e-09   
ref|XP_008372302.1|  PREDICTED: auxin-induced protein 22D-like        62.0    1e-09   
ref|XP_008438589.1|  PREDICTED: auxin-responsive protein IAA4-like    62.4    1e-09   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  62.8    1e-09   
ref|XP_002885542.1|  indoleacetic acid-induced protein 2              62.0    1e-09   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like   63.5    1e-09   
gb|KDP37176.1|  hypothetical protein JCGZ_06232                       62.4    1e-09   
emb|CDY10346.1|  BnaC05g29330D                                        62.0    1e-09   
gb|ADL70491.1|  indole-3-acetic acid inducible 2                      62.0    1e-09   
emb|CDX89832.1|  BnaA10g02500D                                        62.4    1e-09   
emb|CCQ38179.1|  auxin-responsive protein IAA1                        60.8    1e-09   
gb|EPS73542.1|  hypothetical protein M569_01214                       62.0    1e-09   
ref|XP_009145242.1|  PREDICTED: auxin-responsive protein IAA2         62.0    1e-09   
gb|ADL70486.1|  indole-3-acetic acid inducible 2                      62.0    1e-09   
emb|CDY17158.1|  BnaA05g10300D                                        62.4    1e-09   
gb|AAB97164.1|  auxin-responsive protein IAA2                         62.0    1e-09   
emb|CDY19477.1|  BnaC04g11220D                                        62.4    1e-09   
gb|ADL70612.1|  indole-3-acetic acid inducible 11                     62.4    1e-09   
ref|NP_188943.1|  auxin-responsive protein IAA2                       62.0    1e-09   
emb|CDY18205.1|  BnaC05g02280D                                        63.2    1e-09   
ref|NP_001239616.1|  uncharacterized protein LOC100804096             62.0    1e-09   
ref|XP_006656684.1|  PREDICTED: auxin-responsive protein IAA20-like   62.0    1e-09   
emb|CDY10692.1|  BnaA05g16700D                                        62.0    2e-09   
gb|ADW10174.1|  putative auxin-responsive protein IAA1                61.2    2e-09   
gb|ABK24636.1|  unknown                                               64.3    2e-09   
ref|XP_009113982.1|  PREDICTED: auxin-responsive protein IAA4         62.0    2e-09   
ref|XP_010556932.1|  PREDICTED: auxin-responsive protein IAA13-like   62.8    2e-09   
gb|ADL70601.1|  indole-3-acetic acid inducible 11                     62.4    2e-09   
gb|EPS60474.1|  hypothetical protein M569_14329                       62.0    2e-09   
ref|XP_003559829.1|  PREDICTED: auxin-responsive protein IAA13-like   62.4    2e-09   
ref|XP_010483935.1|  PREDICTED: auxin-responsive protein IAA12-like   62.4    2e-09   
gb|ADC29404.2|  indole-3-acetic acid inducible 11                     62.0    2e-09   
ref|XP_006294888.1|  hypothetical protein CARUB_v10023938mg           62.4    2e-09   
ref|XP_009143874.1|  PREDICTED: auxin-responsive protein IAA13        62.4    2e-09   
gb|KHN05056.1|  Auxin-induced protein 22B                             62.0    2e-09   
gb|ADK98260.1|  auxin-responsive protein IAA1                         60.8    2e-09   
gb|KJB18136.1|  hypothetical protein B456_003G035700                  63.9    2e-09   
ref|NP_001241389.1|  uncharacterized protein LOC100783314             63.9    2e-09   
ref|XP_010441995.1|  PREDICTED: auxin-responsive protein IAA4-like    61.2    2e-09   
emb|CDY36883.1|  BnaC08g09640D                                        61.6    2e-09   
gb|KHG05201.1|  Auxin-induced 22D                                     62.0    2e-09   



>gb|KDO61758.1| hypothetical protein CISIN_1g042047mg [Citrus sinensis]
Length=83

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+LSLYNS+E L N LI+MFA YQ  E  K G  Y L Y+DK+G+WL+ GDVPW TF+ 
Sbjct  9    KINLSLYNSFETLANSLIHMFATYQKSE--KRGVRYTLTYQDKEGDWLIAGDVPWQTFIE  66

Query  187  SVHRIEILRSG  219
            SV R+EILR G
Sbjct  67   SVQRLEILRCG  77



>ref|XP_009607066.1| PREDICTED: auxin-responsive protein IAA28-like isoform X2 [Nicotiana 
tomentosiformis]
Length=238

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L LYNSY+VLTN LI MFA+YQ+  C  NG  + LLY+D++G+W++ GDVPW TF
Sbjct  154  GRKINLRLYNSYQVLTNSLIQMFAKYQN--CNDNGTRFTLLYQDREGDWMLAGDVPWQTF  211

Query  181  VGSVHRIEILRSG  219
            + +V RI+ILR+G
Sbjct  212  METVQRIQILRNG  224



>ref|XP_009607065.1| PREDICTED: auxin-responsive protein IAA28-like isoform X1 [Nicotiana 
tomentosiformis]
Length=239

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L LYNSY+VLTN LI MFA+  DQ C  NG  + LLY+D++G+W++ GDVPW TF
Sbjct  154  GRKINLRLYNSYQVLTNSLIQMFAK-SDQNCNDNGTRFTLLYQDREGDWMLAGDVPWQTF  212

Query  181  VGSVHRIEILRSG  219
            + +V RI+ILR+G
Sbjct  213  METVQRIQILRNG  225



>ref|XP_009767739.1| PREDICTED: auxin-responsive protein IAA28-like isoform X2 [Nicotiana 
sylvestris]
Length=226

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L LY+SY+VLTN LI MFA+YQ   C +NG  + LLY+D++G+W++ GDVPW TF
Sbjct  142  GRKINLRLYDSYQVLTNSLIQMFAKYQ--SCDENGTRFTLLYQDREGDWMLAGDVPWQTF  199

Query  181  VGSVHRIEILRSG  219
            + +V RI+ILR+G
Sbjct  200  METVQRIQILRNG  212



>ref|XP_009767738.1| PREDICTED: auxin-responsive protein IAA28-like isoform X1 [Nicotiana 
sylvestris]
Length=227

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L LY+SY+VLTN LI MFA+  DQ C +NG  + LLY+D++G+W++ GDVPW TF
Sbjct  142  GRKINLRLYDSYQVLTNSLIQMFAK-SDQSCDENGTRFTLLYQDREGDWMLAGDVPWQTF  200

Query  181  VGSVHRIEILRSG  219
            + +V RI+ILR+G
Sbjct  201  METVQRIQILRNG  213



>ref|XP_006483377.1| PREDICTED: auxin-responsive protein IAA29-like [Citrus sinensis]
Length=209

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+LSLYNS+E L N LI+MFA YQ  E  K G  Y L Y+DK+G+WL+ GDVPW TF+ 
Sbjct  135  KINLSLYNSFETLANSLIHMFATYQKSE--KRGVRYTLTYQDKEGDWLIAGDVPWQTFIE  192

Query  187  SVHRIEILRSG  219
            SV R+EILR G
Sbjct  193  SVQRLEILRCG  203



>ref|XP_006450408.1| hypothetical protein CICLE_v10009245mg [Citrus clementina]
 gb|ESR63648.1| hypothetical protein CICLE_v10009245mg [Citrus clementina]
Length=258

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+LSLYNS+E L N LI+MFA YQ+ E  K G  Y L Y+DK+G+WL+  DVPW TF+ 
Sbjct  184  KINLSLYNSFETLANSLIHMFATYQEIE--KRGVRYTLTYQDKKGDWLIAEDVPWQTFIE  241

Query  187  SVHRIEILRSG  219
            SV R+EILR G
Sbjct  242  SVQRLEILRCG  252



>ref|XP_006353683.1| PREDICTED: auxin-responsive protein IAA29-like [Solanum tuberosum]
Length=237

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KIDL LYNSY++LTN L+ MF +   + C +N G + LLY+DK+G+W++ GDVPW TF
Sbjct  153  GRKIDLMLYNSYQILTNTLLQMFHKSH-ESCDENDGRFTLLYQDKEGDWMLAGDVPWETF  211

Query  181  VGSVHRIEILRS  216
            + +V RI+ILR+
Sbjct  212  METVQRIQILRN  223



>ref|NP_001266091.1| IAA29 [Solanum lycopersicum]
 gb|AEX00367.1| IAA29 [Solanum lycopersicum]
Length=227

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DL LY+SY++ T +L+ MFARYQ+   GKN   + +LY+D++G+W++ GDVPW TF
Sbjct  156  GRKVDLRLYHSYQLFTQNLLQMFARYQN--SGKNSTRFTILYQDREGDWMLAGDVPWKTF  213

Query  181  VGSVHRIEILRS  216
            V +V RIEI ++
Sbjct  214  VETVQRIEIQKN  225



>ref|XP_010090614.1| Auxin-responsive protein IAA29 [Morus notabilis]
 gb|EXB40150.1| Auxin-responsive protein IAA29 [Morus notabilis]
Length=286

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL+L+NSY  L N LI MF    D +C ++ G Y L Y+DK+G+WL+ GDVPW +F+ 
Sbjct  215  KIDLTLHNSYYSLKNALITMFTNSYDGKCTEDRGSYRLTYQDKEGDWLLAGDVPWKSFIK  274

Query  187  SVHRIEILRSG  219
            SV R+EI R+G
Sbjct  275  SVQRLEIARNG  285



>ref|NP_001266100.1| IAA36 [Solanum lycopersicum]
 gb|AEX00371.1| IAA36 [Solanum lycopersicum]
Length=242

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KIDL LYNSY++LTN L+ MF +   + C +N G + LLY+DK+G+W++ GDVPW TF
Sbjct  155  GRKIDLMLYNSYQILTNTLLQMFNKSH-ESCDENDGRFTLLYQDKEGDWMLAGDVPWETF  213

Query  181  VGSVHRIEIL  210
            + +V RI+IL
Sbjct  214  METVQRIQIL  223



>ref|XP_010437931.1| PREDICTED: auxin-responsive protein IAA29-like isoform X2 [Camelina 
sativa]
Length=207

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
              K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA +++ K+G+WL+ GDVPW  F
Sbjct  128  ARKVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFIFQGKEGDWLLPGDVPWRIF  185

Query  181  VGSVHRIEILR  213
              SVHRI I+R
Sbjct  186  AESVHRISIIR  196



>ref|XP_010437929.1| PREDICTED: auxin-responsive protein IAA29-like isoform X1 [Camelina 
sativa]
 ref|XP_010437930.1| PREDICTED: auxin-responsive protein IAA29-like isoform X1 [Camelina 
sativa]
Length=248

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
              K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA +++ K+G+WL+ GDVPW  F
Sbjct  169  ARKVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFIFQGKEGDWLLPGDVPWRIF  226

Query  181  VGSVHRIEILR  213
              SVHRI I+R
Sbjct  227  AESVHRISIIR  237



>ref|XP_002309635.1| hypothetical protein POPTR_0006s27130g [Populus trichocarpa]
 gb|EEE93158.1| hypothetical protein POPTR_0006s27130g [Populus trichocarpa]
Length=229

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL LYNSY+ LT  LI+MFA+ ++ E  K+   Y+L Y+DK G+WL+ GDVPW TF+ 
Sbjct  160  KIDLRLYNSYQTLTKSLISMFAKCKNLE--KDAARYSLTYQDKDGDWLIAGDVPWQTFME  217

Query  187  SVHRIEILRSG  219
            SV R++I+R+ 
Sbjct  218  SVQRLKIVRNA  228



>emb|CDP13527.1| unnamed protein product [Coffea canephora]
Length=172

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KIDL+L++SY+ LTN ++NMFA+Y++ +  ++ G Y L Y DK+G+WL+ GDVPW  F
Sbjct  101  GRKIDLTLFDSYQALTNAVLNMFAKYRNGD--EDDGPYILSYLDKEGDWLLAGDVPWQIF  158

Query  181  VGSVHRIEILR  213
            V SV RIE+L+
Sbjct  159  VESVQRIELLK  169



>ref|XP_010447414.1| PREDICTED: auxin-responsive protein IAA29-like isoform X2 [Camelina 
sativa]
Length=248

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K+G+WL+ GDVPW  F  
Sbjct  171  KVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFTFQGKEGDWLIPGDVPWRIFAE  228

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  229  SVHRISIIR  237



>ref|XP_006343525.1| PREDICTED: auxin-responsive protein IAA29-like [Solanum tuberosum]
Length=219

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+D+ LY+SY++LT +L+ MF++YQ+   G N   + +LY+D++G+W++ GDVPW TF
Sbjct  148  GRKVDIRLYHSYQLLTQNLLQMFSKYQN--SGNNSTRFTILYQDREGDWMLAGDVPWKTF  205

Query  181  VGSVHRIEILRS  216
            V +V RIEI ++
Sbjct  206  VETVQRIEIQKN  217



>ref|XP_009126250.1| PREDICTED: auxin-responsive protein IAA29 isoform X2 [Brassica 
rapa]
Length=194

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF++YQD  C +    +   ++ K+G+WL+ GDVPW  F  
Sbjct  117  KVDIKLFNSYESLTNSLITMFSQYQD--CDREDTNFKFTFQGKEGDWLLPGDVPWKIFAE  174

Query  187  SVHRIEILR  213
            SVHRI I R
Sbjct  175  SVHRISITR  183



>gb|EYU32350.1| hypothetical protein MIMGU_mgv1a019829mg [Erythranthe guttata]
Length=233

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQD-QECGKNGGGYALLYEDKQGNWLVTGDVPWMT  177
            G KIDLSLY+SY  LT+  I+MF++Y   +E  ++GG Y +LY+DK G+W++ GDVPW  
Sbjct  158  GRKIDLSLYHSYLSLTHAFIHMFSKYTAYKEENRDGGEYRILYQDKDGDWMLAGDVPWER  217

Query  178  FVGSVHRIEILRSGD  222
            FV SV R+EI+   D
Sbjct  218  FVESVRRVEIILRKD  232



>gb|KFK29835.1| hypothetical protein AALP_AA7G185100 [Arabis alpina]
Length=250

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF +Y D+ C +    Y L ++ K G+WL+ GDVPW  FV 
Sbjct  172  KVDIKLFNSYESLTNSLITMFTQY-DEGCDREDTNYRLTFQGKDGDWLLPGDVPWKIFVE  230

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  231  SVHRISIVR  239



>ref|XP_010250166.1| PREDICTED: auxin-responsive protein IAA5-like [Nelumbo nucifera]
Length=235

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGG----GYALLYEDKQGNWLVTGDVP  168
            G KIDLSLY+SY+ LT+ +I+MF +YQ    G   G     Y L+Y+D++G+WL+ GD P
Sbjct  157  GRKIDLSLYSSYQTLTSAVISMFGKYQSSVQGAKSGPEPTSYTLVYQDREGDWLLVGDAP  216

Query  169  WMTFVGSVHRIEIL-RSG  219
            W TF+GSV R++++ RSG
Sbjct  217  WETFIGSVQRMKLIKRSG  234



>ref|XP_006358296.1| PREDICTED: auxin-responsive protein IAA20-like [Solanum tuberosum]
Length=203

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL++SY  LT+ LI+MF + ++     NG  Y L Y+DK+G+WL+ GDVPW TFVG
Sbjct  136  KIDLSLFHSYNTLTDTLISMFGKSKE-----NGDVYELTYQDKEGDWLLAGDVPWRTFVG  190

Query  187  SVHRIEILRSGD  222
            SV R++++R  D
Sbjct  191  SVQRLKLIRDED  202



>ref|XP_009126243.1| PREDICTED: auxin-responsive protein IAA29 isoform X1 [Brassica 
rapa]
 emb|CDX75231.1| BnaA01g04710D [Brassica napus]
Length=231

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF++YQD  C +    +   ++ K+G+WL+ GDVPW  F  
Sbjct  154  KVDIKLFNSYESLTNSLITMFSQYQD--CDREDTNFKFTFQGKEGDWLLPGDVPWKIFAE  211

Query  187  SVHRIEILR  213
            SVHRI I R
Sbjct  212  SVHRISITR  220



>ref|XP_011039729.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Populus euphratica]
Length=902

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL LYNSY+ LT  LI+MFA+ ++ E  K+   Y+L Y+DK G+WLV GDVPW TF+ 
Sbjct  160  KIDLRLYNSYQTLTKSLISMFAKCKNLE--KDAARYSLTYQDKDGDWLVAGDVPWQTFME  217

Query  187  SVHRIEILRSG  219
            SV R++I+R+ 
Sbjct  218  SVQRLKIVRNA  228



>ref|XP_009138073.1| PREDICTED: auxin-responsive protein IAA29-like [Brassica rapa]
 emb|CDY13478.1| BnaA03g51960D [Brassica napus]
Length=243

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LT  LI MF +YQD  C +    Y   ++ K+G+WL+ GDVPW  F  
Sbjct  166  KVDIKLFNSYESLTKSLITMFTQYQD--CDREDTSYKFTFQGKEGDWLLPGDVPWKIFAE  223

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  224  SVHRISIIR  232



>ref|XP_009767450.1| PREDICTED: auxin-responsive protein IAA29-like [Nicotiana sylvestris]
Length=211

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL++SY  LT+ LI MF + ++     NG  Y L Y+DK+G+WL+ GDVPW TFVG
Sbjct  144  KIDLSLFHSYGTLTDTLIAMFGKSKE-----NGDAYELTYQDKEGDWLLAGDVPWRTFVG  198

Query  187  SVHRIEILRSGD  222
            SV R++++R  D
Sbjct  199  SVQRLKLVRDED  210



>gb|KJB55025.1| hypothetical protein B456_009G058600 [Gossypium raimondii]
Length=228

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ LY SY+ LTN LI MFA+  D++C ++   Y L Y+DK+G+WL+ GD+PW  FV 
Sbjct  161  KIDIKLYQSYQSLTNSLITMFAK--DKKCDEDD--YILTYQDKEGDWLIAGDIPWQNFVR  216

Query  187  SVHRIEILRS  216
            SV R+EI+R+
Sbjct  217  SVQRMEIVRN  226



>ref|XP_010656457.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Vitis 
vinifera]
Length=207

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLS ++SY+ LTN LINMF +     C ++   + L Y+D++G+WL+ GDVPW TF+ 
Sbjct  141  KIDLSRHHSYQTLTNTLINMFGK-----CQQDAQSFKLAYQDREGDWLLAGDVPWRTFIQ  195

Query  187  SVHRIEILRSG  219
            SV R++ILR G
Sbjct  196  SVERLKILRIG  206



>gb|KHG13019.1| Auxin-responsive IAA29 -like protein [Gossypium arboreum]
Length=227

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ +Y+SY+ LTN LI MF +  D+EC  N   Y L Y+DK+G+WL+ GD+PW  FV 
Sbjct  160  KIDIKVYHSYQSLTNSLITMFTK--DKEC--NEDDYILTYQDKEGDWLIAGDIPWQNFVR  215

Query  187  SVHRIEILRS  216
            SV R+EI+R+
Sbjct  216  SVQRMEIVRN  225



>emb|CBI28230.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLS ++SY+ LTN LINMF +     C ++   + L Y+D++G+WL+ GDVPW TF+ 
Sbjct  118  KIDLSRHHSYQTLTNTLINMFGK-----CQQDAQSFKLAYQDREGDWLLAGDVPWRTFIQ  172

Query  187  SVHRIEILRSG  219
            SV R++ILR G
Sbjct  173  SVERLKILRIG  183



>ref|XP_002285354.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Vitis 
vinifera]
Length=224

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLS ++SY+ LTN LINMF +     C ++   + L Y+D++G+WL+ GDVPW TF+ 
Sbjct  158  KIDLSRHHSYQTLTNTLINMFGK-----CQQDAQSFKLAYQDREGDWLLAGDVPWRTFIQ  212

Query  187  SVHRIEILRSG  219
            SV R++ILR G
Sbjct  213  SVERLKILRIG  223



>ref|XP_006577839.1| PREDICTED: uncharacterized protein LOC100802759 isoform X1 [Glycine 
max]
 gb|KHN08138.1| Auxin-responsive protein IAA29 [Glycine soja]
Length=226

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L L+NSY+ LT+ LI+MFA+YQ  E  + G  Y L ++++QG WL  G VPW +F
Sbjct  152  GRKINLRLFNSYQTLTSSLISMFAKYQKFE--EVGESYTLTFQNEQGEWLQVGHVPWQSF  209

Query  181  VGSVHRIEILRSGD  222
            +G+V R+ ILR+G 
Sbjct  210  IGTVRRLVILRNGS  223



>ref|XP_010041196.1| PREDICTED: auxin-responsive protein IAA29-like [Eucalyptus grandis]
 gb|KCW44557.1| hypothetical protein EUGRSUZ_L01933 [Eucalyptus grandis]
Length=85

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+L  Y SY  L   LI MF+RY +++  K+   Y L Y+DK+G+WL+ GD+PW+ FV 
Sbjct  15   KINLRTYRSYNSLKGALIAMFSRY-NRDDFKDHASYTLTYQDKEGDWLLAGDLPWLNFVE  73

Query  187  SVHRIEILRSGD  222
            SVHR++I RS D
Sbjct  74   SVHRLQIQRSRD  85



>emb|CDX72351.1| BnaC07g43730D [Brassica napus]
Length=247

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
              K+D+ L+NSYE LTN LI MF +YQ+  C +    Y   ++ K+G+WL+ GDVPW  F
Sbjct  168  ARKVDIKLFNSYESLTNFLITMFTQYQN--CDREDTSYKFTFQGKEGDWLLLGDVPWKIF  225

Query  181  VGSVHRIEILR  213
              SVHRI I+R
Sbjct  226  AESVHRISIIR  236



>ref|XP_010432746.1| PREDICTED: auxin-responsive protein IAA29-like isoform X2 [Camelina 
sativa]
Length=247

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K+G+WL+ GD PW  F  
Sbjct  170  KVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFTFQGKEGDWLLPGDFPWRIFSE  227

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  228  SVHRISIIR  236



>gb|KHN07071.1| Auxin-responsive protein IAA29 [Glycine soja]
Length=227

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G KI+L L+NSY+ LT+ LI+MFA+YQ  E  + G  Y L ++++QG+WL  G VPW +F
Sbjct  153  GRKINLRLFNSYQTLTSSLISMFAKYQKFE--EVGESYTLNFQNEQGDWLQVGHVPWQSF  210

Query  181  VGSVHRIEILRSGD  222
            +G+V R+ ILR+G 
Sbjct  211  IGTVRRLVILRNGS  224



>ref|XP_009623727.1| PREDICTED: auxin-responsive protein IAA29-like [Nicotiana tomentosiformis]
Length=228

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K++L LY+SY+VL +DL+ MFA+Y + +   +   + +LY+DK G+W++ GDVPW TF
Sbjct  156  GRKVNLRLYDSYQVLAHDLVQMFAKYLNLD-DNHSTRFMILYQDKDGDWMLAGDVPWQTF  214

Query  181  VGSVHRIEILRS  216
              SV RIEILR+
Sbjct  215  RESVQRIEILRN  226



>emb|CDX68829.1| BnaC01g06240D [Brassica napus]
Length=228

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L++SYE LTN LI MF++YQD  C +    +   ++ K+G+WL+ GD PW  F  
Sbjct  151  KVDIKLFDSYESLTNSLITMFSQYQD--CDREDTNFKFTFQGKEGDWLLPGDAPWKIFAE  208

Query  187  SVHRIEILR  213
            SVHRI I R
Sbjct  209  SVHRISITR  217



>ref|XP_004501338.1| PREDICTED: auxin-responsive protein IAA29-like [Cicer arietinum]
Length=211

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G +I+L LYNSY+ LT+ LI+MF + Q+ E  ++G  Y L ++ KQG+W++TG +PW +F
Sbjct  140  GRQINLRLYNSYQTLTDSLISMFVKCQNFE--EDGSNYTLTFQTKQGDWMLTGHIPWQSF  197

Query  181  VGSVHRIEILRS  216
            +G+V R+ ILR+
Sbjct  198  IGTVRRLAILRN  209



>ref|XP_010648672.1| PREDICTED: auxin-responsive protein IAA28 [Vitis vinifera]
 emb|CBI21052.3| unnamed protein product [Vitis vinifera]
Length=227

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+L LY SY++L N L  MFAR +  +C  +   Y L Y+DK+G+WL+ GDVPW TF+ 
Sbjct  158  KINLKLYQSYQMLKNSLTAMFARCK--KCDVDCVHYTLTYQDKEGDWLLAGDVPWRTFIE  215

Query  187  SVHRIEILRSG  219
            SV R+E++R+G
Sbjct  216  SVQRLELVRNG  226



>gb|AAK55727.1|AF380646_1 AT4g32280/F10M6_80 [Arabidopsis thaliana]
 gb|AAL06798.1| AT4g32280/F10M6_80 [Arabidopsis thaliana]
Length=194

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  117  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  174

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  175  SVHRISIIR  183



>ref|XP_006284419.1| hypothetical protein CARUB_v10005589mg [Capsella rubella]
 gb|EOA17317.1| hypothetical protein CARUB_v10005589mg [Capsella rubella]
Length=207

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K G+WL+ GDVPW  F  
Sbjct  130  KVDIKLFNSYESLTDSLIAMFTQYED--CDREDTNYAFTFQGKDGDWLLPGDVPWRIFAE  187

Query  187  SVHRIEILR  213
            SV+RI I+R
Sbjct  188  SVNRISIIR  196



>gb|ADB93671.2| indole-3-acetic acid inducible 29 [Arabidopsis thaliana]
Length=218

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  150  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  207

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  208  SVHRISIIR  216



>ref|NP_001280821.1| auxin-responsive protein IAA29-like [Malus domestica]
 gb|ADL36589.1| ARF domain class transcription factor [Malus domestica]
Length=243

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID++L++S++ L + LI MF++ + +E G     Y L+Y+DKQG+WL+  DVPW TF+ 
Sbjct  173  KIDINLHHSFQSLRDTLITMFSKCKSKEGGA-AADYILIYQDKQGDWLLAADVPWQTFIE  231

Query  187  SVHRIEILRSG  219
            SV R++I+R+G
Sbjct  232  SVQRLQIVRNG  242



>gb|ADL70778.1| indole-3-acetic acid inducible 29 [Arabidopsis thaliana]
Length=235

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  168  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  225

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  226  SVHRISIIR  234



>gb|ADB93673.2| indole-3-acetic acid inducible 29 [Arabidopsis thaliana]
Length=242

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  174  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  231

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  232  SVHRISIIR  240



>gb|ADL70783.1| indole-3-acetic acid inducible 29 [Arabidopsis thaliana]
Length=242

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  174  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  231

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  232  SVHRISIIR  240



>ref|NP_567891.1| auxin-responsive protein IAA29 [Arabidopsis thaliana]
 sp|Q93WC4.2|IAA29_ARATH RecName: Full=Auxin-responsive protein IAA29; AltName: Full=Indoleacetic 
acid-induced protein 29 [Arabidopsis thaliana]
 gb|AAT67084.1| IAA29 [Arabidopsis thaliana]
 dbj|BAF01529.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30553.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30554.1| hypothetical protein, partial [Arabidopsis thaliana]
 gb|AEE86032.1| auxin-responsive protein IAA29 [Arabidopsis thaliana]
Length=251

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF  Y+D  C +    Y   ++ K+G+WL+ GDV W  F  
Sbjct  174  KVDIKLFNSYESLTNSLITMFTEYED--CDREDTNYTFTFQGKEGDWLLRGDVTWKIFAE  231

Query  187  SVHRIEILR  213
            SVHRI I+R
Sbjct  232  SVHRISIIR  240



>ref|XP_010048188.1| PREDICTED: auxin-induced protein 22D [Eucalyptus grandis]
 gb|KCW80372.1| hypothetical protein EUGRSUZ_C01734 [Eucalyptus grandis]
Length=216

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KI+L  Y SY  L   LI MF+RY +++  K+   Y L Y+DK+G+WL+ GD+PW+ FV 
Sbjct  146  KINLRTYRSYNSLKGALIAMFSRY-NRDDFKDHASYTLTYQDKEGDWLLAGDLPWLNFVE  204

Query  187  SVHRIEILRSGD  222
            SVHR++I RS D
Sbjct  205  SVHRLQIQRSRD  216



>ref|XP_006284420.1| hypothetical protein CARUB_v10005589mg [Capsella rubella]
 gb|EOA17318.1| hypothetical protein CARUB_v10005589mg [Capsella rubella]
Length=249

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K G+WL+ GDVPW  F  
Sbjct  172  KVDIKLFNSYESLTDSLIAMFTQYED--CDREDTNYAFTFQGKDGDWLLPGDVPWRIFAE  229

Query  187  SVHRIEILR  213
            SV+RI I+R
Sbjct  230  SVNRISIIR  238



>ref|NP_001266098.1| IAA35 [Solanum lycopersicum]
 gb|AEX00370.1| IAA35 [Solanum lycopersicum]
Length=196

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL+L++SY  LT+ LI+MF + ++      G  Y L Y+DK+G+WL+ GDVPW TFVG
Sbjct  129  KIDLTLFHSYNKLTDTLISMFGKNKEI-----GDVYKLTYQDKEGDWLLAGDVPWRTFVG  183

Query  187  SVHRIEILRSGD  222
            SV R++++R  D
Sbjct  184  SVQRLKLIRDED  195



>ref|XP_010241552.1| PREDICTED: auxin-responsive protein IAA28-like [Nelumbo nucifera]
Length=234

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQ----DQECGKNGGGYALLYEDKQGNWLVTGDVP  168
            G K+DLSL++SY  LTN L++MF + Q    + + G     Y L+Y+D++G+WL+ GDVP
Sbjct  157  GRKVDLSLHSSYGTLTNTLLSMFGKCQRSLPESKAGTGHERYTLVYQDREGDWLLVGDVP  216

Query  169  WMTFVGSVHRIEILRSG  219
            W +F+ SV R+++L++G
Sbjct  217  WESFIVSVQRLKLLKNG  233



>ref|XP_009797130.1| PREDICTED: auxin-responsive protein IAA29-like [Nicotiana sylvestris]
Length=228

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K++L LY+SY+VL ++LI MFA+Y +     +   + +LY+DK G+W++ GDVPW TF
Sbjct  157  GRKVNLMLYDSYQVLNHNLIQMFAKYLN--LDNHTTCFTILYQDKDGDWMLAGDVPWQTF  214

Query  181  VGSVHRIEILRS  216
            + SV RIEI R+
Sbjct  215  MESVQRIEIQRN  226



>ref|XP_006412496.1| hypothetical protein EUTSA_v10027347mg [Eutrema salsugineum]
 gb|ESQ53949.1| hypothetical protein EUTSA_v10027347mg [Eutrema salsugineum]
Length=247

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+D+ L+NSYE LTN LI MF++++   C +    Y   ++ K G+WL+ GDVPW  F  
Sbjct  170  KVDIKLFNSYESLTNSLITMFSQFEG--CDREDTNYKFTFQGKDGDWLLPGDVPWKIFAE  227

Query  187  SVHRIEILR  213
            SVHRI I++
Sbjct  228  SVHRISIIK  236



>ref|XP_011459850.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Fragaria vesca subsp. vesca]
Length=930

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ L++SY+ L + LI MFA+ ++ E  ++   + + Y+D  G+WL+ GDVPW TFVG
Sbjct  165  KIDIKLHHSYQTLRDSLITMFAKCKECE-NEDTADFTVTYQDMHGHWLLAGDVPWQTFVG  223

Query  187  SVHRIEILRSG  219
            SV R+EI+R+G
Sbjct  224  SVQRLEIIRNG  234



>ref|XP_008466417.1| PREDICTED: auxin-responsive protein IAA28 [Cucumis melo]
 ref|XP_008466418.1| PREDICTED: auxin-responsive protein IAA28 [Cucumis melo]
Length=235

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ +YNSY+ L   LI+MF+    Q+CG +     L Y+DK+G+WL+ GD+PW  FV 
Sbjct  162  KIDVGMYNSYQTLKTALIDMFSDSCYQKCGNSNASLTLTYQDKEGDWLLAGDIPWQIFVE  221

Query  187  SVHRIEILR  213
            SV  ++I+R
Sbjct  222  SVQCMKIIR  230



>ref|XP_009608871.1| PREDICTED: auxin-responsive protein IAA20-like [Nicotiana tomentosiformis]
Length=212

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL+ SY  LT+ LI MF + ++     NG  Y L Y+D +G+WL+ GDVPW TFV 
Sbjct  145  KIDLSLFQSYGTLTDTLIAMFGKSKE-----NGDTYELTYQDNEGDWLLAGDVPWRTFVV  199

Query  187  SVHRIEILRSGD  222
            SV R++++R  D
Sbjct  200  SVQRLKLVRDED  211



>ref|XP_004136353.1| PREDICTED: auxin-responsive protein IAA29-like [Cucumis sativus]
 gb|KGN60094.1| hypothetical protein Csa_3G877650 [Cucumis sativus]
Length=234

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ +YNSY+ L    INMF+    Q+CG +     L Y+DK+G+WL+ GD+PW  FV 
Sbjct  161  KIDVGMYNSYQTLKTASINMFSDSCYQKCGNSNASLTLTYQDKEGDWLLAGDLPWQNFVE  220

Query  187  SVHRIEILR  213
            SV  ++I+R
Sbjct  221  SVQCMKIIR  229



>ref|XP_004167111.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
Length=234

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+ +YNSY+ L    INMF+    Q+CG +     L Y+DK+G+WL+ GD+PW  FV 
Sbjct  161  KIDVGMYNSYQTLKTASINMFSDSCYQKCGNSNASLTLTYQDKEGDWLLAGDLPWQNFVE  220

Query  187  SVHRIEILR  213
            SV  ++I+R
Sbjct  221  SVQCMKIIR  229



>ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46953.1| ATP binding protein, putative [Ricinus communis]
Length=895

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQ--DQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            KIDL L++SY+ LTN LI+MF + +  D +   N   Y L Y+DK G+WL+ GDVPW TF
Sbjct  161  KIDLRLFHSYQTLTNFLISMFGKCEKGDDDSTTN---YTLTYQDKDGDWLLAGDVPWQTF  217

Query  181  VGSVHRIEILRSG  219
            + SV R+E++R+G
Sbjct  218  MESVQRLELVRNG  230



>ref|XP_003603373.1| Auxin-responsive protein IAA10 [Medicago truncatula]
 gb|AES73624.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=213

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G +I+L LYNSY+ L + LI+MF + Q+ E  + G  Y L +++KQG W +T  + W +F
Sbjct  138  GRQINLRLYNSYQTLKDSLISMFVKCQNFE--ETGANYTLTFQNKQGEWKLTSHITWQSF  195

Query  181  VGSVHRIEILRSGD  222
            +G+V R+ ILR+G+
Sbjct  196  IGTVRRLAILRNGE  209



>ref|XP_009774736.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=290

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL++YNSY VL++ L  MF+ ++D +CG                   +G  Y L YED
Sbjct  186  KVDLTIYNSYNVLSSALEKMFSCFKDGQCGTQGISSSDGLNESKLVDLLHGSEYVLTYED  245

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F  S  ++ I++S D
Sbjct  246  KDGDWMLVGDVPWRMFTESCKKLRIMKSSD  275



>ref|XP_008337261.1| PREDICTED: auxin-responsive protein IAA20-like [Malus domestica]
Length=250

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL+ S++ LT+ L++MF +     C  +   Y L Y+D++G+WL+  DVPW +F+ 
Sbjct  184  KIDLSLHQSFQTLTDTLMDMFDK-----CQMDSNNYKLTYQDREGDWLLAQDVPWRSFIR  238

Query  187  SVHRIEILRSGD  222
            SV R+ +L+  D
Sbjct  239  SVQRLNLLKRSD  250



>ref|XP_006475894.1| PREDICTED: auxin-responsive protein IAA29-like [Citrus sinensis]
 gb|KDO80168.1| hypothetical protein CISIN_1g023769mg [Citrus sinensis]
Length=259

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL+LY+S+E LTN LI MF  + +     +   Y L Y+D++G+WL+  DVPW TF+ 
Sbjct  193  KIDLTLYDSFETLTNTLIGMFGLWLE-----DSYDYQLTYQDREGDWLIAKDVPWRTFIQ  247

Query  187  SVHRIEILRSG  219
            +V R+ + RSG
Sbjct  248  TVQRLNLSRSG  258



>ref|XP_010112480.1| Auxin-responsive protein IAA29 [Morus notabilis]
 gb|EXC33724.1| Auxin-responsive protein IAA29 [Morus notabilis]
Length=229

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL++ +  LT+ L++MF +     C ++ G + L Y+D++G+WL+  DVPW TF+ 
Sbjct  164  KIDLSLHSCFGTLTDTLMDMFGK-----CQEDSGNHKLTYQDREGDWLLAQDVPWRTFIR  218

Query  187  SVHRIEILR  213
            SV R+++LR
Sbjct  219  SVQRLKLLR  227



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------NGGGYALLYEDKQGNWLVT  156
            K+D+ LY SY+ L++ L  MF+ +  ++CG           NG  Y   YEDK G+W++ 
Sbjct  130  KVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETNGSDYVPTYEDKDGDWMLV  189

Query  157  GDVPWMTFVGSVHRIEILR  213
            GDVPW  FV S  R+ I++
Sbjct  190  GDVPWEMFVESCKRLRIMK  208



>ref|XP_009363994.1| PREDICTED: auxin-responsive protein IAA29 [Pyrus x bretschneideri]
Length=249

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL+ S++ LT  L++MF +     C  +   Y L Y+D++G+WL+  DVPW +F+ 
Sbjct  183  KIDLSLHQSFQTLTETLMDMFDK-----CQMDSNNYKLTYQDREGDWLLAQDVPWRSFIR  237

Query  187  SVHRIEILRSGD  222
            SV R+++++  D
Sbjct  238  SVQRLKLVKRSD  249



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------NGGGYALLYEDKQGNWLVT  156
            K+D+ LY SY+ L++ L  MF+ +  ++CG           NG  Y   YEDK G+W++ 
Sbjct  130  KVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETNGSDYVPTYEDKDGDWMLV  189

Query  157  GDVPWMTFVGSVHRIEILR  213
            GDVPW  FV S  R+ I++
Sbjct  190  GDVPWEMFVESCKRLRIMK  208



>gb|KDP21371.1| hypothetical protein JCGZ_21842 [Jatropha curcas]
Length=197

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  116  KIDLKMYKSYPELLKALENMFKLTIGEYSERE-GYNGSNYAPTYEDKDGDWMLVGDVPWE  174

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I+R
Sbjct  175  MFICSCKRLRIMR  187



>ref|XP_007204725.1| hypothetical protein PRUPE_ppa010871mg [Prunus persica]
 gb|EMJ05924.1| hypothetical protein PRUPE_ppa010871mg [Prunus persica]
Length=232

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 5/74 (7%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
              KIDLSL++S+  L + L++MF      +C  +   Y L Y+D++G+WL+  DVPW TF
Sbjct  164  ARKIDLSLHHSFRTLADTLMDMF-----DKCQMDSNNYKLTYQDREGDWLLARDVPWRTF  218

Query  181  VGSVHRIEILRSGD  222
            + SV R+++++  D
Sbjct  219  IRSVQRLKLVKKSD  232



>ref|XP_010687936.1| PREDICTED: auxin-responsive protein IAA29 [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL LY+SYE L + L+ MF + +D     +   Y L Y+D  G+WL+ GDVPW TF+ 
Sbjct  198  KIDLKLYHSYEALISSLLTMFNKEED-----SVDDYKLTYQDSDGDWLLAGDVPWRTFIQ  252

Query  187  SVHRIEILRSGD  222
            SV R+++ R  D
Sbjct  253  SVQRLKLRRRDD  264



>ref|XP_007223809.1| hypothetical protein PRUPE_ppa010683mg [Prunus persica]
 gb|EMJ25008.1| hypothetical protein PRUPE_ppa010683mg [Prunus persica]
Length=240

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA---RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMT  177
            KID+  ++SY+ L + LI MF+   R   +E G  G  Y L Y+DKQG+WL+  DVPW T
Sbjct  166  KIDIRPHHSYQTLKDTLITMFSKCKRSGGKEGGGAGAEYILAYQDKQGDWLLVADVPWQT  225

Query  178  FVGSVHRIEILRSG  219
            F+ SV R++ILR G
Sbjct  226  FIKSVQRLQILRKG  239



>ref|XP_011017813.1| PREDICTED: auxin-induced protein 22D-like isoform X1 [Populus 
euphratica]
Length=234

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+SL++S+  L   L++MF       C +N   Y L Y+D++G+WL+  DVPW  F+G
Sbjct  168  KIDVSLHHSFPALKQTLLDMFGI-----CQENSSSYRLTYQDREGDWLLAEDVPWRNFLG  222

Query  187  SVHRIEILR  213
            +VHR++++R
Sbjct  223  TVHRLKLMR  231



>ref|XP_011017814.1| PREDICTED: auxin-responsive protein IAA29-like isoform X2 [Populus 
euphratica]
Length=233

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+SL++S+  L   L++MF       C +N   Y L Y+D++G+WL+  DVPW  F+G
Sbjct  167  KIDVSLHHSFPALKQTLLDMFGI-----CQENSSSYRLTYQDREGDWLLAEDVPWRNFLG  221

Query  187  SVHRIEILR  213
            +VHR++++R
Sbjct  222  TVHRLKLMR  230



>ref|XP_008451269.1| PREDICTED: auxin-induced protein 22D-like [Cucumis melo]
Length=197

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFAR----YQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL++Y SY  L   L NMF      Y ++E   NG  YA  YEDK G+W++ GDVPW 
Sbjct  115  KIDLTIYKSYTELVKALENMFKFNLGGYSEKEGFNNGSDYAPTYEDKDGDWMLVGDVPWE  174

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  175  MFISSCKRLRIMK  187



>ref|XP_002281696.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera]
 emb|CBI17931.3| unnamed protein product [Vitis vinifera]
Length=186

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L N L NMF      Y ++E G NG  Y   YEDK G+W++ GDVPW 
Sbjct  112  KIDLKVYKSYPELLNALENMFKFRIGEYSERE-GYNGSDYTPAYEDKDGDWMLVGDVPWE  170

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  171  MFISSCKRLRIMK  183



>ref|XP_006443922.1| hypothetical protein CICLE_v10022370mg [Citrus clementina]
 ref|XP_006479599.1| PREDICTED: auxin-induced protein 22D-like [Citrus sinensis]
 gb|ESR57162.1| hypothetical protein CICLE_v10022370mg [Citrus clementina]
Length=194

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y  L N L NMF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  113  KIDLKVYTCYPELLNALENMFQLTIGKYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWD  171

Query  175  TFVGSVHRIEILR  213
             F+ +  R+ I+R
Sbjct  172  MFITTCKRLRIMR  184



>gb|KHN18839.1| Auxin-induced protein 22D [Glycine soja]
Length=202

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  121  KIDLKVYKSYPELLKALENMFKCTFGQYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  179

Query  175  TFVGSVHRIEILR  213
             FV S  R+ I++
Sbjct  180  MFVSSCKRLRIMK  192



>gb|EPS72934.1| hypothetical protein M569_01824, partial [Genlisea aurea]
Length=139

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DL  +NSY  L   L  MF      E  +  G + L YEDK G+W++ GDVPW  F
Sbjct  65   GRKVDLKAHNSYVCLARSLDQMFQSSLFPEERRLSGDFVLAYEDKDGDWMLVGDVPWHMF  124

Query  181  VGSVHRIEILRSGD  222
            + S  R+ I+RS +
Sbjct  125  LNSARRLRIMRSAE  138



>ref|XP_008786091.1| PREDICTED: auxin-induced protein 22D-like [Phoenix dactylifera]
Length=196

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQEC----GKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL LY  YE L   L NMF  +   E     G NG  YA+ YEDK G+W++ GDVPW 
Sbjct  113  KIDLKLYKGYEELREALDNMFRCFSIGELSGMEGCNGPEYAITYEDKDGDWMLVGDVPWE  172

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  173  MFISSCKRLRIMKGAE  188



>gb|KHN03839.1| Auxin-induced protein 22D [Glycine soja]
Length=197

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL++Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  116  KIDLNVYKSYPELLKALGNMFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  174

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I+++ +
Sbjct  175  MFVSSCKRLRIMKASE  190



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  149  KVDLKLYKSYQELSDALAKMFSSFTIGNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKD  208

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FVGS  R+ I++
Sbjct  209  GDWMLVGDVPWEMFVGSCKRLRIMK  233



>ref|XP_002308067.2| hypothetical protein POPTR_0006s06550g [Populus trichocarpa]
 gb|EEE91590.2| hypothetical protein POPTR_0006s06550g [Populus trichocarpa]
Length=229

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+S+Y  +  L + L++MF       C +N   Y L Y+D++G+WL+  DVPW  F+G
Sbjct  163  KIDVSVYRCFPTLKHTLLDMFG-----ICQENSSNYRLTYQDREGDWLLAEDVPWRNFLG  217

Query  187  SVHRIEILRSGD  222
            SV R++++RS +
Sbjct  218  SVQRLKLMRSSN  229



>ref|XP_010923480.1| PREDICTED: auxin-induced protein 22D-like [Elaeis guineensis]
Length=196

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQEC----GKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y+ L   L NMF  +   E     G NG  YA+ YEDK G+W++ GDVPW 
Sbjct  113  KIDLKVYKGYKELREALDNMFRCFSTGELSGMEGCNGSEYAITYEDKDGDWMLVGDVPWE  172

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I+R  +
Sbjct  173  MFISSCKRLRIMRRSE  188



>sp|O24542.1|AX22D_VIGRR RecName: Full=Auxin-induced protein 22D; AltName: Full=Indole-3-acetic 
acid-induced protein ARG13 [Vigna radiata var. radiata]
 dbj|BAA20848.1| Aux22d [Vigna radiata]
Length=193

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  112  KIDLKVYKSYPELLKALENMFKCIFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  170

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I++  +
Sbjct  171  MFVSSCKRLRIMKGSE  186



>ref|NP_001242395.1| uncharacterized protein LOC100799875 [Glycine max]
 gb|ACU18630.1| unknown [Glycine max]
Length=197

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL++Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  116  KIDLNVYKSYPELLKALGNMFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  174

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I+++ +
Sbjct  175  MFVSSCKRLRIMKASE  190



>ref|NP_001242729.1| uncharacterized protein LOC100780752 [Glycine max]
 gb|ACU18346.1| unknown [Glycine max]
Length=202

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  121  KIDLKVYKSYPELLKALENMFKCTFGQYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  179

Query  175  TFVGSVHRIEILR  213
             FV S  R+ I++
Sbjct  180  MFVSSCKRLRIMK  192



>ref|XP_006450872.1| hypothetical protein CICLE_v10008935mg [Citrus clementina]
 gb|ESR64112.1| hypothetical protein CICLE_v10008935mg [Citrus clementina]
Length=321

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL+LY+S+E LTN LI+MF  + +     +   Y L Y+D++G+WL+  DVPW TF+ 
Sbjct  255  KIDLTLYDSFETLTNTLISMFGLWLE-----DSYDYQLTYQDREGDWLIAKDVPWRTFIQ  309

Query  187  SVHRIEILRSG  219
            +V R+ + RS 
Sbjct  310  TVQRLNLSRSS  320



>ref|XP_008219507.1| PREDICTED: auxin-responsive protein IAA29 [Prunus mume]
Length=237

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--YALLYEDKQGNWLVTGDVPWM  174
            G KID+  ++ Y+ L + LI MF++ +     + G G  Y L Y+DKQG WL+  DVPW 
Sbjct  162  GRKIDMRPHHCYQTLKDTLITMFSKCKRSGGKEGGAGAEYILAYQDKQGAWLLVADVPWQ  221

Query  175  TFVGSVHRIEILRSG  219
            TF+ SV R++ILR+G
Sbjct  222  TFIKSVQRLQILRNG  236



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+DL  Y +Y+ L++ L  MF+ +   +CG  G    L YEDK G+W++ GDVPW  F+ 
Sbjct  218  KVDLRSYATYQELSSALEKMFSCFTIGQCGAQGTENVLTYEDKDGDWMLVGDVPWEMFIA  277

Query  187  SVHRIEILRSGD  222
            S  R++I++  D
Sbjct  278  SCKRLKIMKGSD  289



>ref|XP_011078390.1| PREDICTED: auxin-responsive protein IAA28-like [Sesamum indicum]
Length=207

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DLS + SY+ L   LI MF +     C  N   Y L Y+DK G+W++ GDVPW TF
Sbjct  139  GRKVDLSSHRSYQTLIAKLIAMFGK-----CEDNVETYKLTYQDKDGDWVLAGDVPWETF  193

Query  181  VGSVHRIEILRSG  219
            V S  R+++ ++G
Sbjct  194  VHSAQRLKLQKNG  206



>ref|XP_006604480.1| PREDICTED: auxin-induced protein 22E-like [Glycine max]
 gb|KHN02538.1| Auxin-induced protein 22E [Glycine soja]
Length=204

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +YNSY  L   L N+F      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  123  KIDLKVYNSYPELLMALQNLFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  181

Query  175  TFVGSVHRIEILR  213
             FV S  R++I++
Sbjct  182  MFVSSCKRLKIIK  194



>ref|XP_011020165.1| PREDICTED: auxin-responsive protein IAA29-like [Populus euphratica]
Length=233

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KID+SLY  +  L + +++MF       C +N   Y L Y+D++G+WL+  DVPW  F+G
Sbjct  167  KIDVSLYRCFPTLKHAVLDMFGI-----CQENSSNYRLTYQDREGDWLLAEDVPWRNFLG  221

Query  187  SVHRIEILRSGD  222
            SV R++++RS +
Sbjct  222  SVQRLKLMRSSN  233



>ref|XP_009764468.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana sylvestris]
Length=193

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +YNSY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  112  KIDLKVYNSYPELLKALQNMFKCTIGVYTERE-GYNGSDYAPTYEDKDGDWMLVGDVPWD  170

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  171  MFLNSCRRLRIMK  183



>ref|XP_002520979.1| Auxin-induced protein 22E, putative [Ricinus communis]
 gb|EEF41396.1| Auxin-induced protein 22E, putative [Ricinus communis]
Length=196

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KID+ +YNSY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  115  KIDIKVYNSYPELLKALENMFKLKIGEYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWG  173

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  174  MFISSCKRLRIVK  186



>ref|XP_006349740.1| PREDICTED: auxin-induced protein 22D-like [Solanum tuberosum]
Length=183

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY+ L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  102  KIDLKVYKSYQELLKALQNMFKCTIGVYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  160

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  161  MFISSCKRLRIIK  173



>gb|AAD32145.1|AF123507_1 Nt-iaa4.5 deduced protein [Nicotiana tabacum]
Length=195

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +YNSY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  112  KIDLKVYNSYPELLKALQNMFKCTIGVYTERE-GYNGSDYAPTYEDKDGDWMLVGDVPWD  170

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  171  MFLNSCRRLRIMK  183



>ref|XP_008362893.1| PREDICTED: auxin-responsive protein IAA29-like [Malus domestica]
Length=244

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDLSL+ S++ LT+ L++MF +     C  +   Y L Y+D+ G+WL+  DVPW +F+ 
Sbjct  175  KIDLSLHQSFQTLTDSLMDMFDK-----CQMDSNNYKLTYQDRDGDWLLAQDVPWRSFIR  229

Query  187  SVHRIEILR  213
            SV R+++++
Sbjct  230  SVQRLKLVK  238



>ref|XP_007050424.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOX94581.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=406

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  325  KIDLKVYRSYAGLLKALENMFKLTVGAYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  383

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  384  MFISSCKRLRIMKGSE  399



>ref|XP_006355888.1| PREDICTED: auxin-responsive protein IAA13-like [Solanum tuberosum]
Length=322

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 21/95 (22%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG---------------------YA  117
            G K+DL+ ++SYE L   L NMF R     C ++                        + 
Sbjct  205  GRKVDLNAHSSYENLARTLDNMFLRPSTTVCARSSNAQELGVMSETAFSSRLLDGSSEFV  264

Query  118  LLYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            L YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  265  LTYEDKEGDWMLVGDVPWEMFISSVKRLRIMRTSD  299



>dbj|BAJ85337.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNG----------GGYALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C  NG            Y + YED+ G+W+
Sbjct  171  GRKVDLNAHRSYKTLALALEIMFTKPSAGLCASNGTKSLKLLDNSSEYQMTYEDRDGDWM  230

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  231  LVGDVPWEMFVGSVKRLRIMRTSD  254



>ref|XP_009786590.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana sylvestris]
Length=177

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL+LY SY  L   L NMF      Y ++E G NG  Y   YEDK G+W++ GDVPW 
Sbjct  96   KIDLNLYKSYSQLLEALENMFKCSIGVYSERE-GYNGSDYVPTYEDKDGDWMLAGDVPWD  154

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  D
Sbjct  155  MFINSCKRLRIMKGSD  170



>ref|XP_007144687.1| hypothetical protein PHAVU_007G176700g [Phaseolus vulgaris]
 gb|ESW16681.1| hypothetical protein PHAVU_007G176700g [Phaseolus vulgaris]
Length=196

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  115  KIDLRVYQSYPQLLKALENMFKCIFGEYSERE-GYNGSEHAPTYEDKDGDWMLVGDVPWH  173

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I++  +
Sbjct  174  MFVSSCKRLRIMKGSE  189



>gb|KFK29404.1| hypothetical protein AALP_AA7G129700 [Arabis alpina]
Length=248

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 15/89 (17%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNG---------------GGYALLYEDK  135
            G KIDL+ +  YE L+N L NMF + +     +                  G  L YEDK
Sbjct  151  GRKIDLNAHKCYESLSNTLENMFLKPKTGSSTRESDAHTETHLKILPDGSSGLVLTYEDK  210

Query  136  QGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            +G+W++ GDVPW  F+GSV R+ I+R+ +
Sbjct  211  EGDWMLVGDVPWGMFIGSVRRLRIMRTSE  239



>emb|CDX92888.1| BnaC07g41460D [Brassica napus]
Length=405

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 12/123 (10%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQD--------QECGKNGGGYALLYEDKQGNWLVT  156
            G KIDL+ +  YE L+N L  MF + +         +       G+ L YEDK+G+W++ 
Sbjct  134  GRKIDLNAHRCYESLSNTLEEMFLKPKTDGNLETRLKILPDGSSGFVLTYEDKEGDWMLV  193

Query  157  GDVPWMTFVGSVHRIEILRSGD*SWK----IRQIMK*GEVFCMWKYGSLSSLKIN*CCSV  324
            GDVPW  F+GSV R+ I+++ + +      +R I     V    +Y S ++  +   CSV
Sbjct  194  GDVPWGMFIGSVKRLRIMKTSEATGTEMACVRSIRSLTSVTQSPRYVSRTTGIVMSSCSV  253

Query  325  EPI  333
             PI
Sbjct  254  HPI  256



>ref|XP_003521267.1| PREDICTED: auxin-induced protein 22E-like [Glycine max]
 gb|KHN10704.1| Auxin-induced protein 22E [Glycine soja]
Length=206

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +YNSY  L   L ++F      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  125  KIDLKVYNSYPELLAALQSLFTCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  183

Query  175  TFVGSVHRIEILR  213
             FV S  R++I++
Sbjct  184  MFVSSCKRLKIIK  196



>sp|O24543.1|AX22E_VIGRR RecName: Full=Auxin-induced protein 22E; AltName: Full=Indole-3-acetic 
acid-induced protein ARG14 [Vigna radiata var. radiata]
 dbj|BAA20849.1| Aux22e [Vigna radiata]
Length=203

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L N+F      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  122  KIDLKVYKSYPELLKALQNLFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  180

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I++  +
Sbjct  181  MFVSSCKRLRIIKGSE  196



>ref|XP_010038042.1| PREDICTED: auxin-responsive protein IAA1-like [Eucalyptus grandis]
 gb|KCW49839.1| hypothetical protein EUGRSUZ_K03314 [Eucalyptus grandis]
Length=189

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+DL  Y SY+ L   L NMF      +C   G  YA  YEDK G+W++ GDVPW  F  
Sbjct  117  KVDLKTYKSYQELMESLENMF-NITIGDCSDKGSDYAPTYEDKDGDWMLVGDVPWNMFTS  175

Query  187  SVHRIEILRSG  219
            +  R+ I+R G
Sbjct  176  TCKRLRIMRGG  186



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+D+ LY SY+ L++ L  MF+ +  ++CG                 NG  Y   Y+DK 
Sbjct  128  KVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKD  187

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  188  GDWMLVGDVPWEMFVESCQRLRIMK  212



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+D+ LY SY+ L++ L  MF+ +  ++CG                 NG  Y   Y+DK 
Sbjct  128  KVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKD  187

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  +
Sbjct  188  GDWMLVGDVPWEMFVESCQRLRIMKGSE  215



>ref|XP_007024033.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOY26655.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=202

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQEC--------GKNGGGYALLYEDKQGNWLVTGD  162
            K+DL +YNSY+ L + L +MF+ +  + C          NG  Y   YEDK G+W++ GD
Sbjct  107  KVDLEMYNSYQQLLSSLEDMFSCFTIRNCLNEKKIVDQVNGLEYVPTYEDKDGDWMLVGD  166

Query  163  VPWMTFVGSVHRIEILRSGD  222
            VPW  FV S  R+ +++S +
Sbjct  167  VPWQMFVDSCKRLRLMKSSE  186



>ref|NP_001266065.1| IAA12 [Solanum lycopersicum]
 gb|AEX00355.1| IAA12 [Solanum lycopersicum]
Length=313

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 21/95 (22%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNG---------------------GGYA  117
            G K+DL+ +NSYE L   L NMF R     C ++                        + 
Sbjct  196  GRKVDLNAHNSYENLAQTLDNMFLRPSTTVCARSSNVQELGVMSETTSSSRLLDGSSEFV  255

Query  118  LLYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            L YEDK G+W++ GDVPW  F+ SV R+ ++R+ D
Sbjct  256  LTYEDKDGDWMLVGDVPWEMFISSVKRLRVMRTSD  290



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  150  KVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKD  209

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  210  GDWMLVGDVPWEMFVQSCKRLRIMK  234



>gb|AAN16887.1| Aux/IAA2 [Mirabilis jalapa]
Length=93

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y +++ G NG  Y   YEDK G+W++ GDVPW 
Sbjct  13   KIDLKVYQSYAELLRGLENMFKVRIGSYSERD-GYNGSDYVPTYEDKDGDWMLVGDVPWE  71

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++S +
Sbjct  72   MFISSCKRLRIMKSSE  87



>ref|XP_009589137.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana tomentosiformis]
Length=193

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  112  KIDLKVYKSYPELLKALQNMFKCTIGVYTERE-GYNGSEYAPTYEDKDGDWMLVGDVPWD  170

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  171  MFINSCRRLRIMK  183



>gb|ACJ85999.1| unknown [Medicago truncatula]
Length=204

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  123  KIDLKVYKSYSELLKVLENMFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  181

Query  175  TFVGSVHRIEILR  213
             F+ S  R++I++
Sbjct  182  MFISSCKRLKIVK  194



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL +Y SY+ L+  L NMF+ +    CG                NG  Y   YEDK G
Sbjct  169  KVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDG  228

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  229  DWMLVGDVPWEMFVESCKRLRIMK  252



>ref|XP_010556867.1| PREDICTED: auxin-responsive protein IAA10 [Tarenaya hassleriana]
Length=257

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 46/89 (52%), Gaps = 17/89 (19%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMF------ARYQDQECG-----------KNGGGYALLYE  129
            G K+DLS ++SYE L   L+ MF       R   Q C                G  L Y+
Sbjct  154  GRKVDLSAHSSYEALEKTLVEMFLQPPSLTRSSAQGCEGVSRTWGTKLLDGSSGCVLTYK  213

Query  130  DKQGNWLVTGDVPWMTFVGSVHRIEILRS  216
            DK G+W++ GDVPW  FVGSV R+ I+R+
Sbjct  214  DKDGDWMLVGDVPWQMFVGSVKRLRIMRT  242



>gb|ACF87179.1| unknown [Zea mays]
 gb|ADX60115.1| AUX/IAA transcription factor [Zea mays]
Length=276

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL +Y SY+ L+  L NMF+ +    CG                NG  Y   YEDK G
Sbjct  174  KVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDG  233

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  234  DWMLVGDVPWEMFVESCKRLRIMK  257



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  150  KVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKD  209

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  210  GDWMLVGDVPWEMFVQSCKRLRIMK  234



>gb|KEH43016.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=243

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  150  KVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKD  209

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  210  GDWMLVGDVPWEMFVQSCKRLRIMK  234



>ref|NP_001150626.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG39802.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
Length=275

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL +Y SY+ L+  L NMF+ +    CG                NG  Y   YEDK G
Sbjct  173  KVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDG  232

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  233  DWMLVGDVPWEMFVESCKRLRIMK  256



>gb|ABK95100.1| unknown [Populus trichocarpa]
Length=95

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y + E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  15   KIDLKVYKSYPELLKALENMFKLTIGEYSENE-GYNGSEFAPTYEDKDGDWMLVGDVPWD  73

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  74   MFISSCKRLRIMKGSE  89



>ref|XP_009137802.1| PREDICTED: auxin-responsive protein IAA11-like [Brassica rapa]
Length=226

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 8/82 (10%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQ---ECG-----KNGGGYALLYEDKQGNWLVT  156
            G KIDL+ +  YE L+N L +MF + +     E G         G  L YEDK+G+W++ 
Sbjct  136  GRKIDLNAHRCYESLSNTLEDMFLKPKTDGHLEAGLKILPDGSSGLVLTYEDKEGDWMLV  195

Query  157  GDVPWMTFVGSVHRIEILRSGD  222
            GDVPW  F+GSV R+ I+++ +
Sbjct  196  GDVPWGMFIGSVKRLRIMKTSE  217



>gb|ADG60258.1| IAA13-like protein [Nicotiana tabacum]
Length=170

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  55   GRKVDLNAHSSYENLEQTLDRMFLKPNTAVCARSSNAQELSVMSETSSSRLLDGSSEFVL  114

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  115  TYEDKEGDWMLVGDVPWEMFISSVRRLRIMRTSD  148



>ref|XP_009612337.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=315

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL +Y SY  L++ L  MF+ +   +CG                   +G  Y L YED
Sbjct  211  KVDLKIYKSYNDLSSALEKMFSCFTIGQCGTEGIPIRDGLTESRLMDLLHGSEYVLTYED  270

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F GS  R++I++S D
Sbjct  271  KDGDWMLVGDVPWEMFTGSCKRLKIMKSSD  300



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECG----------------KNGGGYALLYEDKQ  138
            K+DL +Y SY+ L++ L  MFA +   +CG                 NG  Y   YEDK 
Sbjct  133  KVDLKMYGSYQELSDALRKMFASFTAGQCGAQKMRDYMNERKLIDVSNGSDYVPTYEDKD  192

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  193  GDWMLVGDVPWDMFVDSCKRLRIMK  217



>ref|XP_010235967.1| PREDICTED: auxin-responsive protein IAA10 isoform X2 [Brachypodium 
distachyon]
Length=264

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNG----------GGYALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C  N             Y L YED+ G+W+
Sbjct  176  GRKVDLNAHRSYKTLALALEIMFTKPSAGLCASNSTKSLKLLDNSSEYQLTYEDRDGDWM  235

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  236  LVGDVPWEMFVGSVKRLRIMRASD  259



>gb|ACV31210.1| auxin/indole-3-acetic acid 4 [Solanum tuberosum]
Length=198

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL++YNSY+ L++ L  MF+ ++  +C                    +G  Y L YED
Sbjct  94   KVDLTIYNSYQDLSSALEKMFSCFKAGQCETQGISLSDGLKVSKLADLLHGSEYVLTYED  153

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F  S  ++ I++S D
Sbjct  154  KDGDWMLVGDVPWEMFTESCKKLRIMKSSD  183



>ref|XP_010447416.1| PREDICTED: auxin-responsive protein IAA29-like isoform X3 [Camelina 
sativa]
Length=214

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPW  171
              K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K+G+WL+ GDVPW
Sbjct  128  ARKVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFTFQGKEGDWLIPGDVPW  182



>ref|XP_003570401.1| PREDICTED: auxin-responsive protein IAA10 isoform X1 [Brachypodium 
distachyon]
Length=281

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNG----------GGYALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C  N             Y L YED+ G+W+
Sbjct  176  GRKVDLNAHRSYKTLALALEIMFTKPSAGLCASNSTKSLKLLDNSSEYQLTYEDRDGDWM  235

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  236  LVGDVPWEMFVGSVKRLRIMRASD  259



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY  L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  154  KVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYEDKD  213

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++S +
Sbjct  214  GDWMLVGDVPWEMFVESCKRLRIMKSKE  241



>ref|XP_009419087.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=181

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DLSL++SY+ L   L  MF + Q      +   Y + YED+ G+W++ GDVPW  F
Sbjct  111  GRKVDLSLHDSYQALFLTLSQMFPKKQHDGEESDAAYYKVTYEDEDGDWMLVGDVPWEAF  170

Query  181  VGSVHRIEIL  210
            + SV R++IL
Sbjct  171  IQSVKRLKIL  180



>ref|NP_001266029.1| IAA3 protein [Solanum lycopersicum]
 gb|AEX00349.1| IAA3 [Solanum lycopersicum]
Length=185

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY+ L   L +MF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  104  KIDLQVYKSYQELLKALQSMFKCTIGVYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  162

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  163  MFISSCKRLRIIK  175



>emb|CDY35203.1| BnaA01g08280D [Brassica napus]
Length=243

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGY---------------ALLYEDK  135
            G KIDL+ +N YE L+N L +MF +       +   G+                L YEDK
Sbjct  146  GRKIDLNAHNCYESLSNALEDMFLKPNTVSSTQETDGHLETRLKILPDGSSGLVLTYEDK  205

Query  136  QGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            +G+W++ GDVPW  F+GSV R+ I+++ +
Sbjct  206  EGDWMLVGDVPWRMFIGSVKRLRIMKTSE  234



>ref|XP_009612823.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana tomentosiformis]
Length=178

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL+LY SY  L   L NMF      Y ++E G NG  Y   YEDK G+W++ GDVPW 
Sbjct  97   KIDLNLYKSYTELLKALENMFKCSIGVYSERE-GYNGSDYVPTYEDKDGDWMLAGDVPWD  155

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  156  MFINSCKRLRIMK  168



>ref|XP_006352755.1| PREDICTED: auxin-induced protein 22D-like [Solanum tuberosum]
Length=153

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL++Y SY  L   L NMF    + E G NG  Y   YEDK G+W++ GDVPW  F+ 
Sbjct  76   KIDLNIYKSYPQLLKALENMFKCSIETE-GYNGCNYVPTYEDKDGDWMLAGDVPWDMFIN  134

Query  187  SVHRIEILRSGD  222
            S  R+ I++  +
Sbjct  135  SCKRLRIMKGSE  146



>gb|ABM53870.1| IAA2 [Cestrum elegans]
Length=152

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG------------------YALLYED  132
            K+DL  Y +Y+ L++ L NMF+ +   ECG +G                    Y L YED
Sbjct  47   KVDLRNYFAYQELSSALENMFSCFTIGECGSHGAPGKESLSESKLKDLFRGSEYVLTYED  106

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R+ I++S D
Sbjct  107  KDGDWMLVGDVPWELFINTCKRLRIMKSSD  136



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y +YE L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  124  KVDLKMYKTYEELSDALGKMFSSFTMSKCDAQGMMDFMNESKLMDLLNGSDYVPTYEDKD  183

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FVGS  R+ I++
Sbjct  184  GDWMLVGDVPWEMFVGSCKRLRIMK  208



>ref|XP_011045352.1| PREDICTED: auxin-responsive protein IAA1 [Populus euphratica]
Length=220

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 14/85 (16%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQ-------------DQECGKNGGGYALLYEDKQGNW  147
            K+DL +YNSY+ L N L +MF+ +              +QE   NG  Y   YEDK G+W
Sbjct  121  KVDLEMYNSYQQLLNALQDMFSCFSFTIRNYLNERTLMEQEVN-NGAEYVSTYEDKDGDW  179

Query  148  LVTGDVPWMTFVGSVHRIEILRSGD  222
            ++ GDVPW  FV S  R+ +++S +
Sbjct  180  MMLGDVPWKMFVESCKRLRLMKSSE  204



>gb|AFK42473.1| unknown [Lotus japonicus]
Length=196

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +YN+Y  L   L NMF      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  115  KIDLKVYNNYPELLKALENMFKCTFGEYSERE-GYNGSEHAPTYEDKDGDWMLVGDVPWN  173

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  174  MFMSSCKRLRIVK  186



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY  L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  51   KVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKD  110

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++S +
Sbjct  111  GDWMLVGDVPWEMFVESCKRLRIMKSKE  138



>ref|XP_002307625.1| auxin-induced protein 22B [Populus trichocarpa]
 gb|EEE94621.1| auxin-induced protein 22B [Populus trichocarpa]
Length=195

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y + E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  115  KIDLKVYKSYPELLKALENMFKLTIGEYSENE-GYNGSEFAPTYEDKDGDWMLVGDVPWD  173

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  174  MFISSCKRLRIMK  186



>gb|EPS58914.1| hypothetical protein M569_15899, partial [Genlisea aurea]
Length=128

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL  YN+Y  L   L NMF      Y ++E G N   YA  YEDK G+W++ GDVPW 
Sbjct  47   KIDLKFYNNYVDLLKALENMFKCKIGVYSERE-GYNASEYAPTYEDKDGDWMLVGDVPWE  105

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I+++ +
Sbjct  106  MFVNSCKRMRIMKASE  121



>ref|XP_004169589.1| PREDICTED: auxin-responsive protein IAA4-like, partial [Cucumis 
sativus]
Length=117

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFAR----YQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL++Y SY  L   L NMF      Y ++E G NG  Y   YEDK G+W++ GDVPW 
Sbjct  36   KIDLTVYKSYTDLVKALENMFKFNLGGYSERE-GFNGSDYVPTYEDKDGDWMLVGDVPWE  94

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  95   MFISSCKRLRIMKGSE  110



>gb|EMS48060.1| Auxin-responsive protein IAA10 [Triticum urartu]
Length=142

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG----------YALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C  N             Y + YED+ G+W+
Sbjct  54   GRKVDLNAHRSYKTLALALEIMFTKPSAGLCASNSTKSLKLLENSCEYQMTYEDRDGDWM  113

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  114  LVGDVPWEMFVGSVKRLRIMRTSD  137



>ref|XP_004495146.1| PREDICTED: auxin-induced protein 22D-like isoform X2 [Cicer arietinum]
Length=199

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  118  KIDLKVYKSYSELLKALENMFKCTFGEYSERE-GYNGSEFAPTYEDKDGDWMLVGDVPWE  176

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ +++  +
Sbjct  177  MFMSSCKRLRVMKGSE  192



>ref|XP_004495145.1| PREDICTED: auxin-induced protein 22D-like isoform X1 [Cicer arietinum]
Length=203

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  122  KIDLKVYKSYSELLKALENMFKCTFGEYSERE-GYNGSEFAPTYEDKDGDWMLVGDVPWE  180

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ +++  +
Sbjct  181  MFMSSCKRLRVMKGSE  196



>gb|KJB22939.1| hypothetical protein B456_004G075000 [Gossypium raimondii]
Length=175

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y  +E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  94   KIDLKVYRSYPQLLKALENMFKLTIGAYSKRE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  152

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I +  +
Sbjct  153  MFISSCKRLRITKGSE  168



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL++Y SY+ L+N L  MF+ +   +CG                NG  Y   YED+ G
Sbjct  136  KVDLNMYKSYQDLSNSLEKMFSCFTMGQCGSQGINFLNESKLMDLLNGSEYVPTYEDRDG  195

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  196  DWMLVGDVPWEMFVDSCRRLRIMK  219



>ref|XP_010674856.1| PREDICTED: auxin-responsive protein IAA4-like [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KID+ LYN Y  L   L +MF     +Y ++E G NG  +   YEDK G+W++ GDVPW 
Sbjct  99   KIDMKLYNGYAELLKSLEDMFKVTVGKYSERE-GYNGSEFVPTYEDKDGDWMLVGDVPWE  157

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ +++  D
Sbjct  158  MFINSCKRLRVMKGSD  173



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY  L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  154  KVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDKD  213

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++S +
Sbjct  214  GDWMLVGDVPWEMFVESCKRLRIMKSKE  241



>ref|XP_010278166.1| PREDICTED: auxin-responsive protein IAA4-like [Nelumbo nucifera]
Length=198

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL  Y  Y  L   L NMF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  116  KIDLKSYKGYPELLKALENMFKFTIGQYSERE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  174

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  175  MFISSCKRLRIMK  187



>gb|KJB56783.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=388

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 14/86 (16%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------YALLYEDKQGN  144
            K+DL  YN+Y   ++ L  MF+ +   +CG NG G              Y L YEDK G+
Sbjct  231  KVDLKTYNNYREFSSALEKMFSCFTIGQCGSNGDGLSESRLMDLLHGSEYVLTYEDKDGD  290

Query  145  WLVTGDVPWMTFVGSVHRIEILRSGD  222
            W++ GDVPW  F  S  R+ I++  +
Sbjct  291  WMLVGDVPWEMFTDSCRRLRIMKGSE  316



>gb|KJB06503.1| hypothetical protein B456_001G242800 [Gossypium raimondii]
Length=159

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YED+ G+W++ GDVPW 
Sbjct  78   KIDLKVYRSYPQLLLALENMFKLTIGAYSERE-GYNGSNYAPTYEDRDGDWMLVGDVPWE  136

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  137  MFISSCKRLRIMKGSE  152



>ref|XP_010447413.1| PREDICTED: auxin-responsive protein IAA29-like isoform X1 [Camelina 
sativa]
Length=255

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPW  171
              K+D+ L+NSYE LT+ LI MF +Y+D  C +    YA  ++ K+G+WL+ GDVPW
Sbjct  169  ARKVDIKLFNSYESLTDSLITMFTQYED--CEREDTNYAFTFQGKEGDWLIPGDVPW  223



>ref|XP_004153443.1| PREDICTED: auxin-responsive protein IAA16-like, partial [Cucumis 
sativus]
Length=139

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  35   KVDLKLYASYKELSHALAQMFSSFTIGKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKD  94

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  D
Sbjct  95   GDWMLVGDVPWEMFVDSCKRLRIMKESD  122



>emb|CDY51701.1| BnaA03g58910D [Brassica napus]
Length=201

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 8/82 (10%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQ---ECG-----KNGGGYALLYEDKQGNWLVT  156
            G K+DL+ ++ YE L+N L  MF + +     E G         G  L YEDK+G+W++ 
Sbjct  111  GRKVDLNAHSCYESLSNALEEMFLKPKTDGHLEAGLKILPDGSSGLVLTYEDKEGDWMLV  170

Query  157  GDVPWMTFVGSVHRIEILRSGD  222
            GDVPW  F+GSV R+ I+++ +
Sbjct  171  GDVPWGMFIGSVKRLRIMKTSE  192



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+DL +Y SY+ L+N L  MF+ +       N   Y   YEDK G+W++ GDVPW  FV 
Sbjct  133  KVDLKMYKSYQELSNALAKMFSSFTMLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  192

Query  187  SVHRIEILR  213
            S  R+ I++
Sbjct  193  SCKRLRIMK  201



>gb|ACR38138.1| unknown [Zea mays]
Length=158

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG----------YALLYEDKQGNWL  150
            G K+DL+ + SY+ L + L  MF +     C  +             Y L YED+ G+W+
Sbjct  52   GRKVDLNAHRSYKTLASALELMFMKPSIGLCTSSSSKTLKLLDSSSEYQLTYEDRDGDWM  111

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R++I+R+ D
Sbjct  112  LVGDVPWEMFVGSVKRLKIMRTSD  135



>ref|XP_004495060.1| PREDICTED: auxin-responsive protein IAA12-like isoform X3 [Cicer 
arietinum]
Length=262

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQ---ECGK-------NGGGYALLYEDKQGNWL  150
            G K++LS ++SYE L   L +MF  Y+      C +           + L YEDK+G+W+
Sbjct  159  GRKVNLSSHSSYETLAQTLEDMFNEYESTTGIACKEWHSKLLDGSSKFVLTYEDKEGDWM  218

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FV SV R+ I+R+ +
Sbjct  219  LVGDVPWGMFVSSVKRLRIMRTSE  242



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            KIDL LY +Y+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  138  KIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESKLIDLLNGSDYVPTYEDKD  197

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  RI I++
Sbjct  198  GDWMLVGDVPWEMFVDSCKRIRIMK  222



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY  L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  154  KVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKD  213

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++S +
Sbjct  214  GDWMLVGDVPWEMFVESCKRLRIMKSKE  241



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  143  KVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKD  202

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  203  GDWMLVGDVPWEMFVDSCKRLRIMK  227



>gb|KJB22937.1| hypothetical protein B456_004G075000 [Gossypium raimondii]
Length=200

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y  +E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  119  KIDLKVYRSYPQLLKALENMFKLTIGAYSKRE-GYNGSDYAPTYEDKDGDWMLVGDVPWE  177

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I +  +
Sbjct  178  MFISSCKRLRITKGSE  193



>emb|CDP10441.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            K+DL+LY+SY+ L   L+ MF +     C ++   Y L+++DK+G+WL+  DV W  F+ 
Sbjct  149  KVDLNLYHSYQTLLQTLVGMFGK-----CQQSVQSYQLIFQDKEGDWLLAEDVNWGNFIT  203

Query  187  SVHRIEILRSGD  222
            SV R+++LR  D
Sbjct  204  SVQRLKLLRKRD  215



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  143  KVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKD  202

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  203  GDWMLVGDVPWEMFVDSCKRLRIMK  227



>gb|KJB06507.1| hypothetical protein B456_001G242800 [Gossypium raimondii]
Length=184

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YED+ G+W++ GDVPW 
Sbjct  103  KIDLKVYRSYPQLLLALENMFKLTIGAYSERE-GYNGSNYAPTYEDRDGDWMLVGDVPWE  161

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  162  MFISSCKRLRIMKGSE  177



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY+ L++ L  MF+ +  + CG                 NG  Y   YEDK 
Sbjct  46   KVDLKMYKSYQQLSDALGKMFSSFTIENCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKD  105

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  106  GDWMLVGDVPWGMFVDSCKRLRIMK  130



>gb|EMT31544.1| Auxin-responsive protein IAA10 [Aegilops tauschii]
Length=228

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG----------YALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C  N             Y + YED+ G+W+
Sbjct  140  GRKVDLNAHRSYKTLALALEIMFTKPSAGLCASNSTKSLKLLENSCEYQMTYEDRDGDWM  199

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  200  LVGDVPWEMFVGSVKRLRIMRTSD  223



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 11/83 (13%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKN-----------GGGYALLYEDKQGNWLV  153
            K+DL  Y +Y+ L++ L  MF+ +   +CG N           G  Y L YEDK G+W++
Sbjct  241  KVDLRAYATYQELSSGLEKMFSCFTLGQCGSNMSETKLRDLLHGSEYVLTYEDKDGDWML  300

Query  154  TGDVPWMTFVGSVHRIEILRSGD  222
             GDVPW  F+ S  R++I++  D
Sbjct  301  VGDVPWEMFIDSCKRLKIMKGSD  323



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 16/86 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY  L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  156  KVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDKD  215

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRS  216
            G+W++ GDVPW  FV S  R+ I++S
Sbjct  216  GDWMLVGDVPWEMFVESCKRLRIMKS  241



>ref|XP_009611025.1| PREDICTED: auxin-responsive protein IAA17-like [Nicotiana tomentosiformis]
Length=207

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF-----ARYQDQEC---GKNGGGYALLYEDKQGNWLVTGD  162
            K+DL +Y+SY+ L N L NMF       +Q Q       NG  Y   YEDK G+W++ GD
Sbjct  112  KVDLEIYDSYQKLLNALQNMFTCLTICNFQSQSKLMDITNGVEYVPTYEDKDGDWMLVGD  171

Query  163  VPWMTFVGSVHRIEILRSGD  222
            VPW  FV +  RI +++S +
Sbjct  172  VPWKMFVDTCKRIRLMKSSE  191



>ref|XP_004146959.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 ref|XP_004170581.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 gb|KGN44764.1| hypothetical protein Csa_7G378530 [Cucumis sativus]
Length=196

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFAR----YQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL++Y SY  L   L NMF      Y ++E G NG  Y   YEDK G+W++ GDVPW 
Sbjct  115  KIDLTVYKSYTDLVKALENMFKFNLGGYSERE-GFNGSDYVPTYEDKDGDWMLVGDVPWE  173

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  174  MFISSCKRLRIMK  186



>ref|XP_009767832.1| PREDICTED: auxin-responsive protein IAA12-like isoform X3 [Nicotiana 
sylvestris]
Length=309

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  196  GRKVDLNAHSSYENLEQTLDRMFLKPNTAVCARSSNAQELSVMSETSSSRLLDGSSEFVL  255

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  256  TYEDKEGDWMLVGDVPWEMFISSVRRLRIMRTSD  289



>ref|NP_001142395.1| uncharacterized protein LOC100274569 [Zea mays]
 gb|ACF88394.1| unknown [Zea mays]
 gb|AFW82063.1| hypothetical protein ZEAMMB73_977844 [Zea mays]
 gb|AIB05149.1| AUX/IAA transcription factor, partial [Zea mays]
Length=246

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 10/79 (13%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNG-------GGYALLYEDKQGNWLVTGDV  165
            KIDL  Y +Y+ L+  L  MF+ +     GK+G       G Y L YEDK G+W++ GDV
Sbjct  155  KIDLKTYKNYKDLSTALEKMFSGFS---TGKDGSSEYRKDGEYVLTYEDKDGDWMLVGDV  211

Query  166  PWMTFVGSVHRIEILRSGD  222
            PW  F GS  R+ I++  D
Sbjct  212  PWEMFAGSCRRLRIMKGSD  230



>gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  133  KVDLKLYASYKELSHALAQMFSSFTIGKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKD  192

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  D
Sbjct  193  GDWMLVGDVPWEMFVDSCKRLRIMKESD  220



>ref|NP_001266052.1| IAA8 [Solanum lycopersicum]
 gb|AEX00352.1| IAA8 [Solanum lycopersicum]
Length=295

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL++YNSY+ L++ L  MF  ++  +C                    +G  YAL YED
Sbjct  191  KVDLTMYNSYKDLSSALEKMFRCFKAGQCETQGISLSDGLKESKLADLLHGSEYALTYED  250

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F  S  ++ I++S D
Sbjct  251  KDGDWMLVGDVPWEMFTESCKKLRIMKSSD  280



>emb|CBI28036.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 47/90 (52%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNG------------------GGYALLYED  132
            K+DL LY++Y  L++ L  MF+ +   +CG NG                    Y L YED
Sbjct  65   KVDLKLYSTYMELSSALEKMFSCFTIGQCGSNGVPIRDGLSESRLMDLLHGSEYVLTYED  124

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F  S  R+ I++S +
Sbjct  125  KDGDWMLVGDVPWEMFTDSCKRMRIMKSSE  154



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL  +++Y+ L+  L  MF+ +   +CG                   NG  YAL YED
Sbjct  277  KVDLRTHSTYQELSRALEKMFSCFTIGQCGSHGAPEREKLSESKLRDLLNGSEYALTYED  336

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R++I++S D
Sbjct  337  KDGDWMLVGDVPWEMFIETCKRLKIMKSSD  366



>ref|XP_009767831.1| PREDICTED: auxin-responsive protein IAA12-like isoform X2 [Nicotiana 
sylvestris]
Length=311

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  196  GRKVDLNAHSSYENLEQTLDRMFLKPNTAVCARSSNAQELSVMSETSSSRLLDGSSEFVL  255

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  256  TYEDKEGDWMLVGDVPWEMFISSVRRLRIMRTSD  289



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNG------------------GGYALLYED  132
            K+DL  Y++Y+ L++ L  MF+ +   +CG NG                    Y L YED
Sbjct  272  KVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGTPGREMLNESKLRDFLHGSEYVLTYED  331

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R++I++  D
Sbjct  332  KDGDWMLVGDVPWEMFIESCKRLKIMKGAD  361



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGG------------------GYALLYED  132
            K+DL  Y +Y+ L++DL  MF+ +   +CG +GG                   Y + YED
Sbjct  243  KVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGGPGKEMLSESKLKDFLHGSEYVVTYED  302

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R++I++  D
Sbjct  303  KDGDWMLVGDVPWDMFIDTCKRLKIMKGSD  332



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  167  KVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLLNGSDYVPTYEDKD  226

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  227  GDWMLVGDVPWDMFVDSCKRLRIMK  251



>gb|KDP23666.1| hypothetical protein JCGZ_23499 [Jatropha curcas]
Length=204

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL LY  Y  L   L +MF      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  122  KIDLKLYKDYSELLKALEDMFKFEVGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWD  180

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  181  MFINSCKRLRIMK  193



>ref|XP_004964748.1| PREDICTED: auxin-responsive protein IAA20-like [Setaria italica]
Length=174

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 10/80 (13%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFA----------RYQDQECGKNGGGYALLYEDKQGNWL  150
            G K+D+SL+ SYE L   L  MF           R   Q   + G  YA+ YED +G+WL
Sbjct  94   GRKVDVSLHASYEELLRTLARMFPSAANKGAEEEREVAQHERRRGHPYAVTYEDGEGDWL  153

Query  151  VTGDVPWMTFVGSVHRIEIL  210
            + GDVPW  F  SV R++IL
Sbjct  154  LVGDVPWEAFAKSVKRLKIL  173



>gb|KHG20616.1| Auxin-induced 22D [Gossypium arboreum]
 gb|KHG26249.1| Auxin-induced 22D [Gossypium arboreum]
Length=184

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L NMF      Y ++E G NG  YA  YED+ G+W++ GDVPW 
Sbjct  103  KIDLKVYRSYPQLLLALENMFKLTIGAYSERE-GYNGSDYAPTYEDRDGDWMLVGDVPWE  161

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  162  MFISSCKRLRIMKGSE  177



>ref|XP_009767830.1| PREDICTED: auxin-responsive protein IAA12-like isoform X1 [Nicotiana 
sylvestris]
Length=313

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  196  GRKVDLNAHSSYENLEQTLDRMFLKPNTAVCARSSNAQELSVMSETSSSRLLDGSSEFVL  255

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  256  TYEDKEGDWMLVGDVPWEMFISSVRRLRIMRTSD  289



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGG------------------GYALLYED  132
            K+DL  Y +Y+ L++DL  MF+ +   +CG +GG                   Y + YED
Sbjct  251  KVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGGPGKEMLSESKLKDFLHGSEYVVTYED  310

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R++I++  D
Sbjct  311  KDGDWMLVGDVPWDMFIDTCKRLKIMKGSD  340



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL +Y SY+ L+  L  MF+ +    CG                NG  Y   YEDK G
Sbjct  162  KVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDG  221

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  222  DWMLVGDVPWEMFVESCKRLRIMK  245



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            KIDL LY +Y+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  128  KIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESRLIDLLNGSDYVPTYEDKD  187

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  RI I++
Sbjct  188  GDWMLVGDVPWGMFVDSCKRIRIMK  212



>gb|AAL55414.1| auxin-induced AUX/IAA1 [Antirrhinum majus]
Length=172

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 5/74 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL  YN+Y  L   L NMF      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  95   KIDLKFYNNYFDLLKALENMFKCTIGVYSERE-GYNGSEFAPTYEDKDGDWMLVGDVPWD  153

Query  175  TFVGSVHRIEILRS  216
             F+ S  R+ I++S
Sbjct  154  MFITSCKRLRIMQS  167



>ref|XP_004156465.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16-like 
[Cucumis sativus]
Length=239

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  135  KVDLKLYASYKELSHALAQMFSSFTIGKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKD  194

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  D
Sbjct  195  GDWMLVGDVPWEMFVDSCKRLRIMKESD  222



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DL +Y SY+ L+  L  MF+ +    CG                NG  Y   YEDK G
Sbjct  179  KVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDG  238

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  239  DWMLVGDVPWEMFVESCKRLRIMK  262



>ref|XP_010691245.1| PREDICTED: auxin-responsive protein IAA1 [Beta vulgaris subsp. 
vulgaris]
Length=205

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQEC---GK-----NGGGYALLYEDKQGNWLVTGD  162
            K+DL LYNSY+ L   L +MF+ +  +     GK     NG  Y   +EDK G+W++ GD
Sbjct  113  KVDLELYNSYQQLLKALEDMFSSFTIRHFFNDGKLMDPVNGSDYVPTFEDKDGDWMMVGD  172

Query  163  VPWMTFVGSVHRIEILRSGD  222
            VPW  FV S  RI +++S +
Sbjct  173  VPWNMFVESCKRIRLMKSSE  192



>emb|CDY38374.1| BnaC01g09830D [Brassica napus]
Length=238

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGY---------------ALLYEDK  135
            G KIDL+ +  YE L+N L +MF + +     +   G+                L YEDK
Sbjct  144  GRKIDLNAHQCYESLSNTLEDMFLKPKSVSSTQETDGHLETRLKILPDGSSGLVLTYEDK  203

Query  136  QGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            +G+W++ GDVPW  F+GSV R+ I+++ +
Sbjct  204  EGDWMLVGDVPWRMFIGSVKRLRIMKTSE  232



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  136  KVDLKMYTSYQQLSDALGKMFSSFTIGNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDKD  195

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  RI I++
Sbjct  196  GDWMLVGDVPWEMFVDSCKRIRIMK  220



>ref|XP_008449351.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=220

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG----------------YALLYEDKQ  138
            K+DLS+YNSY  L++ L   F  +   +CG   GG                Y   Y+DK 
Sbjct  115  KVDLSMYNSYNQLSHALAKFFGAFTIGKCGSEAGGMKELMNELKVNVDCSDYVPTYQDKD  174

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  175  GDWMLLGDVPWQMFVESCKRVRIMK  199



>ref|XP_010440447.1| PREDICTED: auxin-responsive protein IAA1-like [Camelina sativa]
Length=172

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y +Y  L   L NMF      Y ++E  K G G+   YEDK G+W++ GDVPW 
Sbjct  92   KIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKKGSGFVPTYEDKDGDWMLVGDVPWD  151

Query  175  TFVGSVHRIEILRSGD  222
             F  S  ++ I++  +
Sbjct  152  MFSSSCQKLRIMKGSE  167



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  154  KVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKD  213

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  214  GDWMLVGDVPWEMFVNSCKRLRIMK  238



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL  Y++Y+ L+  L  MF+ +   +CG                   NG  Y L YED
Sbjct  288  KVDLKTYSAYQELSTALEKMFSCFTIGQCGSHGVSGRDGLSESKLKDLLNGSEYVLTYED  347

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R+ I++  D
Sbjct  348  KDGDWMLVGDVPWEMFIDSCKRLRIMKGSD  377



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNG------------------GGYALLYED  132
            K+DL  Y++Y+ L++ L  MF+ +   +CG NG                    Y L YED
Sbjct  272  KVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGTPGREMLNESKLRDFLHGSEYVLTYED  331

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R++I++  D
Sbjct  332  KDGDWMLVGDVPWEMFIESCKRLKIMKGAD  361



>ref|XP_010450024.1| PREDICTED: auxin-responsive protein IAA1-like [Camelina sativa]
Length=170

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y +Y  L   L NMF      Y ++E  K G G+   YEDK G+W++ GDVPW 
Sbjct  90   KIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKKGSGFVPTYEDKDGDWMLVGDVPWD  149

Query  175  TFVGSVHRIEILRSGD  222
             F  S  ++ I++  +
Sbjct  150  MFSSSCQKLRIMKGSE  165



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DLS+Y +Y+ L+  L  MF+ +    CG                NG  Y   YEDK G
Sbjct  150  KVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGMNGMNESKLMDLLNGSEYVPTYEDKDG  209

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  210  DWMLVGDVPWEMFVESCKRLRIMK  233



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 15/84 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK---------------NGGGYALLYEDKQG  141
            K+DLS+Y +Y+ L+  L  MF+ +    CG                NG  Y   YEDK G
Sbjct  150  KVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGMNGMNESKLMDLLNGSEYVPTYEDKDG  209

Query  142  NWLVTGDVPWMTFVGSVHRIEILR  213
            +W++ GDVPW  FV S  R+ I++
Sbjct  210  DWMLVGDVPWEMFVESCKRLRIMK  233



>ref|XP_004493738.1| PREDICTED: auxin-induced protein 22E-like [Cicer arietinum]
Length=192

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L N+F      Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  111  KIDLQVYKSYSELLIALQNLFKCTFGEYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  169

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R++I++  +
Sbjct  170  MFISSCKRLKIVKGSE  185



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNG------------------GGYALLYED  132
            K+DL +Y++Y+ L++ L  MF+ +   +CG +G                    Y L YED
Sbjct  246  KVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGTPGKEILSESKLKDLLHGSEYVLTYED  305

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R++I++S D
Sbjct  306  KDGDWMLVGDVPWEMFIETCRRLKIMKSAD  335



>ref|XP_008808453.1| PREDICTED: auxin-induced protein 22D-like [Phoenix dactylifera]
Length=197

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----NGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  YE L   L +MF  +   E  +    NG  YA+ YEDK G+W++ GDVPW 
Sbjct  114  KIDLKVYKGYEELREALEDMFKCFSLGEISRMNESNGYEYAITYEDKDGDWMLVGDVPWA  173

Query  175  TFVGSVHRIEILR  213
             F+ S  R+ I++
Sbjct  174  MFISSCKRMRIMK  186



>ref|XP_010542967.1| PREDICTED: auxin-responsive protein IAA13-like isoform X2 [Tarenaya 
hassleriana]
Length=252

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 16/90 (18%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARY----------QDQECGK------NGGGYALLYED  132
            G K+D+S ++SYE L   L +MF R           ++++  K          + L YED
Sbjct  143  GRKVDMSAHSSYENLAKTLEDMFFRPSSVIGLTGNCREKDKAKAWKILDGSSEFVLTYED  202

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K+G+W++ GDVPW  FVGSV R+ I+R+ +
Sbjct  203  KEGDWMLVGDVPWRMFVGSVRRLRIMRTSE  232



>ref|XP_009354869.1| PREDICTED: auxin-induced protein 22D-like [Pyrus x bretschneideri]
Length=175

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTFVG  186
            KIDL +YNSY  L   L  MF          NG  +A  YEDK G+W++ GDVPW  FV 
Sbjct  101  KIDLKIYNSYPELIKALEKMF-----NLANINGSDFAPTYEDKDGDWMLVGDVPWSMFVS  155

Query  187  SVHRIEILR  213
            S +R+ I++
Sbjct  156  SCNRLRIMK  164



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG------------------YALLYED  132
            K+DL  Y++Y+ L++ L  MF+ +   +CG +G                    Y L YED
Sbjct  283  KVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGSEYVLTYED  342

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R+ I++S D
Sbjct  343  KDGDWMLVGDVPWEMFIDSCKRLRIMKSSD  372



>ref|XP_006353472.1| PREDICTED: auxin-responsive protein IAA27 [Solanum tuberosum]
Length=295

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL++YNSY+ L++ L  MF+ ++  +C                    +G  Y L YED
Sbjct  191  KVDLTIYNSYQDLSSALEKMFSCFKAGQCETQGISLSDGLKVSKLADLLHGSEYVLTYED  250

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F  S  ++ I++S D
Sbjct  251  KDGDWMLVGDVPWEMFTESCKKLRIMKSSD  280



>ref|XP_007162489.1| hypothetical protein PHAVU_001G156500g [Phaseolus vulgaris]
 gb|ESW34483.1| hypothetical protein PHAVU_001G156500g [Phaseolus vulgaris]
Length=205

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L N+F      Y ++E G NG  +A  YEDK G+W++ GDVPW 
Sbjct  124  KIDLKVYQSYPELLMALQNLFKCTFGEYSERE-GYNGSEFAPTYEDKDGDWMLVGDVPWN  182

Query  175  TFVGSVHRIEILRSGD  222
             FV S  R+ I++  +
Sbjct  183  MFVSSCKRLRIIKGSE  198



>ref|XP_009419086.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=179

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DLSL++SY+     L  MF + Q      +   Y + YED+ G+W++ GDVPW  F
Sbjct  109  GRKVDLSLHDSYQAFFLTLGQMFPKKQHDGEESDAAYYKVTYEDEDGDWMLVGDVPWEAF  168

Query  181  VGSVHRIEIL  210
            + SV R++IL
Sbjct  169  IQSVRRLKIL  178



>ref|XP_007050158.1| Indole-3-acetic acid inducible 11, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94315.1| Indole-3-acetic acid inducible 11, putative isoform 1 [Theobroma 
cacao]
Length=308

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 17/91 (19%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMF-----------ARYQDQECGKNG------GGYALLYE  129
            G K+DL+ + SYE L   L +MF           +R ++ E  +          + L YE
Sbjct  198  GRKVDLNAHESYEKLAKTLEDMFLKNTTSVNPVGSRVREHEVARPSKLLDGSSDFVLTYE  257

Query  130  DKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            DK+G+W++ GDVPW  FV SV R+ I+R+ +
Sbjct  258  DKEGDWMLVGDVPWEMFVSSVKRLRIMRTSE  288



>ref|XP_004134103.1| PREDICTED: auxin-induced protein 22B-like [Cucumis sativus]
 ref|XP_004170427.1| PREDICTED: auxin-induced protein 22B-like [Cucumis sativus]
 gb|KGN56917.1| hypothetical protein Csa_3G143580 [Cucumis sativus]
Length=204

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDLSLY  Y VL   L +MF      Y ++E G  G  Y   YEDK G+W++ GDVPW 
Sbjct  122  KIDLSLYKGYPVLLQTLEDMFKFTVGEYSERE-GYKGSEYVPTYEDKDGDWMLVGDVPWE  180

Query  175  TFVGSVHRIEILRSGD  222
             F  S  R+ I++  +
Sbjct  181  MFTSSCKRLRIMKGSE  196



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (49%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL +Y SY+ L+  L  MF+ +    CG                   NG  Y   YED
Sbjct  143  KVDLKMYRSYQELSMALEKMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYED  202

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  FV S  R+ I++  +
Sbjct  203  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSE  232



>ref|XP_009419085.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=180

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWMTF  180
            G K+DLSL++SY+     L  MF + Q      +   Y + YED+ G+W++ GDVPW  F
Sbjct  110  GRKVDLSLHDSYQAFFLTLGQMFPKKQHDGEESDAAYYKVTYEDEDGDWMLVGDVPWEAF  169

Query  181  VGSVHRIEIL  210
            + SV R++IL
Sbjct  170  IQSVRRLKIL  179



>ref|XP_010542966.1| PREDICTED: auxin-responsive protein IAA13-like isoform X1 [Tarenaya 
hassleriana]
Length=253

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 16/90 (18%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARY----------QDQECGK------NGGGYALLYED  132
            G K+D+S ++SYE L   L +MF R           ++++  K          + L YED
Sbjct  144  GRKVDMSAHSSYENLAKTLEDMFFRPSSVIGLTGNCREKDKAKAWKILDGSSEFVLTYED  203

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K+G+W++ GDVPW  FVGSV R+ I+R+ +
Sbjct  204  KEGDWMLVGDVPWRMFVGSVRRLRIMRTSE  233



>ref|XP_010529092.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
 ref|XP_010540311.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
 ref|XP_010552452.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
Length=184

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y  L N L  MF      Y ++E G  G GY   YEDK G+W++ GDVPW 
Sbjct  101  KIDLKMYKDYPELLNALEKMFNFAIGEYSERE-GYKGSGYVPTYEDKDGDWMLVGDVPWE  159

Query  175  TFVGSVHRIEILRSGD  222
             F  S  R+ I+++ +
Sbjct  160  MFSSSCKRLRIMKASE  175



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  143  KVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKD  202

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  203  GDWMLVGDVPWEMFVDSCKRLRIMK  227



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  146  KVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKD  205

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  206  GDWMLVGDVPWEMFVDSCKRLRIMK  230



>ref|XP_002279955.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera]
 emb|CBI34154.3| unnamed protein product [Vitis vinifera]
Length=199

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y  L   L  MF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  117  KIDLKVYKGYPELLKALEEMFKFSVGQYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  175

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  176  MFISSCKRLRIMKGSE  191



>ref|XP_006282898.1| hypothetical protein CARUB_v10007151mg [Capsella rubella]
 gb|EOA15796.1| hypothetical protein CARUB_v10007151mg [Capsella rubella]
Length=170

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y +Y  L   L NMF      Y ++E  K G G+   YEDK G+W++ GDVPW 
Sbjct  90   KIDLKMYQNYPELLKALENMFKFTVGEYSEREGYKKGSGFVPTYEDKDGDWMLVGDVPWD  149

Query  175  TFVGSVHRIEILRSGD  222
             F  S  ++ I++  +
Sbjct  150  MFSSSCQKLRIMKGSE  165



>ref|XP_010435109.1| PREDICTED: auxin-responsive protein IAA1 [Camelina sativa]
Length=173

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y +Y  L   L NMF      Y ++E  K G G+   YEDK G+W++ GDVPW 
Sbjct  93   KIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKKGSGFVPTYEDKDGDWMLVGDVPWD  152

Query  175  TFVGSVHRIEILRSGD  222
             F  S  ++ I++  +
Sbjct  153  MFSSSCQKLRIMKGSE  168



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L + L  MF+ +   +CG                 NG  Y   YEDK 
Sbjct  140  KVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKD  199

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             +W++ GDVPW  FV S  R+ I++  +
Sbjct  200  ADWMLVGDVPWEMFVESCKRLRIMKGSE  227



>ref|XP_002299625.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|ABK94664.1| unknown [Populus trichocarpa]
 gb|EEE84430.1| auxin-induced protein IAA4 [Populus trichocarpa]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 14/85 (16%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQ-------------DQECGKNGGGYALLYEDKQGNW  147
            K+DL +YNSY+ L N L +MF+ +              +QE   NG  Y   YEDK G+W
Sbjct  121  KVDLEMYNSYQQLLNALQDMFSCFSFTIRNYLNERTIMEQEVN-NGVEYVPTYEDKDGDW  179

Query  148  LVTGDVPWMTFVGSVHRIEILRSGD  222
            ++ GDVPW  FV S  R+ +++S +
Sbjct  180  MMLGDVPWKMFVESCKRLRLMKSSE  204



>ref|XP_008235329.1| PREDICTED: auxin-induced protein 22D-like [Prunus mume]
Length=193

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF-----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPW  171
            KIDL +Y SY  L   L NMF       Y + +   NG  +A  YEDK G+W++ GDVPW
Sbjct  109  KIDLKVYKSYPELLKALENMFNLSNIGNYSETQGYINGSDFAPTYEDKDGDWMLVGDVPW  168

Query  172  MTFVGSVHRIEILR  213
              FV S  R+ I++
Sbjct  169  NMFVSSCKRLRIMK  182



>ref|XP_009621769.1| PREDICTED: auxin-responsive protein IAA13 isoform X3 [Nicotiana 
tomentosiformis]
Length=310

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  197  GRKVDLNAHSSYENLERTLDRMFLKPNTAVCARSSNAQELGVMSETSSSRLLDGSTEFVL  256

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  257  TYEDKEGDWMLVGDVPWEMFISSVKRLRIMRTSD  290



>ref|XP_010679164.1| PREDICTED: auxin-induced protein 22D [Beta vulgaris subsp. vulgaris]
Length=198

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y SY  L   L +MF     +Y +++ G NG   A  YEDK G+W++ GDVPW 
Sbjct  117  KIDLKMYQSYAELLKGLESMFRICIGKYSERD-GYNGSDVAPTYEDKDGDWMLVGDVPWE  175

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++S +
Sbjct  176  MFITSCKRLRIMKSSE  191



>ref|XP_006648120.1| PREDICTED: auxin-responsive protein IAA10-like isoform X2 [Oryza 
brachyantha]
Length=284

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGK----------NGGGYALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C            N   Y L YED+ G+W+
Sbjct  179  GRKVDLNAHRSYKTLALALELMFTKPSIGLCTSHNTKSLKLLDNSAEYQLTYEDRDGDWM  238

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  239  LVGDVPWEMFVGSVKRLRIMRTSD  262



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L + L  MF+ +   +CG                 NG  Y   YEDK 
Sbjct  140  KVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKD  199

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             +W++ GDVPW  FV S  R+ I++  +
Sbjct  200  ADWMLVGDVPWEMFVESCKRLRIMKGSE  227



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 43/85 (51%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L + L  MF+ +   +CG                 NG  Y   YEDK 
Sbjct  140  KVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFFNGSDYVPTYEDKD  199

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
             +W++ GDVPW  FV S  R+ I++
Sbjct  200  ADWMLVGDVPWEMFVESCKRLRIMK  224



>ref|XP_006648119.1| PREDICTED: auxin-responsive protein IAA10-like isoform X1 [Oryza 
brachyantha]
Length=285

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGK----------NGGGYALLYEDKQGNWL  150
            G K+DL+ + SY+ L   L  MF +     C            N   Y L YED+ G+W+
Sbjct  180  GRKVDLNAHRSYKTLALALELMFTKPSIGLCTSHNTKSLKLLDNSAEYQLTYEDRDGDWM  239

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  FVGSV R+ I+R+ D
Sbjct  240  LVGDVPWEMFVGSVKRLRIMRTSD  263



>gb|KJB38347.1| hypothetical protein B456_006G250900 [Gossypium raimondii]
 gb|KJB38348.1| hypothetical protein B456_006G250900 [Gossypium raimondii]
Length=335

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 9/83 (11%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGK---------NGGGYALLYEDKQGNWLV  153
            G K+DL+ ++SY  L + L NMF R    E  +             + L YEDK+G+W++
Sbjct  233  GRKVDLNAHSSYHSLASALENMFLRSAGAEKQQLTMPSRLLDGSSEFVLTYEDKEGDWML  292

Query  154  TGDVPWMTFVGSVHRIEILRSGD  222
             GDVPWM F+ SV R+ I+++ +
Sbjct  293  VGDVPWMMFLTSVRRLRIMKTSE  315



>ref|XP_007201847.1| hypothetical protein PRUPE_ppa011843mg [Prunus persica]
 gb|EMJ03046.1| hypothetical protein PRUPE_ppa011843mg [Prunus persica]
Length=193

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMF-----ARYQDQECGKNGGGYALLYEDKQGNWLVTGDVPW  171
            KIDL +Y SY  L   L NMF       Y + +   NG  +A  YEDK G+W++ GDVPW
Sbjct  109  KIDLKVYKSYPELLKALENMFNLSNIGNYSETQGYINGSDFAPTYEDKDGDWMLVGDVPW  168

Query  172  MTFVGSVHRIEILR  213
              FV S  R+ I++
Sbjct  169  NMFVSSCKRLRIMK  182



>ref|XP_009382657.1| PREDICTED: auxin-induced protein 22D-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 7/76 (9%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARY-------QDQECGKNGGGYALLYEDKQGNWLVTGDV  165
            K+DL +YNSYE LT+ L  MF  +       Q Q    +   +A+ YEDK G+W++ GDV
Sbjct  104  KVDLGVYNSYEDLTDALEAMFKGFSLGKRIIQRQAHDLHESEHAITYEDKDGDWMLVGDV  163

Query  166  PWMTFVGSVHRIEILR  213
            PW  FV S  R+ I++
Sbjct  164  PWEMFVSSCKRLRIMK  179



>ref|XP_009621768.1| PREDICTED: auxin-responsive protein IAA13 isoform X2 [Nicotiana 
tomentosiformis]
Length=312

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  197  GRKVDLNAHSSYENLERTLDRMFLKPNTAVCARSSNAQELGVMSETSSSRLLDGSTEFVL  256

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  257  TYEDKEGDWMLVGDVPWEMFISSVKRLRIMRTSD  290



>ref|XP_009621767.1| PREDICTED: auxin-responsive protein IAA13 isoform X1 [Nicotiana 
tomentosiformis]
Length=314

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 20/94 (21%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGKNGGG--------------------YAL  120
            G K+DL+ ++SYE L   L  MF +     C ++                       + L
Sbjct  197  GRKVDLNAHSSYENLERTLDRMFLKPNTAVCARSSNAQELGVMSETSSSRLLDGSTEFVL  256

Query  121  LYEDKQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
             YEDK+G+W++ GDVPW  F+ SV R+ I+R+ D
Sbjct  257  TYEDKEGDWMLVGDVPWEMFISSVKRLRIMRTSD  290



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK------------------NGGGYALLYED  132
            K+DL  Y++Y+ L+  L  MF+ +   +CG                   NG  Y L YED
Sbjct  275  KVDLRTYSTYQELSCALEKMFSCFTIGQCGSHGAPGKEKLSEIKLRDLLNGSEYVLTYED  334

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ +  R++I++S D
Sbjct  335  KDGDWMLVGDVPWEMFIDTCKRLKIMKSSD  364



>emb|CAN74317.1| hypothetical protein VITISV_013837 [Vitis vinifera]
Length=206

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFA----RYQDQECGKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y  L   L  MF     +Y ++E G NG  YA  YEDK G+W++ GDVPW 
Sbjct  124  KIDLKVYKGYPELLKALEEMFKFSVGQYSERE-GYNGSEYAPTYEDKDGDWMLVGDVPWN  182

Query  175  TFVGSVHRIEILRSGD  222
             F+ S  R+ I++  +
Sbjct  183  MFISSCKRLRIMKGSE  198



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  143  KVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKD  202

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  203  GDWMLVGDVPWEMFVDSCKRLRIMK  227



>gb|KJB38349.1| hypothetical protein B456_006G250900 [Gossypium raimondii]
Length=329

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 9/83 (11%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMFARYQDQECGK---------NGGGYALLYEDKQGNWLV  153
            G K+DL+ ++SY  L + L NMF R    E  +             + L YEDK+G+W++
Sbjct  233  GRKVDLNAHSSYHSLASALENMFLRSAGAEKQQLTMPSRLLDGSSEFVLTYEDKEGDWML  292

Query  154  TGDVPWMTFVGSVHRIEILRSGD  222
             GDVPWM F+ SV R+ I+++ +
Sbjct  293  VGDVPWMMFLTSVRRLRIMKTSE  315



>ref|XP_008455992.1| PREDICTED: auxin-responsive protein IAA16 isoform X2 [Cucumis 
melo]
Length=231

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  132  KVDLKLYGSYKDLSHALAKMFSSFTIGKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKD  191

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  D
Sbjct  192  GDWMLVGDVPWEMFVDSCKRLRIMKESD  219



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 16/88 (18%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL LY SY+ L++ L  MF+ +   +C                  NG  Y   YEDK 
Sbjct  132  KVDLKLYGSYKDLSHALAKMFSSFTIGKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKD  191

Query  139  GNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            G+W++ GDVPW  FV S  R+ I++  D
Sbjct  192  GDWMLVGDVPWEMFVDSCKRLRIMKESD  219



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGG------------------GYALLYED  132
            K+DL  Y++Y+ L++ L  MF+ +   +CG +G                    Y L YED
Sbjct  305  KVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGSEYVLTYED  364

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R+ I++S D
Sbjct  365  KDGDWMLVGDVPWEMFIDSCKRLRIMKSSD  394



>ref|XP_008788132.1| PREDICTED: auxin-induced protein 22D-like [Phoenix dactylifera]
Length=198

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 4/72 (6%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQEC----GKNGGGYALLYEDKQGNWLVTGDVPWM  174
            KIDL +Y  Y+ L   L N+F  +   E     G NG  YA+ YEDK G+W++ GDVPW 
Sbjct  115  KIDLKVYEGYKELRKALENLFKCFSLGELSGMEGCNGSEYAITYEDKDGDWMLVGDVPWE  174

Query  175  TFVGSVHRIEIL  210
             F+ S  R+ I+
Sbjct  175  MFISSCKRLRIM  186



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 18/90 (20%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGKNGG------------------GYALLYED  132
            K+DL  Y++Y+ L++ L  MF+ +   +CG +G                    Y L YED
Sbjct  304  KVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGSEYVLTYED  363

Query  133  KQGNWLVTGDVPWMTFVGSVHRIEILRSGD  222
            K G+W++ GDVPW  F+ S  R+ I++S D
Sbjct  364  KDGDWMLVGDVPWEMFIDSCKRLRIMKSSD  393



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 16/85 (19%)
 Frame = +1

Query  7    KIDLSLYNSYEVLTNDLINMFARYQDQECGK----------------NGGGYALLYEDKQ  138
            K+DL +Y SY+ L++ L  MF+ +    CG                 NG  Y   YEDK 
Sbjct  117  KVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKD  176

Query  139  GNWLVTGDVPWMTFVGSVHRIEILR  213
            G+W++ GDVPW  FV S  R+ I++
Sbjct  177  GDWMLVGDVPWEMFVDSCKRLRIMK  201



>ref|XP_006443729.1| hypothetical protein CICLE_v10021493mg [Citrus clementina]
 ref|XP_006479435.1| PREDICTED: auxin-responsive protein IAA11-like [Citrus sinensis]
 gb|ESR56969.1| hypothetical protein CICLE_v10021493mg [Citrus clementina]
 gb|KDO60348.1| hypothetical protein CISIN_1g023104mg [Citrus sinensis]
Length=287

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = +1

Query  1    GGKIDLSLYNSYEVLTNDLINMF----ARYQDQECGKNG------GGYALLYEDKQGNWL  150
            G KIDL+ +  YE L   L +MF     R   QE  +          Y L YEDK+G+W+
Sbjct  184  GRKIDLNAHGCYESLVQTLEDMFHQPTTRSSVQEPTRPSKLLDGTSDYVLTYEDKEGDWM  243

Query  151  VTGDVPWMTFVGSVHRIEILRSGD  222
            + GDVPW  F+GSV R+ I+R+ +
Sbjct  244  LVGDVPWGMFLGSVKRLRIMRTSE  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600