BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007A05 646 bp,

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP12860.1|  unnamed protein product                                125   2e-33   Coffea canephora [robusta coffee]
gb|EYU24060.1|  hypothetical protein MIMGU_mgv1a017325mg                124   7e-33   Erythranthe guttata [common monkey flower]
ref|XP_010096474.1|  hypothetical protein L484_006721                   115   5e-29   
emb|CAN64856.1|  hypothetical protein VITISV_030491                     112   9e-27   Vitis vinifera
ref|XP_007207520.1|  hypothetical protein PRUPE_ppa013987mg             108   2e-26   
ref|XP_010652886.1|  PREDICTED: uncharacterized protein LOC104879927    107   2e-26   Vitis vinifera
ref|XP_002310621.1|  hypothetical protein POPTR_0007s06990g             105   4e-25   
ref|XP_002530262.1|  conserved hypothetical protein                     102   4e-24   
gb|KDP35289.1|  hypothetical protein JCGZ_09448                       99.8    3e-23   Jatropha curcas
ref|XP_007048178.1|  Uncharacterized protein TCM_001296               99.8    3e-23   
gb|KDO57123.1|  hypothetical protein CISIN_1g034773mg                 99.8    3e-23   Citrus sinensis [apfelsine]
ref|XP_006427923.1|  hypothetical protein CICLE_v10026866mg           98.2    1e-22   
ref|XP_009783266.1|  PREDICTED: uncharacterized protein LOC104231901    105   1e-22   Nicotiana sylvestris
gb|KGN48410.1|  hypothetical protein Csa_6G486830                     95.9    8e-22   Cucumis sativus [cucumbers]
ref|XP_009606571.1|  PREDICTED: uncharacterized protein LOC104100905  94.0    4e-21   
ref|XP_008440092.1|  PREDICTED: uncharacterized protein LOC103484674  93.2    1e-20   
ref|XP_007019583.1|  Mediator of RNA polymerase II transcription ...  90.5    9e-20   
gb|KJB28970.1|  hypothetical protein B456_005G077700                  90.5    1e-19   Gossypium raimondii
ref|XP_002306717.1|  hypothetical protein POPTR_0005s21760g           89.0    3e-19   Populus trichocarpa [western balsam poplar]
gb|KHN09564.1|  hypothetical protein glysoja_011838                   87.8    1e-18   Glycine soja [wild soybean]
ref|XP_004290488.1|  PREDICTED: uncharacterized protein LOC101310479  87.4    2e-18   Fragaria vesca subsp. vesca
ref|XP_003528030.2|  PREDICTED: uncharacterized protein LOC100795724  86.3    4e-18   
gb|EPS71133.1|  hypothetical protein M569_03627                       85.5    6e-18   Genlisea aurea
ref|XP_010062094.1|  PREDICTED: uncharacterized protein LOC104449583  85.9    6e-18   Eucalyptus grandis [rose gum]
ref|XP_006434510.1|  hypothetical protein CICLE_v10003573mg           85.5    6e-18   Citrus clementina [clementine]
emb|CBI18237.3|  unnamed protein product                              86.3    7e-18   Vitis vinifera
gb|KGN45893.1|  hypothetical protein Csa_6G017090                     85.1    1e-17   Cucumis sativus [cucumbers]
ref|XP_010932053.1|  PREDICTED: uncharacterized protein LOC105052817  85.9    1e-17   Elaeis guineensis
ref|XP_002302161.1|  hypothetical protein POPTR_0002s06580g           84.7    1e-17   
gb|KDO83797.1|  hypothetical protein CISIN_1g034641mg                 84.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_009401372.1|  PREDICTED: uncharacterized protein LOC103985414  84.3    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003634523.1|  PREDICTED: uncharacterized protein LOC100854843  83.6    3e-17   Vitis vinifera
ref|XP_007201433.1|  hypothetical protein PRUPE_ppa013713mg           84.0    4e-17   
ref|XP_008237494.1|  PREDICTED: uncharacterized protein LOC103336230  82.4    9e-17   Prunus mume [ume]
gb|EPS65655.1|  hypothetical protein M569_09126                       81.6    1e-16   Genlisea aurea
ref|XP_009349933.1|  PREDICTED: uncharacterized protein LOC103941464  82.0    1e-16   
ref|XP_010097663.1|  hypothetical protein L484_023803                 81.6    2e-16   Morus notabilis
ref|XP_006856469.1|  hypothetical protein AMTR_s00046p00044470        81.3    2e-16   
gb|AFK41103.1|  unknown                                               80.9    4e-16   Lotus japonicus
ref|XP_003556161.1|  PREDICTED: uncharacterized protein LOC100776380  80.5    4e-16   Glycine max [soybeans]
ref|XP_010268571.1|  PREDICTED: uncharacterized protein LOC104605490  80.5    4e-16   
gb|ACU16913.1|  unknown                                               80.1    6e-16   Glycine max [soybeans]
ref|XP_004496440.1|  PREDICTED: uncharacterized protein LOC101513...  80.1    7e-16   
ref|XP_009113577.1|  PREDICTED: uncharacterized protein LOC103838879  79.0    2e-15   Brassica rapa
ref|XP_009764165.1|  PREDICTED: uncharacterized protein LOC104215926  79.0    2e-15   Nicotiana sylvestris
ref|XP_007143570.1|  hypothetical protein PHAVU_007G082800g           78.6    2e-15   Phaseolus vulgaris [French bean]
ref|XP_009403203.1|  PREDICTED: uncharacterized protein LOC103986822  79.3    4e-15   
ref|XP_003592063.1|  hypothetical protein MTR_1g098310                78.2    4e-15   Medicago truncatula
ref|XP_008793904.1|  PREDICTED: uncharacterized protein LOC103710078  77.8    5e-15   
ref|XP_010320114.1|  PREDICTED: uncharacterized protein LOC104647137  77.4    7e-15   
emb|CDX99512.1|  BnaC09g24800D                                        77.4    7e-15   
ref|XP_006656402.1|  PREDICTED: uncharacterized protein LOC102718280  77.4    7e-15   Oryza brachyantha
ref|NP_192727.1|  uncharacterized protein                             76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397132.1|  hypothetical protein EUTSA_v10029196mg           76.6    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009627813.1|  PREDICTED: uncharacterized protein LOC104118301  76.3    2e-14   
gb|EYU36830.1|  hypothetical protein MIMGU_mgv1a017284mg              75.9    2e-14   Erythranthe guttata [common monkey flower]
emb|CDP11432.1|  unnamed protein product                              75.9    2e-14   Coffea canephora [robusta coffee]
ref|XP_006359046.1|  PREDICTED: uncharacterized protein LOC102585655  75.9    2e-14   
ref|XP_002872475.1|  hypothetical protein ARALYDRAFT_489838           75.5    3e-14   Arabidopsis lyrata subsp. lyrata
gb|KFK32039.1|  hypothetical protein AALP_AA6G192400                  75.5    3e-14   Arabis alpina [alpine rockcress]
ref|XP_006288984.1|  hypothetical protein CARUB_v10002358mg           75.5    3e-14   Capsella rubella
ref|NP_001152913.1|  uncharacterized protein LOC100276361             74.7    7e-14   Zea mays [maize]
ref|XP_002524325.1|  conserved hypothetical protein                   74.7    7e-14   
ref|NP_001143448.1|  uncharacterized protein LOC100276103             73.6    2e-13   
ref|XP_011101196.1|  PREDICTED: uncharacterized protein LOC105179276  73.2    2e-13   Sesamum indicum [beniseed]
ref|NP_001058402.1|  Os06g0686600                                     73.6    2e-13   
ref|XP_002438896.1|  hypothetical protein SORBIDRAFT_10g027850        72.8    3e-13   Sorghum bicolor [broomcorn]
ref|XP_011025570.1|  PREDICTED: uncharacterized protein LOC105126...  72.0    8e-13   Populus euphratica
gb|KHN41303.1|  hypothetical protein glysoja_030141                   70.9    1e-12   Glycine soja [wild soybean]
ref|XP_007151977.1|  hypothetical protein PHAVU_004G091400g           70.9    1e-12   Phaseolus vulgaris [French bean]
ref|XP_003563451.1|  PREDICTED: uncharacterized protein LOC100826521  70.5    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_004966250.1|  PREDICTED: uncharacterized protein LOC101782426  69.7    4e-12   Setaria italica
ref|XP_011025569.1|  PREDICTED: uncharacterized protein LOC105126...  70.1    4e-12   Populus euphratica
ref|XP_003518540.1|  PREDICTED: uncharacterized protein LOC100306191  69.3    5e-12   Glycine max [soybeans]
gb|EMT21739.1|  hypothetical protein F775_30902                       68.9    7e-12   
dbj|BAK02428.1|  predicted protein                                    68.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP36568.1|  hypothetical protein JCGZ_08335                       67.4    3e-11   Jatropha curcas
ref|XP_002310616.2|  hypothetical protein POPTR_0007s06990g           67.0    4e-11   
gb|AFW75949.1|  hypothetical protein ZEAMMB73_654440                  65.1    1e-10   
ref|XP_002521377.1|  conserved hypothetical protein                   62.0    4e-09   
ref|XP_006369261.1|  hypothetical protein POPTR_0001s20460g           61.6    5e-09   
ref|XP_010536185.1|  PREDICTED: uncharacterized protein LOC104811234  61.2    5e-09   Tarenaya hassleriana [spider flower]
gb|KHN32708.1|  hypothetical protein glysoja_022390                   61.2    5e-09   Glycine soja [wild soybean]
gb|KHN30067.1|  hypothetical protein glysoja_010445                   61.2    5e-09   Glycine soja [wild soybean]
ref|XP_010087710.1|  hypothetical protein L484_013472                 60.8    8e-09   Morus notabilis
ref|XP_007150492.1|  hypothetical protein PHAVU_005G157200g           60.8    8e-09   Phaseolus vulgaris [French bean]
ref|XP_010262040.1|  PREDICTED: uncharacterized protein LOC104600664  60.8    8e-09   
ref|XP_007024534.1|  Uncharacterized protein TCM_029075               60.8    9e-09   
gb|AGV54821.1|  hypothetical protein                                  60.8    1e-08   Phaseolus vulgaris [French bean]
gb|KHN29707.1|  hypothetical protein glysoja_016329                   60.5    1e-08   Glycine soja [wild soybean]
ref|XP_004486852.1|  PREDICTED: uncharacterized protein LOC101489777  60.1    1e-08   Cicer arietinum [garbanzo]
ref|NP_001235166.1|  uncharacterized protein LOC100305934             60.1    2e-08   Glycine max [soybeans]
ref|XP_002873541.1|  hypothetical protein ARALYDRAFT_488039           59.7    2e-08   
ref|NP_196758.1|  uncharacterized protein                             59.7    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235259.1|  uncharacterized protein LOC100305940             60.1    2e-08   
ref|XP_006855324.1|  hypothetical protein AMTR_s00057p00084630        59.7    2e-08   
ref|XP_008462341.1|  PREDICTED: uncharacterized protein LOC103500715  59.7    2e-08   
ref|XP_008793205.1|  PREDICTED: uncharacterized protein LOC103709...  60.5    2e-08   
ref|XP_004507952.1|  PREDICTED: uncharacterized protein LOC101497454  60.1    2e-08   Cicer arietinum [garbanzo]
ref|XP_008793204.1|  PREDICTED: uncharacterized protein LOC103709...  60.5    2e-08   
ref|NP_001051794.1|  Os03g0831400                                     58.5    3e-08   
ref|XP_010925470.1|  PREDICTED: uncharacterized protein LOC105047996  59.3    3e-08   
ref|XP_004141806.1|  PREDICTED: uncharacterized protein LOC101209615  59.3    3e-08   Cucumis sativus [cucumbers]
gb|KFK25455.1|  hypothetical protein AALP_AA8G117500                  58.9    4e-08   Arabis alpina [alpine rockcress]
ref|XP_006290018.1|  hypothetical protein CARUB_v10003648mg           58.5    4e-08   Capsella rubella
gb|AFK48123.1|  unknown                                               58.9    4e-08   Lotus japonicus
ref|XP_002277637.1|  PREDICTED: uncharacterized protein LOC100267009  58.9    4e-08   Vitis vinifera
ref|NP_001236294.1|  uncharacterized protein LOC100305758             58.9    5e-08   
emb|CDX69715.1|  BnaA10g20640D                                        58.5    5e-08   
ref|XP_009121895.1|  PREDICTED: uncharacterized protein LOC103846677  58.5    5e-08   Brassica rapa
gb|KHN39325.1|  hypothetical protein glysoja_018097                   58.5    6e-08   Glycine soja [wild soybean]
gb|KDP40744.1|  hypothetical protein JCGZ_24743                       58.5    6e-08   Jatropha curcas
emb|CDX70437.1|  BnaC03g05210D                                        58.2    6e-08   
gb|KJB56940.1|  hypothetical protein B456_009G142700                  58.2    7e-08   Gossypium raimondii
ref|XP_003597563.1|  hypothetical protein MTR_2g099630                58.2    8e-08   
ref|XP_010915301.1|  PREDICTED: uncharacterized protein LOC105040464  58.2    8e-08   Elaeis guineensis
ref|XP_009397468.1|  PREDICTED: uncharacterized protein LOC103982302  58.2    8e-08   
ref|XP_008791272.1|  PREDICTED: uncharacterized protein LOC103708229  58.2    9e-08   
ref|XP_009131248.1|  PREDICTED: uncharacterized protein LOC103855949  57.8    9e-08   Brassica rapa
gb|KJB65518.1|  hypothetical protein B456_010G098600                  57.8    9e-08   Gossypium raimondii
ref|XP_006842334.1|  hypothetical protein AMTR_s00079p00164570        57.4    1e-07   
ref|NP_001237797.1|  uncharacterized protein LOC100527044             57.8    1e-07   
emb|CDX97159.1|  BnaC09g44660D                                        57.4    1e-07   
ref|XP_006387696.1|  hypothetical protein POPTR_0667s00200g           57.8    1e-07   
ref|XP_006399717.1|  hypothetical protein EUTSA_v10015080mg           57.4    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010090075.1|  hypothetical protein L484_027306                 57.8    1e-07   Morus notabilis
gb|AEW08166.1|  hypothetical protein 2_1728_01                        57.4    1e-07   Pinus radiata
gb|AFG44226.1|  hypothetical protein 2_1728_01                        57.4    1e-07   Pinus taeda
ref|XP_002976822.1|  hypothetical protein SELMODRAFT_105899           57.0    1e-07   
ref|NP_001239917.1|  uncharacterized protein LOC100818486             57.4    1e-07   Glycine max [soybeans]
ref|XP_006465997.1|  PREDICTED: uncharacterized protein LOC102621718  57.4    1e-07   
ref|XP_009631852.1|  PREDICTED: uncharacterized protein LOC104121539  57.0    2e-07   
ref|XP_007136845.1|  hypothetical protein PHAVU_009G079000g           57.4    2e-07   Phaseolus vulgaris [French bean]
ref|XP_007135522.1|  hypothetical protein PHAVU_010G136400g           57.0    2e-07   Phaseolus vulgaris [French bean]
gb|ABK21328.1|  unknown                                               57.0    2e-07   Picea sitchensis
gb|KJB54405.1|  hypothetical protein B456_009G032700                  57.0    2e-07   Gossypium raimondii
ref|XP_006426586.1|  hypothetical protein CICLE_v10026799mg           57.0    2e-07   
ref|XP_007012782.1|  Uncharacterized protein TCM_037625               57.0    2e-07   
ref|XP_009334737.1|  PREDICTED: uncharacterized protein LOC103927523  57.0    2e-07   Pyrus x bretschneideri [bai li]
gb|ABK22684.1|  unknown                                               56.6    2e-07   Picea sitchensis
gb|EYU29346.1|  hypothetical protein MIMGU_mgv1a024776mg              56.6    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004157365.1|  PREDICTED: uncharacterized protein LOC101228...  56.6    2e-07   
gb|KCW81706.1|  hypothetical protein EUGRSUZ_C03059                   57.0    3e-07   Eucalyptus grandis [rose gum]
ref|XP_008393620.1|  PREDICTED: uncharacterized protein LOC103455808  56.6    3e-07   Malus domestica [apple tree]
ref|XP_009362205.1|  PREDICTED: uncharacterized protein LOC103952357  56.6    3e-07   Pyrus x bretschneideri [bai li]
gb|KJB54658.1|  hypothetical protein B456_009G043500                  56.6    3e-07   Gossypium raimondii
ref|NP_001060710.1|  Os07g0690200                                     55.8    3e-07   
ref|XP_010491951.1|  PREDICTED: uncharacterized protein LOC104769433  55.8    4e-07   Camelina sativa [gold-of-pleasure]
emb|CDP03142.1|  unnamed protein product                              56.2    4e-07   Coffea canephora [robusta coffee]
ref|XP_009125840.1|  PREDICTED: uncharacterized protein LOC103850805  55.8    4e-07   Brassica rapa
ref|XP_010453260.1|  PREDICTED: uncharacterized protein LOC104735212  55.8    4e-07   Camelina sativa [gold-of-pleasure]
gb|KHN17682.1|  hypothetical protein glysoja_005879                   56.2    4e-07   Glycine soja [wild soybean]
ref|NP_001239845.1|  uncharacterized protein LOC100799273             55.8    4e-07   Glycine max [soybeans]
gb|EMT32572.1|  hypothetical protein F775_29998                       56.2    4e-07   
ref|NP_001236822.1|  uncharacterized protein LOC100527749             56.2    5e-07   
emb|CDM82593.1|  unnamed protein product                              56.2    5e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010419781.1|  PREDICTED: uncharacterized protein LOC104705466  55.8    5e-07   Camelina sativa [gold-of-pleasure]
gb|KGN47609.1|  hypothetical protein Csa_6G364115                     55.5    5e-07   Cucumis sativus [cucumbers]
ref|XP_003603170.1|  hypothetical protein MTR_3g104640                55.8    5e-07   Medicago truncatula
ref|XP_007154634.1|  hypothetical protein PHAVU_003G135000g           55.8    5e-07   Phaseolus vulgaris [French bean]
ref|XP_010242270.1|  PREDICTED: uncharacterized protein LOC104586667  55.8    6e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009388679.1|  PREDICTED: uncharacterized protein LOC103975440  55.8    6e-07   
ref|XP_009372399.1|  PREDICTED: uncharacterized protein LOC103961551  55.8    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_008391355.1|  PREDICTED: uncharacterized protein LOC103453586  55.8    7e-07   Malus domestica [apple tree]
emb|CDP08289.1|  unnamed protein product                              56.2    7e-07   Coffea canephora [robusta coffee]
ref|XP_002304103.1|  hypothetical protein POPTR_0003s04160g           55.5    7e-07   Populus trichocarpa [western balsam poplar]
gb|KFK41693.1|  hypothetical protein AALP_AA2G160700                  55.5    8e-07   Arabis alpina [alpine rockcress]
gb|AFO66519.1|  putative ABC superfamily ATP binding cassette tra...  58.2    8e-07   Brassica napus [oilseed rape]
ref|XP_007204834.1|  hypothetical protein PRUPE_ppa026980mg           55.5    9e-07   
ref|XP_008220505.1|  PREDICTED: uncharacterized protein LOC103320582  55.5    9e-07   Prunus mume [ume]
ref|XP_007223475.1|  hypothetical protein PRUPE_ppa013495mg           55.1    9e-07   Prunus persica
ref|XP_009785242.1|  PREDICTED: uncharacterized protein LOC104233535  55.1    9e-07   Nicotiana sylvestris
emb|CCM07289.1|  Chromosome chr9 scaffold_7, whole genome shotgun...  55.8    9e-07   Musa balbisiana [starchy banana]
ref|XP_004247381.1|  PREDICTED: uncharacterized protein LOC101261064  55.8    1e-06   
gb|KGN52839.1|  hypothetical protein Csa_4G002560                     54.7    1e-06   Cucumis sativus [cucumbers]
gb|KEH39921.1|  DUF3511 domain protein                                55.1    1e-06   Medicago truncatula
gb|KJB74840.1|  hypothetical protein B456_012G010400                  56.2    1e-06   Gossypium raimondii
ref|XP_002519185.1|  conserved hypothetical protein                   55.1    1e-06   Ricinus communis
ref|XP_006575776.1|  PREDICTED: uncharacterized protein LOC102665932  54.7    1e-06   
ref|XP_008242377.1|  PREDICTED: uncharacterized protein LOC103340711  55.5    1e-06   Prunus mume [ume]
gb|KJB68771.1|  hypothetical protein B456_011G063500                  55.1    1e-06   Gossypium raimondii
dbj|BAJ85795.1|  predicted protein                                    54.3    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001236849.1|  uncharacterized protein LOC100306567             54.7    1e-06   
ref|XP_007215163.1|  hypothetical protein PRUPE_ppa013537mg           54.7    1e-06   Prunus persica
ref|XP_008228257.1|  PREDICTED: uncharacterized protein LOC103327672  54.7    1e-06   Prunus mume [ume]
ref|XP_009604506.1|  PREDICTED: uncharacterized protein LOC104099...  54.3    1e-06   Nicotiana tomentosiformis
ref|XP_009105933.1|  PREDICTED: uncharacterized protein LOC103831776  54.7    1e-06   
gb|KHN06628.1|  hypothetical protein glysoja_040133                   54.7    1e-06   Glycine soja [wild soybean]
ref|XP_010094301.1|  hypothetical protein L484_000591                 54.7    1e-06   
ref|XP_006357712.1|  PREDICTED: uncharacterized protein LOC102593175  55.1    1e-06   Solanum tuberosum [potatoes]
gb|KDP33854.1|  hypothetical protein JCGZ_07425                       54.7    2e-06   Jatropha curcas
gb|EAY89674.1|  hypothetical protein OsI_11208                        55.1    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009604505.1|  PREDICTED: uncharacterized protein LOC104099...  54.3    2e-06   Nicotiana tomentosiformis
gb|EAY89670.1|  hypothetical protein OsI_11203                        55.1    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009604502.1|  PREDICTED: uncharacterized protein LOC104099...  54.3    2e-06   
ref|XP_002281323.1|  PREDICTED: uncharacterized protein LOC100266443  54.3    2e-06   Vitis vinifera
ref|XP_006359891.1|  PREDICTED: uncharacterized protein LOC102586099  54.3    2e-06   Solanum tuberosum [potatoes]
ref|XP_007161038.1|  hypothetical protein PHAVU_001G037600g           54.3    2e-06   Phaseolus vulgaris [French bean]
gb|EYU45868.1|  hypothetical protein MIMGU_mgv1a024058mg              54.3    2e-06   Erythranthe guttata [common monkey flower]
emb|CBI27887.3|  unnamed protein product                              54.7    2e-06   Vitis vinifera
ref|XP_008665723.1|  PREDICTED: uncharacterized protein LOC100274746  53.5    2e-06   Zea mays [maize]
ref|XP_004243747.1|  PREDICTED: uncharacterized protein LOC101265147  54.3    2e-06   Solanum lycopersicum
ref|XP_003544544.1|  PREDICTED: uncharacterized protein LOC100780149  54.3    2e-06   Glycine max [soybeans]
gb|AFK43847.1|  unknown                                               54.3    2e-06   Lotus japonicus
ref|XP_002516091.1|  conserved hypothetical protein                   54.3    2e-06   Ricinus communis
ref|XP_010519843.1|  PREDICTED: uncharacterized protein LOC104799158  53.9    2e-06   Tarenaya hassleriana [spider flower]
gb|ADE76925.1|  unknown                                               53.9    2e-06   Picea sitchensis
ref|XP_008338712.1|  PREDICTED: uncharacterized protein LOC103401770  54.3    3e-06   Malus domestica [apple tree]
ref|XP_004968999.1|  PREDICTED: uncharacterized protein LOC101766251  53.9    3e-06   Setaria italica
ref|XP_010049210.1|  PREDICTED: uncharacterized protein LOC104437857  53.9    3e-06   Eucalyptus grandis [rose gum]
dbj|BAK04906.1|  predicted protein                                    53.9    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010924971.1|  PREDICTED: uncharacterized protein LOC105047646  53.9    3e-06   Elaeis guineensis
gb|AFK37685.1|  unknown                                               53.9    3e-06   Medicago truncatula
ref|XP_008463430.1|  PREDICTED: uncharacterized protein LOC103501594  53.5    3e-06   
gb|KDP28226.1|  hypothetical protein JCGZ_13997                       53.5    3e-06   Jatropha curcas
ref|XP_006480043.1|  PREDICTED: uncharacterized protein LOC102625735  53.5    3e-06   Citrus sinensis [apfelsine]
ref|XP_006474426.1|  PREDICTED: uncharacterized protein LOC102623546  53.9    4e-06   Citrus sinensis [apfelsine]
ref|XP_004501457.1|  PREDICTED: uncharacterized protein LOC101508769  53.1    4e-06   Cicer arietinum [garbanzo]
ref|XP_009615642.1|  PREDICTED: uncharacterized protein LOC104108337  53.1    4e-06   
ref|NP_001049870.1|  Os03g0302500                                     53.5    4e-06   
emb|CDX72939.1|  BnaC06g33870D                                        56.2    5e-06   
ref|XP_010555044.1|  PREDICTED: uncharacterized protein LOC104824634  53.1    5e-06   Tarenaya hassleriana [spider flower]
ref|XP_002514131.1|  conserved hypothetical protein                   53.5    5e-06   
ref|XP_008806936.1|  PREDICTED: uncharacterized protein LOC103719460  53.1    5e-06   
ref|XP_009768396.1|  PREDICTED: uncharacterized protein LOC104219405  53.1    5e-06   Nicotiana sylvestris
ref|XP_011079982.1|  PREDICTED: uncharacterized protein LOC105163364  53.1    5e-06   Sesamum indicum [beniseed]
ref|XP_011100119.1|  PREDICTED: uncharacterized protein LOC105178320  53.1    5e-06   Sesamum indicum [beniseed]
ref|XP_009790773.1|  PREDICTED: uncharacterized protein LOC104238174  53.1    5e-06   Nicotiana sylvestris
ref|XP_010648337.1|  PREDICTED: uncharacterized protein LOC104878982  53.1    5e-06   Vitis vinifera
ref|NP_001235468.1|  uncharacterized protein LOC100500259             53.1    5e-06   Glycine max [soybeans]
emb|CDY68148.1|  BnaA07g38930D                                        56.2    5e-06   Brassica napus [oilseed rape]
ref|XP_008347501.1|  PREDICTED: uncharacterized protein LOC103410594  53.1    5e-06   Malus domestica [apple tree]
ref|XP_006390627.1|  hypothetical protein EUTSA_v10019700mg           53.1    5e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008795587.1|  PREDICTED: uncharacterized protein LOC103711279  54.7    5e-06   Phoenix dactylifera
ref|XP_009604760.1|  PREDICTED: uncharacterized protein LOC104099460  53.1    5e-06   Nicotiana tomentosiformis
ref|XP_006444450.1|  hypothetical protein CICLE_v10022952mg           52.8    6e-06   Citrus clementina [clementine]
ref|XP_004144117.1|  PREDICTED: uncharacterized protein LOC101207995  53.1    6e-06   Cucumis sativus [cucumbers]
ref|XP_004981181.1|  PREDICTED: uncharacterized protein LOC101770664  52.0    6e-06   
ref|XP_009349378.1|  PREDICTED: uncharacterized protein LOC103940922  53.1    6e-06   Pyrus x bretschneideri [bai li]
gb|KDO71833.1|  hypothetical protein CISIN_1g039223mg                 52.8    6e-06   Citrus sinensis [apfelsine]
ref|XP_010240664.1|  PREDICTED: uncharacterized protein LOC100827619  52.0    7e-06   
ref|XP_003569228.1|  PREDICTED: uncharacterized protein LOC100838787  52.8    7e-06   Brachypodium distachyon [annual false brome]
gb|AFK46816.1|  unknown                                               52.8    7e-06   Medicago truncatula
ref|XP_008337723.1|  PREDICTED: uncharacterized protein LOC103400824  52.8    7e-06   
ref|XP_009395779.1|  PREDICTED: uncharacterized protein LOC103980958  52.4    7e-06   
ref|XP_009393998.1|  PREDICTED: uncharacterized protein LOC103979549  52.4    7e-06   
ref|XP_006650843.1|  PREDICTED: uncharacterized protein LOC102721534  52.0    8e-06   
ref|XP_001772172.1|  predicted protein                                51.6    8e-06   
dbj|BAJ86995.1|  predicted protein                                    52.8    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004305730.1|  PREDICTED: uncharacterized protein LOC101302578  53.1    8e-06   Fragaria vesca subsp. vesca
ref|XP_003558099.1|  PREDICTED: uncharacterized protein LOC100839633  52.4    8e-06   Brachypodium distachyon [annual false brome]
ref|XP_006453069.1|  hypothetical protein CICLE_v10009512mg           53.9    8e-06   
gb|KDP34075.1|  hypothetical protein JCGZ_07646                       52.8    9e-06   Jatropha curcas
ref|XP_009383877.1|  PREDICTED: uncharacterized protein LOC103971526  52.4    9e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009361636.1|  PREDICTED: uncharacterized protein LOC103951883  52.8    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_006644258.1|  PREDICTED: secretory carrier-associated memb...  52.8    9e-06   Oryza brachyantha
ref|XP_006300157.1|  hypothetical protein CARUB_v10016388mg           52.4    9e-06   Capsella rubella
gb|EMT21863.1|  hypothetical protein F775_09219                       52.4    1e-05   
ref|XP_008450877.1|  PREDICTED: uncharacterized protein LOC103492339  52.4    1e-05   Cucumis melo [Oriental melon]
ref|XP_008777406.1|  PREDICTED: uncharacterized protein LOC103697342  52.4    1e-05   
ref|XP_003627161.1|  hypothetical protein MTR_8g018320                52.0    1e-05   Medicago truncatula
gb|KFK37980.1|  hypothetical protein AALP_AA3G054700                  52.4    1e-05   Arabis alpina [alpine rockcress]
emb|CBI22920.3|  unnamed protein product                              52.0    1e-05   Vitis vinifera
ref|XP_010909465.1|  PREDICTED: uncharacterized protein LOC105035542  52.4    1e-05   Elaeis guineensis
gb|KCW69787.1|  hypothetical protein EUGRSUZ_F03151                   52.0    1e-05   Eucalyptus grandis [rose gum]
ref|XP_009798254.1|  PREDICTED: uncharacterized protein LOC104244511  52.0    1e-05   Nicotiana sylvestris
ref|XP_009411641.1|  PREDICTED: uncharacterized protein LOC103993342  52.4    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010062657.1|  PREDICTED: uncharacterized protein LOC104449994  52.0    1e-05   Eucalyptus grandis [rose gum]
emb|CDY65871.1|  BnaAnng21200D                                        54.7    1e-05   Brassica napus [oilseed rape]
ref|XP_006408036.1|  hypothetical protein EUTSA_v10021773mg           52.0    1e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010934645.1|  PREDICTED: uncharacterized protein LOC105054753  51.6    2e-05   
ref|XP_009631543.1|  PREDICTED: uncharacterized protein LOC104121292  52.0    2e-05   
ref|XP_002308546.1|  hypothetical protein POPTR_0006s24240g           52.0    2e-05   
ref|XP_004958777.1|  PREDICTED: uncharacterized protein LOC101779282  50.8    2e-05   
ref|XP_004984650.1|  PREDICTED: histone acetyltransferase KAT2A-like  52.0    2e-05   Setaria italica
ref|XP_008670679.1|  PREDICTED: uncharacterized protein LOC100277467  50.8    2e-05   Zea mays [maize]
ref|XP_011003342.1|  PREDICTED: uncharacterized protein LOC105110111  51.6    2e-05   Populus euphratica
ref|XP_002308279.1|  hypothetical protein POPTR_0006s14990g           51.6    2e-05   
ref|XP_011460334.1|  PREDICTED: uncharacterized protein LOC101305515  51.6    2e-05   Fragaria vesca subsp. vesca
ref|XP_006351591.1|  PREDICTED: uncharacterized protein LOC102597557  51.2    2e-05   
ref|NP_001043368.1|  Os01g0567400                                     52.0    2e-05   
ref|XP_009400543.1|  PREDICTED: uncharacterized protein LOC103984712  51.6    2e-05   
ref|XP_011093755.1|  PREDICTED: uncharacterized protein LOC105173634  52.0    2e-05   
ref|XP_003567593.1|  PREDICTED: uncharacterized protein LOC100833683  50.8    2e-05   
gb|EMS67616.1|  hypothetical protein TRIUR3_01571                     50.8    2e-05   
ref|XP_011100834.1|  PREDICTED: uncharacterized protein LOC105178940  51.6    2e-05   
ref|XP_002888889.1|  hypothetical protein ARALYDRAFT_895124           51.6    2e-05   
gb|EMT01255.1|  hypothetical protein F775_42536                       50.4    2e-05   
ref|XP_010659680.1|  PREDICTED: uncharacterized protein LOC104881367  50.8    2e-05   
dbj|BAB63494.1|  hypothetical protein                                 52.8    3e-05   
ref|XP_010696535.1|  PREDICTED: uncharacterized protein LOC104909...  52.0    3e-05   
ref|NP_177416.1|  uncharacterized protein                             51.2    3e-05   
ref|XP_010685354.1|  PREDICTED: myosin-G heavy chain-like             51.6    3e-05   
ref|XP_002515317.1|  conserved hypothetical protein                   51.2    3e-05   
ref|XP_007035731.1|  Uncharacterized protein TCM_021313               51.2    3e-05   
gb|KDP27881.1|  hypothetical protein JCGZ_18961                       51.2    3e-05   
gb|EPS68829.1|  hypothetical protein M569_05942                       50.8    3e-05   
ref|NP_001142901.1|  uncharacterized protein LOC100275329             50.8    3e-05   
ref|XP_004498869.1|  PREDICTED: uncharacterized protein LOC101498614  50.8    3e-05   
ref|XP_006853891.1|  hypothetical protein AMTR_s00036p00155950        50.8    3e-05   
ref|XP_006588581.1|  PREDICTED: uncharacterized protein LOC102660183  50.4    3e-05   
ref|NP_182270.1|  uncharacterized protein                             50.8    4e-05   
ref|XP_002882120.1|  hypothetical protein ARALYDRAFT_904223           50.8    4e-05   
gb|AFW83054.1|  hypothetical protein ZEAMMB73_749542                  50.8    4e-05   
ref|XP_006382419.1|  hypothetical protein POPTR_0005s01980g           50.1    4e-05   
gb|KJB06767.1|  hypothetical protein B456_001G013200                  50.4    4e-05   
ref|XP_007051058.1|  Uncharacterized protein TCM_004766               50.4    4e-05   
ref|XP_009124308.1|  PREDICTED: uncharacterized protein LOC103849252  50.4    4e-05   
ref|XP_010069874.1|  PREDICTED: uncharacterized protein LOC104456719  50.4    5e-05   
gb|AFW88628.1|  hypothetical protein ZEAMMB73_822579                  52.0    5e-05   
emb|CDY60739.1|  BnaA07g35980D                                        50.4    5e-05   
ref|XP_009382510.1|  PREDICTED: uncharacterized protein LOC103970456  50.8    5e-05   
ref|XP_006346016.1|  PREDICTED: uncharacterized protein LOC102600018  50.1    5e-05   
ref|XP_010259381.1|  PREDICTED: uncharacterized protein LOC104598840  50.1    5e-05   
ref|XP_010428169.1|  PREDICTED: uncharacterized protein LOC104712878  50.4    6e-05   
gb|AAM63039.1|  unknown                                               50.1    6e-05   
ref|XP_009606358.1|  PREDICTED: uncharacterized protein LOC104100753  50.8    6e-05   
ref|XP_010325025.1|  PREDICTED: uncharacterized protein LOC101255120  50.1    6e-05   
gb|EMS61658.1|  hypothetical protein TRIUR3_19887                     52.0    6e-05   
ref|XP_009414906.1|  PREDICTED: uncharacterized protein LOC103995897  50.1    6e-05   
ref|XP_002457733.1|  hypothetical protein SORBIDRAFT_03g012560        49.3    6e-05   
ref|NP_191823.1|  uncharacterized protein                             50.1    6e-05   
ref|XP_010471303.1|  PREDICTED: uncharacterized protein LOC104751120  50.4    6e-05   
ref|XP_003627165.1|  hypothetical protein MTR_8g018360                51.2    6e-05   
ref|XP_001766447.1|  predicted protein                                49.7    6e-05   
ref|XP_002467994.1|  hypothetical protein SORBIDRAFT_01g037750        51.2    6e-05   
ref|XP_010064327.1|  PREDICTED: uncharacterized protein LOC104451328  50.1    6e-05   
ref|XP_010416035.1|  PREDICTED: uncharacterized protein LOC104701955  50.4    7e-05   
gb|KFK35432.1|  hypothetical protein AALP_AA5G283700                  50.1    7e-05   
ref|XP_006302957.1|  hypothetical protein CARUB_v10021141mg           50.4    7e-05   
ref|NP_001145511.1|  uncharacterized protein LOC100278919             49.7    8e-05   
gb|KGN47400.1|  hypothetical protein Csa_6G312030                     49.3    8e-05   
ref|NP_001144614.1|  hypothetical protein                             49.7    9e-05   
ref|XP_002458020.1|  hypothetical protein SORBIDRAFT_03g025590        49.7    9e-05   
ref|XP_003625948.1|  hypothetical protein MTR_7g109290                49.3    9e-05   
ref|XP_010047362.1|  PREDICTED: uncharacterized protein LOC104436321  49.7    1e-04   
gb|KJB49853.1|  hypothetical protein B456_008G141600                  49.3    1e-04   
ref|XP_008660225.1|  PREDICTED: uncharacterized protein LOC103639235  49.7    1e-04   
ref|XP_010486048.1|  PREDICTED: uncharacterized protein LOC104764246  49.7    1e-04   
ref|NP_001143497.1|  uncharacterized protein LOC100276175             49.7    1e-04   
emb|CDO98797.1|  unnamed protein product                              49.7    1e-04   
tpg|DAA58612.1|  TPA: hypothetical protein ZEAMMB73_794061            49.7    1e-04   
ref|XP_004252514.1|  PREDICTED: uncharacterized protein LOC101264299  49.3    1e-04   
ref|NP_974231.2|  uncharacterized protein                             49.7    1e-04   
ref|XP_006409054.1|  hypothetical protein EUTSA_v10022917mg           49.3    1e-04   
emb|CDY01400.1|  BnaA07g11730D                                        49.3    1e-04   
ref|XP_009124862.1|  PREDICTED: uncharacterized protein LOC103849905  49.3    1e-04   
ref|XP_009147213.1|  PREDICTED: uncharacterized protein LOC103870800  49.3    1e-04   
ref|XP_002466150.1|  hypothetical protein SORBIDRAFT_01g002260        51.6    1e-04   
emb|CDY70409.1|  BnaC07g48510D                                        48.9    2e-04   
ref|XP_010534919.1|  PREDICTED: uncharacterized protein LOC104810357  48.9    2e-04   
emb|CDX97527.1|  BnaA05g25520D                                        48.5    2e-04   
ref|XP_009146434.1|  PREDICTED: uncharacterized protein LOC103870083  48.5    2e-04   
ref|XP_010548664.1|  PREDICTED: uncharacterized protein LOC104820019  48.9    2e-04   
ref|NP_001174850.1|  Os06g0564000                                     49.3    2e-04   
dbj|BAJ91043.1|  predicted protein                                    49.3    2e-04   
ref|XP_010415380.1|  PREDICTED: uncharacterized protein LOC104701397  48.9    2e-04   
ref|XP_010464119.1|  PREDICTED: uncharacterized protein LOC104744722  48.9    2e-04   
ref|XP_010467892.1|  PREDICTED: uncharacterized protein LOC104747880  48.9    2e-04   
ref|XP_009757028.1|  PREDICTED: uncharacterized protein LOC104209953  48.9    2e-04   
emb|CDX75738.1|  BnaC03g38210D                                        48.1    2e-04   
gb|EMT06359.1|  hypothetical protein F775_27242                       48.5    2e-04   
ref|XP_010489479.1|  PREDICTED: uncharacterized protein LOC104767140  48.9    2e-04   
gb|EYU27325.1|  hypothetical protein MIMGU_mgv1a015597mg              49.3    2e-04   
emb|CDX82506.1|  BnaA03g33150D                                        48.1    2e-04   
ref|XP_011041610.1|  PREDICTED: uncharacterized protein LOC105137530  48.5    2e-04   
ref|NP_565454.1|  uncharacterized protein                             48.5    3e-04   
ref|XP_006298832.1|  hypothetical protein CARUB_v10014938mg           48.5    3e-04   
ref|XP_009135339.1|  PREDICTED: uncharacterized protein LOC103859543  48.1    3e-04   
ref|XP_002320985.1|  hypothetical protein POPTR_0014s11870g           48.1    3e-04   
emb|CDX91184.1|  BnaC02g04130D                                        50.8    3e-04   
ref|XP_002886038.1|  hypothetical protein ARALYDRAFT_480527           48.5    3e-04   
ref|XP_009103383.1|  PREDICTED: uncharacterized protein LOC103829480  49.3    3e-04   
ref|XP_006407150.1|  hypothetical protein EUTSA_v10021809mg           48.1    3e-04   
ref|XP_006298859.1|  hypothetical protein CARUB_v10014974mg           48.1    3e-04   
ref|XP_004494931.1|  PREDICTED: uncharacterized protein LOC101493503  47.8    3e-04   
ref|XP_004510407.1|  PREDICTED: uncharacterized protein LOC101489793  48.1    3e-04   
ref|XP_003591456.1|  hypothetical protein MTR_1g087730                48.1    3e-04   
ref|XP_002884996.1|  hypothetical protein ARALYDRAFT_478797           48.1    3e-04   
ref|NP_566468.1|  uncharacterized protein                             48.1    3e-04   
gb|KFK38741.1|  hypothetical protein AALP_AA3G154900                  48.1    3e-04   
emb|CDY37497.1|  BnaC01g37350D                                        48.5    3e-04   
emb|CDX86889.1|  BnaA09g22790D                                        48.1    3e-04   
gb|AAM62985.1|  unknown                                               47.8    3e-04   
gb|ACG47193.1|  hypothetical protein                                  47.0    3e-04   
ref|XP_010487168.1|  PREDICTED: uncharacterized protein LOC104765...  48.1    3e-04   
ref|XP_004962365.1|  PREDICTED: nucleosome-remodeling factor subu...  48.9    4e-04   
ref|XP_010501435.1|  PREDICTED: uncharacterized protein LOC104778683  48.1    4e-04   
emb|CDO97888.1|  unnamed protein product                              48.1    4e-04   
ref|XP_010544986.1|  PREDICTED: uncharacterized protein LOC104817471  47.8    4e-04   
ref|XP_010465265.1|  PREDICTED: uncharacterized protein LOC104745659  47.8    4e-04   
gb|KHN43477.1|  hypothetical protein glysoja_002060                   47.4    4e-04   
ref|XP_010468934.1|  PREDICTED: uncharacterized protein LOC104749060  47.8    4e-04   
ref|XP_002440938.1|  hypothetical protein SORBIDRAFT_09g017240        48.9    4e-04   
ref|XP_009127946.1|  PREDICTED: uncharacterized protein LOC103852796  48.1    4e-04   
emb|CDY49860.1|  BnaA02g16090D                                        48.1    4e-04   
ref|XP_008807777.1|  PREDICTED: uncharacterized protein LOC103720035  48.9    5e-04   
emb|CDY39078.1|  BnaA01g29780D                                        47.8    5e-04   
emb|CDP20384.1|  unnamed protein product                              47.4    5e-04   
ref|XP_010512660.1|  PREDICTED: uncharacterized protein LOC104788595  47.8    5e-04   
ref|NP_001144166.1|  uncharacterized protein LOC100277021             48.5    5e-04   
ref|XP_010696536.1|  PREDICTED: uncharacterized protein LOC104909...  47.8    5e-04   
gb|ACN28073.1|  unknown                                               48.5    5e-04   
ref|NP_001142511.1|  uncharacterized protein LOC100274747             48.5    5e-04   
ref|XP_006475485.1|  PREDICTED: uncharacterized protein LOC102618796  47.8    5e-04   
gb|KFK40307.1|  hypothetical protein AALP_AA3G358000                  47.4    6e-04   
ref|NP_001055294.1|  Os05g0356800                                     48.1    6e-04   
gb|KGN56136.1|  hypothetical protein Csa_3G077700                     47.4    6e-04   
ref|XP_010268118.1|  PREDICTED: uncharacterized protein LOC104605179  47.4    6e-04   
ref|XP_008797410.1|  PREDICTED: uncharacterized protein LOC103712620  47.4    6e-04   
ref|XP_010413260.1|  PREDICTED: uncharacterized protein LOC104699622  47.4    6e-04   
ref|XP_010652227.1|  PREDICTED: uncharacterized protein LOC104879791  47.4    6e-04   
ref|XP_007163161.1|  hypothetical protein PHAVU_001G211500g           47.0    6e-04   
ref|XP_010914527.1|  PREDICTED: uncharacterized protein LOC105039905  47.4    6e-04   
ref|XP_006451506.1|  hypothetical protein CICLE_v10009884mg           47.8    6e-04   
ref|XP_002878468.1|  hypothetical protein ARALYDRAFT_907837           47.0    7e-04   
ref|XP_006604736.1|  PREDICTED: uncharacterized protein LOC100807345  47.0    7e-04   
gb|EYU20336.1|  hypothetical protein MIMGU_mgv1a024114mg              47.4    7e-04   
gb|AAF19806.1|  putative protein                                      47.4    7e-04   
gb|KHN19229.1|  hypothetical protein glysoja_041581                   46.2    9e-04   
ref|XP_004495923.1|  PREDICTED: uncharacterized protein LOC101510036  46.6    9e-04   
ref|XP_006293045.1|  hypothetical protein CARUB_v10019325mg           47.0    0.001   



>emb|CDP12860.1| unnamed protein product [Coffea canephora]
Length=79

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 3/82 (4%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKF  234
            MEK KSFPY+S+S Y EARFDFE R+KSYSFN P GD NPEVKRRKRVA YNMY MEGK 
Sbjct  1    MEKMKSFPYYSAS-YAEARFDFEDRSKSYSFNGP-GD-NPEVKRRKRVAAYNMYTMEGKL  57

Query  235  KSSLRNSFKWIKTKFTHTYYDS  300
            KSSLRNSFKWIK+KFT TYYDS
Sbjct  58   KSSLRNSFKWIKSKFTDTYYDS  79



>gb|EYU24060.1| hypothetical protein MIMGU_mgv1a017325mg [Erythranthe guttata]
Length=81

 Score =   124 bits (312),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKF  234
            M+KSKSFPY  S++Y EARFDFE R KS+SFN PA   NPEVKRRKRVAGYNM+A+EGKF
Sbjct  1    MDKSKSFPYSYSTSYAEARFDFEDRAKSFSFNGPAD--NPEVKRRKRVAGYNMFAVEGKF  58

Query  235  KSSLRNSFKWIKTKFTHTYYDSS  303
            KSSL+NSFKWIK KF+  YYD S
Sbjct  59   KSSLKNSFKWIKNKFSDKYYDDS  81



>ref|XP_010096474.1| hypothetical protein L484_006721 [Morus notabilis]
 gb|EXB64484.1| hypothetical protein L484_006721 [Morus notabilis]
Length=91

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 65/90 (72%), Gaps = 9/90 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA---------GDCNPEVKRRKRVAGY  207
            M++SKS P H SS Y +ARF FE R KSYSFN P+            NPE+KRRKRVA Y
Sbjct  1    MDRSKSLPGHYSSLYGDARFGFEDRAKSYSFNGPSVRVEDHELGSSSNPEMKRRKRVANY  60

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            NMYAMEGK KSSLRNSFKWIK+KF  TYYD
Sbjct  61   NMYAMEGKLKSSLRNSFKWIKSKFVDTYYD  90



>emb|CAN64856.1| hypothetical protein VITISV_030491 [Vitis vinifera]
Length=210

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 66/91 (73%), Gaps = 8/91 (9%)
 Frame = +1

Query  46   FIIMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC-------NPEVKRRKRVAG  204
             +IMEKS+SFP H  S Y++AR  FE R+ SYSFN P G         NPE+KRRKRVA 
Sbjct  119  LLIMEKSRSFPDHPYS-YSDARHGFELRSNSYSFNGPIGKVDEFATSDNPEMKRRKRVAS  177

Query  205  YNMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            YNMY+MEGK KSSLRNSFKWIK KFT  YYD
Sbjct  178  YNMYSMEGKLKSSLRNSFKWIKNKFTDDYYD  208



>ref|XP_007207520.1| hypothetical protein PRUPE_ppa013987mg [Prunus persica]
 gb|EMJ08719.1| hypothetical protein PRUPE_ppa013987mg [Prunus persica]
Length=92

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 65/91 (71%), Gaps = 10/91 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG----------DCNPEVKRRKRVAG  204
            MEKSKSF  + S+ YTEA+F FE R+KSYSFN P              NPE++RRKRVA 
Sbjct  1    MEKSKSFSGYYSTGYTEAQFGFEDRSKSYSFNGPVSCSKVDELSSTSGNPELERRKRVAS  60

Query  205  YNMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            YNMYA+EGKFKSSLRNSFKWIK KF   +YD
Sbjct  61   YNMYAVEGKFKSSLRNSFKWIKGKFVDNFYD  91



>ref|XP_010652886.1| PREDICTED: uncharacterized protein LOC104879927 [Vitis vinifera]
Length=89

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 64/88 (73%), Gaps = 8/88 (9%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC-------NPEVKRRKRVAGYNM  213
            MEKS+SFP H  S Y++AR  FE R+ SYSFN P G         NPE+KRRKRVA YNM
Sbjct  1    MEKSRSFPDHPYS-YSDARHGFELRSNSYSFNGPIGKVDEFATSDNPEMKRRKRVASYNM  59

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            Y+MEGK KSSLRNSFKWIK KFT  YYD
Sbjct  60   YSMEGKLKSSLRNSFKWIKNKFTDDYYD  87



>ref|XP_002310621.1| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
 gb|EEE91071.1| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
Length=90

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC---------NPEVKRRKRVAGY  207
            MEKSKSF  +S+ AY+E R  FE R+ SYSFN PAG           NPE+KRRKRVA Y
Sbjct  1    MEKSKSFSGYSN-AYSEIRLGFEERSGSYSFNGPAGKVDDVELESSGNPELKRRKRVAQY  59

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            NMY MEGK KSSLRNSFKWIK+K    Y+D
Sbjct  60   NMYTMEGKIKSSLRNSFKWIKSKLVDDYFD  89



>ref|XP_002530262.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32132.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 62/87 (71%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP--------AGDCNPEVKRRKRVAGYN  210
            MEKSKSF  +S+  Y+E R +FE R+KSYSFN P        A   NPEVKRR+RVA YN
Sbjct  1    MEKSKSFSGYSN-PYSEIRLEFEDRSKSYSFNGPTTGKMDELASSGNPEVKRRRRVAQYN  59

Query  211  MYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            MY MEGK KSSLRNSFKWIK+KF   Y
Sbjct  60   MYTMEGKLKSSLRNSFKWIKSKFVDDY  86



>gb|KDP35289.1| hypothetical protein JCGZ_09448 [Jatropha curcas]
Length=89

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 9/89 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP--------AGDCNPEVKRRKRVAGYN  210
            MEKSKSF  + + AY+E R  FE R+KSYSFN P        A   NPE+KRRKRVA YN
Sbjct  1    MEKSKSFSSYPN-AYSEIRLGFEDRSKSYSFNGPVSGKMDELAPSTNPELKRRKRVAQYN  59

Query  211  MYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            MY++EGK KSSLR+SFKWIK+KF   Y D
Sbjct  60   MYSVEGKLKSSLRSSFKWIKSKFVEDYSD  88



>ref|XP_007048178.1| Uncharacterized protein TCM_001296 [Theobroma cacao]
 gb|EOX92335.1| Uncharacterized protein TCM_001296 [Theobroma cacao]
Length=86

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 60/90 (67%), Gaps = 14/90 (16%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP---------AGDCNPEVKRRKRVAGY  207
            MEKSKSF     S Y+E R   E RTKSYSFN P         A   NPE+KRRKRVA Y
Sbjct  1    MEKSKSF-----SGYSEVRRGIEDRTKSYSFNGPVSSSKADVLATSGNPELKRRKRVASY  55

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            NMY+MEGK KSSLRNSFKWIKTKF    ++
Sbjct  56   NMYSMEGKLKSSLRNSFKWIKTKFVGNLHE  85



>gb|KDO57123.1| hypothetical protein CISIN_1g034773mg [Citrus sinensis]
Length=84

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 60/84 (71%), Gaps = 8/84 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC-------NPEVKRRKRVAGYNM  213
            MEKSKSF  + SS + +A+F FE R+KSYSFN P G         NPE KRRKRVA YNM
Sbjct  1    MEKSKSFSGNPSSCF-DAQFGFEDRSKSYSFNGPTGKADVLASSGNPESKRRKRVAAYNM  59

Query  214  YAMEGKFKSSLRNSFKWIKTKFTH  285
            Y MEGK KSSLRNSFKWIK KFT 
Sbjct  60   YTMEGKLKSSLRNSFKWIKNKFTD  83



>ref|XP_006427923.1| hypothetical protein CICLE_v10026866mg [Citrus clementina]
 gb|ESR41163.1| hypothetical protein CICLE_v10026866mg [Citrus clementina]
Length=84

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 8/84 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC-------NPEVKRRKRVAGYNM  213
            MEKSKSF  + SS + +A+F FE R+KSYSFN P G         NPE KRRKRVA YNM
Sbjct  1    MEKSKSFSGNPSSCF-DAQFGFEDRSKSYSFNGPTGKADVLASSGNPESKRRKRVAAYNM  59

Query  214  YAMEGKFKSSLRNSFKWIKTKFTH  285
            Y MEGK KSSLRNSFKWIK KF+ 
Sbjct  60   YTMEGKLKSSLRNSFKWIKNKFSD  83



>ref|XP_009783266.1| PREDICTED: uncharacterized protein LOC104231901 [Nicotiana sylvestris]
Length=713

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +1

Query  61   KSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKS  240
            KSKS  Y+S+S Y EARFDFE RTKSYSFN   G+ N EVKRR+RVAGYNMY+MEGK K+
Sbjct  42   KSKSLSYYSASNYAEARFDFEDRTKSYSFNGSGGE-NREVKRRRRVAGYNMYSMEGKVKT  100

Query  241  SLRNSFKWIK  270
            SLRNSFKW+K
Sbjct  101  SLRNSFKWLK  110



>gb|KGN48410.1| hypothetical protein Csa_6G486830 [Cucumis sativus]
Length=86

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGD---CNPEVKRRKRVAGYNMYAM  222
            +ME+SKS     S AY + RF FE   KSYSFN         N E+KRR+RVA YNMY+M
Sbjct  1    MMERSKSLSGSYSKAYGDVRFGFEDNPKSYSFNGTIKKEDVANQELKRRQRVATYNMYSM  60

Query  223  EGKFKSSLRNSFKWIKTKFTHTYYD  297
            EGK K SLRNSFKWIK K +H++YD
Sbjct  61   EGKLKKSLRNSFKWIKNKISHSFYD  85



>ref|XP_009606571.1| PREDICTED: uncharacterized protein LOC104100905 [Nicotiana tomentosiformis]
Length=76

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  103  EARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            EARFDFE RTKSYSFN   G+ N EVKR+KRV GYNMY+MEGK K+SL+NSFKW+K+KFT
Sbjct  17   EARFDFEDRTKSYSFNGSGGE-NREVKRKKRVVGYNMYSMEGKVKTSLKNSFKWLKSKFT  75

Query  283  H  285
             
Sbjct  76   D  76



>ref|XP_008440092.1| PREDICTED: uncharacterized protein LOC103484674 [Cucumis melo]
Length=86

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGD---CNPEVKRRKRVAGYNMYAM  222
            +ME+SKS     S AY + RF FE   KSYSF+         N E+KRR+RVA YNMY+M
Sbjct  1    MMERSKSLSGSYSKAYGDVRFGFEDNPKSYSFDGTVKKEDVVNQELKRRQRVATYNMYSM  60

Query  223  EGKFKSSLRNSFKWIKTKFTHTYYD  297
            EGK K SLRNSFKWIK K +H++Y+
Sbjct  61   EGKLKKSLRNSFKWIKNKISHSFYN  85



>ref|XP_007019583.1| Mediator of RNA polymerase II transcription subunit 8 [Theobroma 
cacao]
 gb|EOY16808.1| Mediator of RNA polymerase II transcription subunit 8 [Theobroma 
cacao]
Length=87

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +SSS   E  FDFE R+ SY+FN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSKSFPEYSSSFSGE--FDFENRSNSYNFNGPCSKSNGFAASNDPELKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + MEGK KSS+R+SFKWIK+KF+   Y
Sbjct  59   FTMEGKVKSSVRSSFKWIKSKFSDVRY  85



>gb|KJB28970.1| hypothetical protein B456_005G077700 [Gossypium raimondii]
Length=88

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKS P + SS+ +   F+FE R+ SY+FN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSKSLPQYYSSSLS-GEFEFENRSSSYNFNGPCSKSNGFAASNDPELKRKKRIASYNV  59

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + MEGK KSS+RNSFKWIK+KFT   Y
Sbjct  60   FTMEGKLKSSVRNSFKWIKSKFTDVGY  86



>ref|XP_002306717.1| hypothetical protein POPTR_0005s21760g [Populus trichocarpa]
 gb|EEE93713.1| hypothetical protein POPTR_0005s21760g [Populus trichocarpa]
Length=87

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +SSS   E  F FE R+ SY+FN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSKSFPQYSSSFSGE--FGFEDRSNSYNFNGPCQKGNGFATSSDPELKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + MEGK KS++RNSFKWIK+KF+   Y
Sbjct  59   FTMEGKLKSNVRNSFKWIKSKFSDVRY  85



>gb|KHN09564.1| hypothetical protein glysoja_011838 [Glycine soja]
Length=93

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +1

Query  55   MEKSKSF-PYHSSSAYTEARFDFEGRTKSYSFNSP--------AGDCNPEVKRRKRVAGY  207
            MEK K F  YH SS+Y + R   E RT SYSFN P        A + NPE+KRRKRVA Y
Sbjct  3    MEKGKPFSAYHHSSSYHDFRAGLEDRTTSYSFNGPRSSKRDVLATNGNPELKRRKRVASY  62

Query  208  NMYAMEGKFKSSLRNSFKWIKTKF  279
            NMY ME K KSS R+SFKWIK K 
Sbjct  63   NMYTMEAKLKSSFRSSFKWIKNKL  86



>ref|XP_004290488.1| PREDICTED: uncharacterized protein LOC101310479 [Fragaria vesca 
subsp. vesca]
Length=87

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 13/90 (14%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP---------AGDCNPEVKRRKRVAGY  207
            MEKSKSFP ++SS   E  F F  R+ SY+FN P         AGD  PE++R+KRVA Y
Sbjct  1    MEKSKSFPEYTSSYSGE--FGFRERSNSYNFNGPNQKGNGFATAGD--PELQRKKRVASY  56

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            N++ MEGK K+SL+NSFKWIK +FT   YD
Sbjct  57   NVFTMEGKLKTSLKNSFKWIKNRFTDVRYD  86



>ref|XP_003528030.2| PREDICTED: uncharacterized protein LOC100795724 [Glycine max]
Length=93

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +1

Query  55   MEKSKSF-PYHSSSAYTEARFDFEGRTKSYSFNSP--------AGDCNPEVKRRKRVAGY  207
            MEK K F  YH SS+Y + R   E RT SYSFN P        A + NPE+KRRKRVA Y
Sbjct  3    MEKGKPFSAYHHSSSYHDFRAGLEDRTTSYSFNGPRSSKRDVLATNGNPELKRRKRVASY  62

Query  208  NMYAMEGKFKSSLRNSFKWIKTKF  279
            NMY +E K KSS R+SFKWIK K 
Sbjct  63   NMYTIEAKLKSSFRSSFKWIKNKL  86



>gb|EPS71133.1| hypothetical protein M569_03627, partial [Genlisea aurea]
Length=76

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKF  234
            ++++ SFPY+ +    E  F+FE R KSYSFN P+   +PE+KR+KRVA YN YA+EG+ 
Sbjct  1    VDRASSFPYYPA----ETGFNFEDRPKSYSFNGPSEGDDPEMKRKKRVASYNKYAVEGRL  56

Query  235  KSSLRNSFKWIKTKFTH  285
             SSLRNSFKWIK KF  
Sbjct  57   VSSLRNSFKWIKGKFAD  73



>ref|XP_010062094.1| PREDICTED: uncharacterized protein LOC104449583 [Eucalyptus grandis]
 gb|KCW69157.1| hypothetical protein EUGRSUZ_F02688 [Eucalyptus grandis]
Length=89

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 9/88 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGYNM  213
            MEK+KS+P +S++   E  F+ E R+ SY+FN P G         +PE+KR+KR+A YN+
Sbjct  1    MEKNKSYPAYSAAYLGE--FETEERSNSYNFNGPGGKGSGFAASSDPELKRKKRIAAYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            +A EGK KSSLRNSFKWIK K     YD
Sbjct  59   FAAEGKLKSSLRNSFKWIKGKANEVRYD  86



>ref|XP_006434510.1| hypothetical protein CICLE_v10003573mg [Citrus clementina]
 gb|ESR47750.1| hypothetical protein CICLE_v10003573mg [Citrus clementina]
Length=88

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCN-------PEVKRRKRVAGYNM  213
            MEKSKSFP +SSS   E  FDF+ ++ SY FN P+   N       PE+KR+KR+A YN+
Sbjct  1    MEKSKSFPEYSSSFSGE--FDFDNQSNSYIFNGPSSKGNGFATSSDPEIKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + +E K KSS+RNSFKWIK KF+   Y
Sbjct  59   FTVENKLKSSVRNSFKWIKGKFSDVRY  85



>emb|CBI18237.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 9/88 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKS+SFP +SSS   E  F F  R+ SYSFN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSRSFPEYSSSYAGE--FGFHDRSNSYSFNGPCNKGSGFATSNDPELKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            + MEGK K+S+R+SFKWIKTK +   YD
Sbjct  59   FTMEGKLKTSVRSSFKWIKTKLSDIRYD  86



>gb|KGN45893.1| hypothetical protein Csa_6G017090 [Cucumis sativus]
Length=87

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGYNM  213
            MEKSKSFP +SSS  T   F F+ R+ SY+FN P           +PE++R++R+A YN+
Sbjct  1    MEKSKSFPKYSSS--TSGEFGFQTRSNSYNFNGPTAKATGFSTSADPELQRKRRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + ME K KSS++NSFKWIKTKF+   Y
Sbjct  59   FNMENKVKSSVKNSFKWIKTKFSDIRY  85



>ref|XP_010932053.1| PREDICTED: uncharacterized protein LOC105052817 [Elaeis guineensis]
Length=122

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 7/89 (8%)
 Frame = +1

Query  49   IIMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGY  207
            I+MEKS+SFP +S S+       +EGR  SYSFN P G         +PE+KR++RVA Y
Sbjct  32   IVMEKSRSFPEYSYSSSYSGGLGYEGRPNSYSFNGPNGKHDGFASSSDPELKRKRRVAAY  91

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            N++  E K KSS+RNS KWIKTKFT+  Y
Sbjct  92   NVFTTEAKLKSSVRNSVKWIKTKFTNIRY  120



>ref|XP_002302161.1| hypothetical protein POPTR_0002s06580g [Populus trichocarpa]
 gb|ABK92947.1| unknown [Populus trichocarpa]
 gb|EEE81434.1| hypothetical protein POPTR_0002s06580g [Populus trichocarpa]
Length=87

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +SS  +    F FE ++ SY+FN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSKSFPQYSS--FFSGEFGFEDQSNSYNFNGPCQKGNGFATSSDPELKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + +EGK KSS RNSFKWIK+KF+   Y
Sbjct  59   FTVEGKLKSSARNSFKWIKSKFSDARY  85



>gb|KDO83797.1| hypothetical protein CISIN_1g034641mg [Citrus sinensis]
Length=88

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCN-------PEVKRRKRVAGYNM  213
            MEKSKSFP +SSS   E  FDF+ ++ +Y FN P+   N       PE+KR+KR+A YN+
Sbjct  1    MEKSKSFPEYSSSFSGE--FDFDNQSNAYIFNGPSSKGNGFATSSDPEIKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + +E K KSS+RNSFKWIK KF+   Y
Sbjct  59   FTVENKLKSSVRNSFKWIKGKFSDVRY  85



>ref|XP_009401372.1| PREDICTED: uncharacterized protein LOC103985414 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGYNM  213
            MEK +SFP +SSS  +   F ++ R  SYSFN P+G         +PE+KR++RVA YN 
Sbjct  1    MEKCRSFPEYSSS--STGGFGYDNRCNSYSFNGPSGKDDGFASSSDPELKRKRRVASYNS  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +AME K KSS+RNSFKWIK KFT   Y
Sbjct  59   FAMERKLKSSVRNSFKWIKNKFTDAVY  85



>ref|XP_003634523.1| PREDICTED: uncharacterized protein LOC100854843 [Vitis vinifera]
Length=87

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKS+SFP +SSS   E  F F  R+ SYSFN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSRSFPEYSSSYAGE--FGFHDRSNSYSFNGPCNKGSGFATSNDPELKRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + MEGK K+S+R+SFKWIKTK +   Y
Sbjct  59   FTMEGKLKTSVRSSFKWIKTKLSDIRY  85



>ref|XP_007201433.1| hypothetical protein PRUPE_ppa013713mg [Prunus persica]
 gb|EMJ02632.1| hypothetical protein PRUPE_ppa013713mg [Prunus persica]
Length=107

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 10/93 (11%)
 Frame = +1

Query  46   FIIMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAG  204
             + MEKSKSFP ++S AY+   F F  R+ SY+FN P       A   +PE++R+KRVA 
Sbjct  17   LLTMEKSKSFPEYTS-AYS-GEFGFRERSNSYNFNGPTQKGSGFATSSDPELQRKKRVAS  74

Query  205  YNMYAMEGKFKSSLRNSFKWIKTKF-THTYYDS  300
            YN++ MEGK K+SL+NSFKWIK +F T   YD+
Sbjct  75   YNVFTMEGKVKTSLKNSFKWIKNRFVTDVRYDA  107



>ref|XP_008237494.1| PREDICTED: uncharacterized protein LOC103336230 [Prunus mume]
Length=88

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP ++S AY+   F F  R+ SY+FN P       A   +PE++R+KRVA YN+
Sbjct  1    MEKSKSFPEYTS-AYS-GEFGFRERSNSYNFNGPTQKGSGFATSSDPELQRKKRVASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKF-THTYYDS  300
            + MEGK K+SL+NSFKWIK +F T   YD+
Sbjct  59   FTMEGKVKTSLKNSFKWIKNRFATDVRYDA  88



>gb|EPS65655.1| hypothetical protein M569_09126, partial [Genlisea aurea]
Length=71

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +1

Query  67   KSFPYHSSSAYTEARFDFEG-RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSS  243
            K FPY+S+S Y EARF+ E  R++SYSFN P    NPE+KR+KRVA YN YA+EGKF SS
Sbjct  1    KPFPYYSAS-YAEARFNLEDHRSRSYSFNGPRD--NPEMKRKKRVASYNKYAVEGKFISS  57

Query  244  LRNSFKWIKTKFT  282
             R+ F+WIK KF 
Sbjct  58   FRSKFRWIKAKFA  70



>ref|XP_009349933.1| PREDICTED: uncharacterized protein LOC103941464 [Pyrus x bretschneideri]
Length=89

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S++  +E  FDF  R+ SY+FN P       A   +PE++R+KRVA YN+
Sbjct  1    MEKSKSFPEYSAAHSSE--FDFRERSNSYNFNGPTQKGSGFATSTDPELQRKKRVASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFT  282
            + MEGK K+SLRN+ KWIK   +
Sbjct  59   FTMEGKVKTSLRNNLKWIKNSLS  81



>ref|XP_010097663.1| hypothetical protein L484_023803 [Morus notabilis]
 gb|EXB70618.1| hypothetical protein L484_023803 [Morus notabilis]
Length=87

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            ME S SFP +SS+  +E  F F+ R+ SY+FN P       A   +PE++R+KR+A YN+
Sbjct  1    MENSNSFPEYSSAYSSE--FGFQERSNSYNFNGPCQKGSGFAASSDPELQRKKRIASYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +  EGK KSS+RNSFKWIK+KF+   Y
Sbjct  59   FTTEGKVKSSVRNSFKWIKSKFSDIRY  85



>ref|XP_006856469.1| hypothetical protein AMTR_s00046p00044470 [Amborella trichopoda]
 gb|ERN17936.1| hypothetical protein AMTR_s00046p00044470 [Amborella trichopoda]
Length=81

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-----AGDCNPEVKRRKRVAGYNMYA  219
            MEKS+SFP +SSS  +   F  E R+ SYSFN P     A   +PE+KR+KRVA Y ++A
Sbjct  1    MEKSRSFPEYSSS-LSGGVFGSEDRSNSYSFNGPSNKGFATSSDPELKRKKRVASYKVFA  59

Query  220  MEGKFKSSLRNSFKWIKTK  276
             EGKFKSSLR+SFKWIK+K
Sbjct  60   AEGKFKSSLRSSFKWIKSK  78



>gb|AFK41103.1| unknown [Lotus japonicus]
Length=87

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA-------GDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F  E R+KSY+FN P+          +PE+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTEFGFSRE-RSKSYNFNGPSEKGSGFYASSDPELKRKKRIKSYNV  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
              +EGK K+S+RNSFKWIK KFT   Y
Sbjct  59   LTVEGKVKTSVRNSFKWIKNKFTDIRY  85



>ref|XP_003556161.1| PREDICTED: uncharacterized protein LOC100776380 [Glycine max]
 gb|KHN46396.1| hypothetical protein glysoja_031714 [Glycine soja]
Length=86

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 10/87 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F F  R+ SY+FN P       +   +PE+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTE--FGFSERSNSYNFNGPNQKGNGFSASSDPELKRKKRIKAYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
              +EGK K+S+RNSFKWIK KF+   Y
Sbjct  58   LTVEGKLKTSVRNSFKWIKNKFSDIRY  84



>ref|XP_010268571.1| PREDICTED: uncharacterized protein LOC104605490 [Nelumbo nucifera]
Length=83

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 13/87 (15%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCN-------PEVKRRKRVAGYNM  213
            MEKS++FP ++        F FE  + SYSFN P+G  N       PE+KR++RVA YN+
Sbjct  1    MEKSRAFPEYNCG------FGFEEGSNSYSFNGPSGKENGFSASSDPELKRKRRVAAYNV  54

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +  EGK KSS+RNSFKWIK KFT   Y
Sbjct  55   FTTEGKIKSSVRNSFKWIKNKFTDVRY  81



>gb|ACU16913.1| unknown [Glycine max]
 gb|KHN17032.1| hypothetical protein glysoja_011506 [Glycine soja]
Length=86

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 10/87 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F F  R+ SY+FN P       +   +PE+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTE--FGFSERSNSYNFNGPNQKGNGFSASSDPEIKRKKRIKAYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
              +EGK K+++RNSFKWIK KF+   Y
Sbjct  58   LTVEGKLKTNVRNSFKWIKNKFSDIRY  84



>ref|XP_004496440.1| PREDICTED: uncharacterized protein LOC101513366 isoform X1 [Cicer 
arietinum]
 ref|XP_004496441.1| PREDICTED: uncharacterized protein LOC101513366 isoform X2 [Cicer 
arietinum]
Length=85

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA-------GDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F F  R+ SY+FN P+          +PE+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTE--FGFRERSNSYNFNGPSDKGSGFVASNDPELKRKKRIKSYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHT  288
             A+EGK K+S+RNSFKWIK KF+  
Sbjct  58   LAVEGKLKTSVRNSFKWIKNKFSDV  82



>ref|XP_009113577.1| PREDICTED: uncharacterized protein LOC103838879 [Brassica rapa]
Length=87

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + R+ SYSFN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRSNSYSFNGPCINTDPEIKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             KS+L+NSFKWIK KF+
Sbjct  61   LKSTLKNSFKWIKNKFS  77



>ref|XP_009764165.1| PREDICTED: uncharacterized protein LOC104215926 [Nicotiana sylvestris]
Length=101

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 9/89 (10%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEG-RTKSYSFNSP-----AGDCNPEVKRRKRVAGYNM  213
            +MEKS+S+P +SSS Y+    + +G ++  Y+FN P     A   +PE+KR+KR+A YNM
Sbjct  16   VMEKSRSYPQYSSSNYSG---ELQGDQSNVYTFNGPTTKGFAPANDPEIKRKKRIAAYNM  72

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYYDS  300
            +  EGK K+++R SFKWIKTK T   Y +
Sbjct  73   FTTEGKVKATVRESFKWIKTKLTDIRYSA  101



>ref|XP_007143570.1| hypothetical protein PHAVU_007G082800g [Phaseolus vulgaris]
 gb|ESW15564.1| hypothetical protein PHAVU_007G082800g [Phaseolus vulgaris]
Length=86

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC-------NPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F F  R+ SY+FN P           +PE+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTE--FGFRDRSSSYNFNGPTQKGTGFITSDDPELKRKKRIKAYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
               EGK K+S+RNSFKWIK KF+   Y
Sbjct  58   LTAEGKLKTSVRNSFKWIKNKFSDIRY  84



>ref|XP_009403203.1| PREDICTED: uncharacterized protein LOC103986822 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGYNM  213
            MEK +SFP  SSS+     F +E R+ SYSFN P G         +PE+KR++RVA YN 
Sbjct  57   MEKCRSFPEISSSSCDG--FGYENRSNSYSFNGPDGKGAGFASSTDPELKRKRRVASYNS  114

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + ME K +SS+RNSFKWIK KFT   +
Sbjct  115  FTMERKLRSSVRNSFKWIKNKFTDALH  141



>ref|XP_003592063.1| hypothetical protein MTR_1g098310 [Medicago truncatula]
 gb|AES62314.1| DUF3511 domain protein [Medicago truncatula]
 gb|AFK44497.1| unknown [Medicago truncatula]
Length=86

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 10/87 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA-------GDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +S S YTE  F +  R+ SY+FN P+          + E+KR+KR+  YN+
Sbjct  1    MEKSKSFPEYSCS-YTE--FGYSERSNSYNFNGPSDKGSGFSASNDSELKRKKRIKSYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             A+EGK KSS+RNSFKWIK KF+   Y
Sbjct  58   LAVEGKLKSSVRNSFKWIKNKFSDVRY  84



>ref|XP_008793904.1| PREDICTED: uncharacterized protein LOC103710078 [Phoenix dactylifera]
Length=88

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 8/85 (9%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAG-------DCNPEVKRRKRVAGYNM  213
            MEKS+SFP +  S+     FD E R+ SYSFN P+G         +PE+KR++RVA YN+
Sbjct  1    MEKSRSFPEYPYSSSYSGVFD-EIRSNSYSFNGPSGKRDGFATSSDPELKRKRRVAAYNV  59

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHT  288
            + +E K KSS+R+SFKWIK KF   
Sbjct  60   FTVEAKLKSSVRSSFKWIKAKFADV  84



>ref|XP_010320114.1| PREDICTED: uncharacterized protein LOC104647137 [Solanum lycopersicum]
Length=97

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +1

Query  49   IIMEKSKSFPYHSSSAYTEARFDFEG-RTKSYSFNSP-----AGDCNPEVKRRKRVAGYN  210
            I+MEK +S+P +SSS  +    +F+  +T  Y+FN P     A   +PE+KR+KR+A YN
Sbjct  8    IVMEKCRSYPQYSSSNNSGEFGNFQDDQTNVYTFNGPTTKGFAPSNDPEIKRKKRIAAYN  67

Query  211  MYAMEGKFKSSLRNSFKWIKTKFTHTYYD  297
            M+  EGK K+++R SFKWIKTK +   Y+
Sbjct  68   MFTTEGKVKATVRESFKWIKTKISDIRYN  96



>emb|CDX99512.1| BnaC09g24800D [Brassica napus]
Length=87

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + R+ SYSFN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRSNSYSFNGPCINTDPEIKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             KS+L+N FKWIK KF+
Sbjct  61   LKSTLKNGFKWIKNKFS  77



>ref|XP_006656402.1| PREDICTED: uncharacterized protein LOC102718280 [Oryza brachyantha]
Length=89

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARF-----DFEGRT-KSYSFNSPAGDCNPEVKRRKRVAGYNMY  216
            MEK +S P+  S+AY          D  G   KSYSFN P+   +PE KRR+RVA YN++
Sbjct  1    MEKCRSVPHEHSAAYYGCGGGYDYEDVSGAAAKSYSFNGPSARDDPEAKRRRRVAAYNVF  60

Query  217  AMEGKFKSSLRNSFKWIKTKFTHTYY  294
            A +G+ KS++R+SFKWIK+KF+   Y
Sbjct  61   ATQGRLKSTVRSSFKWIKSKFSTVRY  86



>ref|NP_192727.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB39613.1| putative protein [Arabidopsis thaliana]
 emb|CAB78112.1| putative protein [Arabidopsis thaliana]
 gb|AAR24181.1| At4g09890 [Arabidopsis thaliana]
 gb|AAR92324.1| At4g09890 [Arabidopsis thaliana]
 gb|AEE82810.1| uncharacterized protein AT4G09890 [Arabidopsis thaliana]
Length=87

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + R+ SY+FN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRSNSYNFNGPCINTDPEMKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             KS+L+NSFKWIK KF+
Sbjct  61   LKSTLKNSFKWIKNKFS  77



>ref|XP_006397132.1| hypothetical protein EUTSA_v10029196mg [Eutrema salsugineum]
 gb|ESQ38585.1| hypothetical protein EUTSA_v10029196mg [Eutrema salsugineum]
Length=87

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + RT SY+FN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRTNSYNFNGPCINTDPEIKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             K+SL++SFKWIK KF+
Sbjct  61   LKNSLKSSFKWIKNKFS  77



>ref|XP_009627813.1| PREDICTED: uncharacterized protein LOC104118301 [Nicotiana tomentosiformis]
Length=85

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 9/88 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEG-RTKSYSFNSP-----AGDCNPEVKRRKRVAGYNMY  216
            MEKS+S+P +SSS Y+    +F+  ++  Y+FN P     A   +PE+KR+KR+A YNM+
Sbjct  1    MEKSRSYPQYSSSNYSG---EFQSDQSNVYTFNGPTTKGFAPANDPEIKRKKRIAAYNMF  57

Query  217  AMEGKFKSSLRNSFKWIKTKFTHTYYDS  300
              EGK K+++R SFKWIKTK T   Y +
Sbjct  58   TTEGKVKATVRESFKWIKTKLTDIRYSA  85



>gb|EYU36830.1| hypothetical protein MIMGU_mgv1a017284mg [Erythranthe guttata]
Length=84

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 10/84 (12%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCN------PEVKRRKRVAGYNMY  216
            MEKS+S+P +SS    E + +      SY+FN P G  N      PE+KR+KR+A YN++
Sbjct  1    MEKSRSYPRYSSQLGCEDQTN----PYSYTFNGPMGQMNSGTLNEPEMKRKKRIAAYNLF  56

Query  217  AMEGKFKSSLRNSFKWIKTKFTHT  288
              EGK K+S+R+SFKWIKTK  H 
Sbjct  57   TKEGKVKASVRDSFKWIKTKINHV  80



>emb|CDP11432.1| unnamed protein product [Coffea canephora]
Length=87

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA-------GDCNPEVKRRKRVAGYNM  213
            MEKSKSFP +SSS  +E  + F+ ++ SY FN P+          +PE+KR+KR+A YNM
Sbjct  1    MEKSKSFPQYSSSYSSE--YGFQDQSNSYIFNGPSTRGEGFTASNDPELKRKKRIAAYNM  58

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +  EGK K+++R SFKWIKTK +   Y
Sbjct  59   FTTEGKLKATVRESFKWIKTKLSDVRY  85



>ref|XP_006359046.1| PREDICTED: uncharacterized protein LOC102585655 [Solanum tuberosum]
Length=88

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEG-RTKSYSFNSP-----AGDCNPEVKRRKRVAGYNMY  216
            MEKS+S+P +SSS  +    +F+  +T  Y+FN P     A   +PE+KR+KR+A YNM+
Sbjct  1    MEKSRSYPQYSSSNNSGEFGNFQDDQTNVYTFNGPTTKGFAPSNDPEIKRKKRIAAYNMF  60

Query  217  AMEGKFKSSLRNSFKWIKTKFTHTYYD  297
              EGK K+++R SFKWIKTK +   Y+
Sbjct  61   TTEGKVKATVRESFKWIKTKISDIRYN  87



>ref|XP_002872475.1| hypothetical protein ARALYDRAFT_489838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48734.1| hypothetical protein ARALYDRAFT_489838 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + R+ SY+FN P  + +PE+KR++RVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRSNSYNFNGPCINTDPEMKRKRRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             KS+L+NSFKWIK KF+
Sbjct  61   LKSTLKNSFKWIKNKFS  77



>gb|KFK32039.1| hypothetical protein AALP_AA6G192400 [Arabis alpina]
Length=87

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SSS  T+     + R+ SY+FN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSSFSTDEFGYDQNRSNSYNFNGPCINTDPEMKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             K++L+NSFKWIK KF+
Sbjct  61   LKNTLKNSFKWIKNKFS  77



>ref|XP_006288984.1| hypothetical protein CARUB_v10002358mg [Capsella rubella]
 gb|EOA21882.1| hypothetical protein CARUB_v10002358mg [Capsella rubella]
Length=87

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            +M+ SKS+  +SS+  T+     + R+ SY+FN P  + +PE+KR+KRVA YN++A E K
Sbjct  1    MMKGSKSYTEYSSNFSTDEFGYDQNRSNSYNFNGPCINTDPEMKRKKRVASYNLFATEEK  60

Query  232  FKSSLRNSFKWIKTKFT  282
             KS+L+NSFKWIK KF+
Sbjct  61   LKSTLKNSFKWIKNKFS  77



>ref|NP_001152913.1| uncharacterized protein LOC100276361 [Zea mays]
 gb|ACF85070.1| unknown [Zea mays]
 gb|ACG33722.1| hypothetical protein [Zea mays]
 gb|AFW69165.1| hypothetical protein ZEAMMB73_443271 [Zea mays]
Length=92

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 9/89 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARF-----DFEG----RTKSYSFNSPAGDCNPEVKRRKRVAGY  207
            MEK +S P+  SSAY          D  G      KSYSFN P+G  +PE KRR+RVA Y
Sbjct  1    MEKCRSVPHEHSSAYYGCGGGYDYEDVGGGPGQAGKSYSFNGPSGRDDPEAKRRRRVAAY  60

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            N++A +G+ K+++R+S KW+K+KF+   Y
Sbjct  61   NVFATQGRIKTTVRSSVKWLKSKFSDVRY  89



>ref|XP_002524325.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38065.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 56/85 (66%), Gaps = 13/85 (15%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKS+S+P +SSS   E   +      SYSFN P       A   +PE+KRRKR+A YN+
Sbjct  1    MEKSRSYPEYSSSFSGEFGSN------SYSFNGPYQKGTGFATSSDPEMKRRKRIASYNV  54

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHT  288
            + MEGK KSS+RNSFKWIK KF+ T
Sbjct  55   FTMEGKLKSSVRNSFKWIKNKFSST  79



>ref|NP_001143448.1| uncharacterized protein LOC100276103 [Zea mays]
 gb|ACG32165.1| hypothetical protein [Zea mays]
Length=92

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 9/89 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARF-----DFEG----RTKSYSFNSPAGDCNPEVKRRKRVAGY  207
            MEK +S P+  SSAY          D  G      KSYSFN P+G  +PE KRR RVA Y
Sbjct  1    MEKCRSVPHEHSSAYYGCGGGYDYEDVGGGPGQAGKSYSFNGPSGRDDPEAKRRXRVAAY  60

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            N++A +G+ K+++R+S KW+K+KF+   Y
Sbjct  61   NVFATQGRIKTTVRSSVKWLKSKFSDVRY  89



>ref|XP_011101196.1| PREDICTED: uncharacterized protein LOC105179276 [Sesamum indicum]
Length=77

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +1

Query  55   MEKS-KSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGK  231
            MEKS +S+  +SS       F  E R   Y+FN P    +PE+KR+KRVA YNM A EGK
Sbjct  1    MEKSCRSYCQYSSE------FGCENRENPYAFNGPNASNDPEMKRKKRVAAYNMLATEGK  54

Query  232  FKSSLRNSFKWIKTKFTHTYY  294
             K+S++ SFKWIKTKF    Y
Sbjct  55   VKASVKESFKWIKTKFNDVRY  75



>ref|NP_001058402.1| Os06g0686600 [Oryza sativa Japonica Group]
 dbj|BAD46046.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20316.1| Os06g0686600 [Oryza sativa Japonica Group]
 gb|EAZ02142.1| hypothetical protein OsI_24232 [Oryza sativa Indica Group]
 gb|EAZ38069.1| hypothetical protein OsJ_22415 [Oryza sativa Japonica Group]
Length=93

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTE----------ARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAG  204
            MEK +S P+  S+AY            +        KSYSFN P+   +PE KRR+RVA 
Sbjct  1    MEKCRSVPHEHSAAYYGCGGGYDYEDVSGGGGGAAAKSYSFNGPSARDDPEAKRRRRVAA  60

Query  205  YNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            YN++A +G+ KS++R+SFKWIK+KF+   Y
Sbjct  61   YNVFATQGRLKSTVRSSFKWIKSKFSDIRY  90



>ref|XP_002438896.1| hypothetical protein SORBIDRAFT_10g027850 [Sorghum bicolor]
 gb|EER90263.1| hypothetical protein SORBIDRAFT_10g027850 [Sorghum bicolor]
Length=92

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 9/89 (10%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARF-----DFEG----RTKSYSFNSPAGDCNPEVKRRKRVAGY  207
            MEK +S P+  SS Y          D  G      KSYSFN P+G  +PE KRR+RVA Y
Sbjct  1    MEKCRSVPHEHSSVYYGCGGGYDYEDVGGGPGQAGKSYSFNGPSGRDDPEAKRRRRVAAY  60

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            N++A +G+ K+++R+S KW+K+KF+   Y
Sbjct  61   NVFATQGRIKTTVRSSVKWLKSKFSDIRY  89



>ref|XP_011025570.1| PREDICTED: uncharacterized protein LOC105126404 isoform X2 [Populus 
euphratica]
Length=97

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 10/68 (15%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC---------NPEVKRRKRVAG  204
            +MEKSKSF  +S+ AY+E R  FE R++SYSFN PAG           NPE+KRRKRVA 
Sbjct  21   LMEKSKSFSGYSN-AYSEIRLGFEERSRSYSFNGPAGKVDGIELESSGNPELKRRKRVAQ  79

Query  205  YNMYAMEG  228
            YNMY ME 
Sbjct  80   YNMYTMEA  87



>gb|KHN41303.1| hypothetical protein glysoja_030141 [Glycine soja]
Length=86

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 10/82 (12%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEK+ S P +S S Y+E  F F  R+ SY+FN P       +   +PE+KR+KR+  YN+
Sbjct  1    MEKNNSLPKYSCS-YSE--FGFTERSNSYNFNGPIQKGSGFSAANDPELKRKKRIKAYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKF  279
            + +EGK K+S+RN FKWIK KF
Sbjct  58   FTVEGKLKTSVRNGFKWIKNKF  79



>ref|XP_007151977.1| hypothetical protein PHAVU_004G091400g [Phaseolus vulgaris]
 gb|ESW23971.1| hypothetical protein PHAVU_004G091400g [Phaseolus vulgaris]
Length=86

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPA-------GDCNPEVKRRKRVAGYNM  213
            MEK+ S P +S S Y+E  F F  R+ SY+FN P           +PE+KR+KR+  YN+
Sbjct  1    MEKNNSLPKYSCS-YSE--FGFTERSNSYNFNGPLQKGTGFYAANDPELKRKKRIKSYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKF  279
            + MEGK K+++RN FKWIK KF
Sbjct  58   FTMEGKLKTTVRNGFKWIKNKF  79



>ref|XP_003563451.1| PREDICTED: uncharacterized protein LOC100826521 [Brachypodium 
distachyon]
Length=95

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 12/92 (13%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARF--------DFEG----RTKSYSFNSPAGDCNPEVKRRKRV  198
            MEKS+S P   S+               D  G      KSYSFN P+   +PE KRR+RV
Sbjct  1    MEKSRSVPREHSAPTAAYYGSGGGYDYEDVAGGAPAAAKSYSFNGPSAGDDPEAKRRRRV  60

Query  199  AGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            A YN++A + + KSS+R SFKW+K+K +   Y
Sbjct  61   ASYNVFASQARLKSSVRGSFKWLKSKLSDVRY  92



>ref|XP_004966250.1| PREDICTED: uncharacterized protein LOC101782426 [Setaria italica]
Length=93

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGR----------TKSYSFNSPAGDCNPEVKRRKRVAG  204
            MEK +S P+  SSAY      ++             KSYSFN P+   +PE KRR+RVA 
Sbjct  1    MEKCRSVPHDHSSAYYGCGGGYDYEDVGGGGGAGQGKSYSFNGPSAREDPEAKRRRRVAA  60

Query  205  YNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            YN++A +G+ K+++R+S KW+K+KF+   Y
Sbjct  61   YNVFATQGRIKTTVRSSVKWLKSKFSDIRY  90



>ref|XP_011025569.1| PREDICTED: uncharacterized protein LOC105126404 isoform X1 [Populus 
euphratica]
Length=108

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 10/67 (15%)
 Frame = +1

Query  52   IMEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC---------NPEVKRRKRVAG  204
            +MEKSKSF  +S+ AY+E R  FE R++SYSFN PAG           NPE+KRRKRVA 
Sbjct  21   LMEKSKSFSGYSN-AYSEIRLGFEERSRSYSFNGPAGKVDGIELESSGNPELKRRKRVAQ  79

Query  205  YNMYAME  225
            YNMY ME
Sbjct  80   YNMYTME  86



>ref|XP_003518540.1| PREDICTED: uncharacterized protein LOC100306191 [Glycine max]
 gb|ACU14256.1| unknown [Glycine max]
 gb|KHN00742.1| hypothetical protein glysoja_000410 [Glycine soja]
Length=86

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 10/86 (12%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP----AGDC---NPEVKRRKRVAGYNM  213
            MEK+ S P +S S Y+E  F F  R+ SY+FN P    +G C   +PE+KR+KR+  YN+
Sbjct  1    MEKNNSLPKYSCS-YSE--FGFAERSNSYNFNGPIQKGSGFCAANDPELKRKKRIKAYNV  57

Query  214  YAMEGKFKSSLRNSFKWIKTKFTHTY  291
            + +E K K+S+RN FKWIK KF   +
Sbjct  58   FTVEEKLKTSVRNGFKWIKDKFGDIH  83



>gb|EMT21739.1| hypothetical protein F775_30902 [Aegilops tauschii]
Length=92

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 13/91 (14%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTE-----------ARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVA  201
            MEK +S P+  ++A              +R    G  KSYSFN P+   +PE KRR+RVA
Sbjct  1    MEKCRSVPHEHATAAYYGCGGGYDYEDVSRGGAAG--KSYSFNGPSAGEDPEAKRRRRVA  58

Query  202  GYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             YN++A + + KSS+R SFKW+K+K +   Y
Sbjct  59   SYNVFASQARLKSSVRGSFKWLKSKLSDVRY  89



>dbj|BAK02428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=93

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             KSYSFN P+   +PE KRR+RVA YN++A + + KSS+R SFKW+K+K +   Y
Sbjct  36   VKSYSFNGPSAGDDPEAKRRRRVASYNVFASQARLKSSVRGSFKWLKSKLSDVRY  90



>gb|KDP36568.1| hypothetical protein JCGZ_08335 [Jatropha curcas]
Length=84

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 13/83 (16%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSP-------AGDCNPEVKRRKRVAGYNM  213
            MEKSKS+P +SSS   E   +      SYSFN P       A   +PE+KR+KR+A YN+
Sbjct  1    MEKSKSYPEYSSSFSGEFGSN------SYSFNGPYHKGNGFASSNDPELKRKKRIASYNV  54

Query  214  YAMEGKFKSSLRNSFKWIKTKFT  282
            + +EGK KSS+R+SFKWIK KF 
Sbjct  55   FTVEGKLKSSVRSSFKWIKNKFN  77



>ref|XP_002310616.2| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
 gb|EEE91066.2| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
Length=87

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 44/66 (67%), Gaps = 10/66 (15%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTKSYSFNSPAGDC---------NPEVKRRKRVAGY  207
            MEKSKSF  +S+ AY+E R  FE R+ SYSFN PAG           NPE+KRRKRVA Y
Sbjct  1    MEKSKSFSGYSN-AYSEIRLGFEERSGSYSFNGPAGKVDDVELESSGNPELKRRKRVAQY  59

Query  208  NMYAME  225
            NMY ME
Sbjct  60   NMYTME  65



>gb|AFW75949.1| hypothetical protein ZEAMMB73_654440, partial [Zea mays]
Length=85

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  55   MEKSKSFPY-HSSSAYTEARFDFEGRT-KSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEG  228
            MEK +S P+ HSS  Y        G+  KSYSFN P+G  +PE KRR+RVA YN+ A +G
Sbjct  1    MEKCRSVPHEHSSPYYGGGGGGGPGQAGKSYSFNGPSGRDDPEPKRRRRVAAYNVLAAQG  60

Query  229  KFKSSLRNSFKWIKTKFT  282
            + K+++R S K +K+K +
Sbjct  61   RIKTTVRGSVKCLKSKIS  78



>ref|XP_002521377.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41045.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K++SFN      +PE++R+KRVA Y +YAMEGK K SLR SF+WIK  +T   Y
Sbjct  68   SKNWSFN------DPELQRKKRVASYKVYAMEGKMKGSLRKSFRWIKDTYTQVVY  116



>ref|XP_006369261.1| hypothetical protein POPTR_0001s20460g [Populus trichocarpa]
 gb|ABK95751.1| unknown [Populus trichocarpa]
 gb|ABK96166.1| unknown [Populus trichocarpa]
 gb|ERP65830.1| hypothetical protein POPTR_0001s20460g [Populus trichocarpa]
Length=116

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = +1

Query  115  DFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + E  +KS+SFN      +PE++R++RVA Y +YA+EGK K SLR SF+WIK   T   Y
Sbjct  60   NLESSSKSWSFN------DPELQRKRRVANYKVYAIEGKMKGSLRKSFRWIKDTCTQVVY  113



>ref|XP_010536185.1| PREDICTED: uncharacterized protein LOC104811234 [Tarenaya hassleriana]
Length=111

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  112  FDFE-GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            +DFE  + KSYS +   G  +PE +R+KRVA Y MY++EGK K S R SF+W+K ++T  
Sbjct  47   YDFELKKGKSYSGSKSWGLSDPEFQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQV  106

Query  289  YY  294
             Y
Sbjct  107  VY  108



>gb|KHN32708.1| hypothetical protein glysoja_022390 [Glycine soja]
Length=114

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVAGY +YA EGK K SLR SF+WIK  +T   Y
Sbjct  63   SKSWSFS------DPELQRKKRVAGYKIYAAEGKMKGSLRKSFRWIKNAYTQALY  111



>gb|KHN30067.1| hypothetical protein glysoja_010445 [Glycine soja]
Length=117

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVAGY +YA EGK K SLR SF+WIK  +T   Y
Sbjct  66   SKSWSFT------DPELQRKKRVAGYKIYAAEGKMKGSLRKSFRWIKNTYTQALY  114



>ref|XP_010087710.1| hypothetical protein L484_013472 [Morus notabilis]
 gb|EXB29698.1| hypothetical protein L484_013472 [Morus notabilis]
Length=117

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVAGY  YA+EGK K SLR SF+WI   +T   Y
Sbjct  66   SKSWSFN------DPELQRKKRVAGYKAYAVEGKMKGSLRKSFRWINNTYTQVVY  114



>ref|XP_007150492.1| hypothetical protein PHAVU_005G157200g [Phaseolus vulgaris]
 gb|ESW22486.1| hypothetical protein PHAVU_005G157200g [Phaseolus vulgaris]
Length=120

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVAGY +YA EGK K SLR SF+WIK  +T   Y
Sbjct  69   SKSWSFS------DPELQRKKRVAGYKIYAAEGKMKGSLRKSFRWIKHTYTQALY  117



>ref|XP_010262040.1| PREDICTED: uncharacterized protein LOC104600664 [Nelumbo nucifera]
Length=115

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            +KS+SFN      +PE++R+KRVA Y +YAMEGK K SLR SF+W+K ++T  
Sbjct  64   SKSWSFN------DPELQRKKRVASYKVYAMEGKMKGSLRKSFRWLKDRYTQV  110



>ref|XP_007024534.1| Uncharacterized protein TCM_029075 [Theobroma cacao]
 gb|EOY27156.1| Uncharacterized protein TCM_029075 [Theobroma cacao]
Length=131

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = +1

Query  118  FEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            F   +KS+SFN      +PE++R+KRVA Y +YA+EGK K SLR SF+WIK  +T   Y
Sbjct  76   FGSSSKSWSFN------DPELQRKKRVASYKVYAVEGKMKGSLRKSFRWIKDTYTQVVY  128



>gb|AGV54821.1| hypothetical protein [Phaseolus vulgaris]
Length=118

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVAGY +YA EGK K SLR SF+WIK  +T   Y
Sbjct  67   SKSWSFS------DPELQRKKRVAGYKIYAAEGKMKGSLRKSFRWIKHTYTQALY  115



>gb|KHN29707.1| hypothetical protein glysoja_016329 [Glycine soja]
Length=115

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVA Y MY++EGK K S R SF+W+K K++H  Y
Sbjct  65   SKSWSF------ADPELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVY  113



>ref|XP_004486852.1| PREDICTED: uncharacterized protein LOC101489777 [Cicer arietinum]
Length=110

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +1

Query  118  FEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
             +G +KS+S N      +PE+KR+KRVAGY +YA EGK K SL+ S +WIK+ +T  
Sbjct  55   VKGISKSWSLN------DPELKRKKRVAGYKIYAAEGKMKGSLKKSLRWIKSTYTQA  105



>ref|NP_001235166.1| uncharacterized protein LOC100305934 [Glycine max]
 gb|ACU13857.1| unknown [Glycine max]
 gb|KHN32197.1| hypothetical protein glysoja_035290 [Glycine soja]
Length=115

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  142  SFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            SF+      +PE++R+KR+A Y MY++EGK K S R SF+W+K K++H  Y
Sbjct  63   SFSKSWSLADPEIRRKKRIASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVY  113



>ref|XP_002873541.1| hypothetical protein ARALYDRAFT_488039 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49800.1| hypothetical protein ARALYDRAFT_488039 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  127  RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + KS + +   G  +PE++R+KRVA Y MY +EGK K S RNSF+W+K ++T   Y
Sbjct  49   KEKSIARSKSWGITDPELQRKKRVASYKMYGVEGKVKGSFRNSFRWLKQRYTQVVY  104



>ref|NP_196758.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87670.1| putative protein [Arabidopsis thaliana]
 gb|AAL49887.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20368.1| unknown protein [Arabidopsis thaliana]
 gb|AAM61733.1| unknown [Arabidopsis thaliana]
 gb|AED91746.1| uncharacterized protein AT5G11970 [Arabidopsis thaliana]
Length=105

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  127  RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + KS + +   G  +PE++R+KRVA Y MY +EGK K S RNSF+W+K ++T   Y
Sbjct  47   KEKSIARSKSWGITDPELQRKKRVASYKMYGVEGKVKGSFRNSFRWLKQRYTQVVY  102



>ref|NP_001235259.1| uncharacterized protein LOC100305940 [Glycine max]
 gb|ACU13865.1| unknown [Glycine max]
Length=117

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVAGY +YA EGK K SLR SF+WIK  +    Y
Sbjct  66   SKSWSFT------DPELQRKKRVAGYKIYAAEGKLKGSLRKSFRWIKNTYAQALY  114



>ref|XP_006855324.1| hypothetical protein AMTR_s00057p00084630 [Amborella trichopoda]
 gb|ERN16791.1| hypothetical protein AMTR_s00057p00084630 [Amborella trichopoda]
Length=103

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G++KS S   P    +PE+KRRKRVAGY +YA+EG+ K+S R SF+WIK K +   +
Sbjct  45   GKSKSRSSVRPWCLSDPEMKRRKRVAGYKVYAVEGRVKASFRRSFRWIKDKCSELIH  101



>ref|XP_008462341.1| PREDICTED: uncharacterized protein LOC103500715 [Cucumis melo]
Length=116

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = +1

Query  115  DFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +F   +KS+SF       +PE++R+ RVAGY +YA+EGK K SLR SF+WIK  +T   Y
Sbjct  60   NFGSTSKSWSFK------DPELQRKTRVAGYKVYAVEGKMKGSLRKSFRWIKNTYTQVVY  113



>ref|XP_008793205.1| PREDICTED: uncharacterized protein LOC103709558 isoform X2 [Phoenix 
dactylifera]
Length=167

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRV GY  YAMEGK K SLR SF+W+K ++T   Y
Sbjct  77   DPELQRKKRVVGYKAYAMEGKMKGSLRKSFRWLKERYTQVVY  118



>ref|XP_004507952.1| PREDICTED: uncharacterized protein LOC101497454 [Cicer arietinum]
Length=131

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +YA+EGK K SLR SFKWIK + T   +
Sbjct  81   SKSWSFN------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWIKDRCTRVVH  129



>ref|XP_008793204.1| PREDICTED: uncharacterized protein LOC103709558 isoform X1 [Phoenix 
dactylifera]
Length=168

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRV GY  YAMEGK K SLR SF+W+K ++T   Y
Sbjct  77   DPELQRKKRVVGYKAYAMEGKMKGSLRKSFRWLKERYTQVVY  118



>ref|NP_001051794.1| Os03g0831400 [Oryza sativa Japonica Group]
 gb|AAO39867.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP46237.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99709.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13708.1| Os03g0831400 [Oryza sativa Japonica Group]
 gb|EAY92448.1| hypothetical protein OsI_14181 [Oryza sativa Indica Group]
 gb|EAZ29170.1| hypothetical protein OsJ_13229 [Oryza sativa Japonica Group]
 dbj|BAG92370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=74

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  115  DFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            D + RT + S ++P    +PE KRR+RVA Y  YA+E + K+SLR  F+WIK +F   +
Sbjct  16   DGDERTVASSSSTPWWSGDPEAKRRRRVAAYKAYAVEARVKASLRRGFRWIKDRFVRRW  74



>ref|XP_010925470.1| PREDICTED: uncharacterized protein LOC105047996 [Elaeis guineensis]
Length=121

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRV GY  YA+EGK K SLR SF+WIK ++T   Y
Sbjct  77   DPELQRKKRVVGYKAYAVEGKMKGSLRKSFRWIKERYTQVVY  118



>ref|XP_004141806.1| PREDICTED: uncharacterized protein LOC101209615 [Cucumis sativus]
 ref|XP_004155972.1| PREDICTED: uncharacterized LOC101209615 [Cucumis sativus]
 gb|KGN45515.1| hypothetical protein Csa_7G450720 [Cucumis sativus]
Length=116

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+ RVAGY +YA+EGK K SLR SF+WIK  +T   Y
Sbjct  65   SKSWSFK------DPELQRKTRVAGYKVYAVEGKMKGSLRKSFRWIKNTYTQVVY  113



>gb|KFK25455.1| hypothetical protein AALP_AA8G117500 [Arabis alpina]
Length=104

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  88   SSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWI  267
            S++Y     D + + KS + +   G  +PE++R+KRVA Y MY++EGK K S R SF+W+
Sbjct  34   SASYVTTENDLK-KGKSIARSKSWGITDPELQRKKRVASYKMYSVEGKVKGSFRKSFRWL  92

Query  268  KTKFTHTYY  294
            K ++T   Y
Sbjct  93   KQRYTQVVY  101



>ref|XP_006290018.1| hypothetical protein CARUB_v10003648mg [Capsella rubella]
 gb|EOA22916.1| hypothetical protein CARUB_v10003648mg [Capsella rubella]
Length=106

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  FDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            +D + + KS + +   G  +PE+ R+KRVA Y MY +EGK K S R SF+W+K ++T   
Sbjct  43   YDLKKKEKSIARSKSWGITDPELLRKKRVASYKMYGVEGKVKGSFRKSFRWLKHRYTQVV  102

Query  292  Y  294
            Y
Sbjct  103  Y  103



>gb|AFK48123.1| unknown [Lotus japonicus]
Length=121

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R SF+W+K K++H  Y
Sbjct  77   ADPELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVY  119



>ref|XP_002277637.1| PREDICTED: uncharacterized protein LOC100267009 [Vitis vinifera]
Length=117

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +YA+EGK K S R SF+WIK  +T   Y
Sbjct  66   SKSWSFN------DPELQRKKRVASYKVYAVEGKMKGSFRKSFRWIKDTYTQVVY  114



>ref|NP_001236294.1| uncharacterized protein LOC100305758 [Glycine max]
 gb|ACU13613.1| unknown [Glycine max]
Length=121

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVAGY +Y+ EGK K SLR S +WIK  +T   +
Sbjct  70   SKSWSFN------DPELQRKKRVAGYKIYSAEGKMKGSLRKSLRWIKNTYTQAVH  118



>emb|CDX69715.1| BnaA10g20640D [Brassica napus]
Length=105

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            GR+KS+      G  +PE+KR+KRVA Y MY++EGK K S R SF+W+K ++T   Y
Sbjct  52   GRSKSW------GITDPELKRKKRVASYKMYSVEGKVKGSFRKSFRWLKHRYTQVVY  102



>ref|XP_009121895.1| PREDICTED: uncharacterized protein LOC103846677 [Brassica rapa]
Length=105

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            GR+KS+      G  +PE+KR+KRVA Y MY++EGK K S R SF+W+K ++T   Y
Sbjct  52   GRSKSW------GITDPELKRKKRVASYKMYSVEGKVKGSFRKSFRWLKHRYTQVVY  102



>gb|KHN39325.1| hypothetical protein glysoja_018097 [Glycine soja]
Length=121

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVAGY +Y+ EGK K SLR S +WIK  +T   +
Sbjct  70   SKSWSFN------DPELQRKKRVAGYKIYSAEGKMKGSLRKSLRWIKNTYTQAVH  118



>gb|KDP40744.1| hypothetical protein JCGZ_24743 [Jatropha curcas]
Length=123

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVA Y +YA+EGK K SLR SF+WIK  +T   Y
Sbjct  72   SKSWSFK------DPELQRKKRVASYKVYAVEGKMKGSLRKSFRWIKDTYTQVVY  120



>emb|CDX70437.1| BnaC03g05210D [Brassica napus]
Length=106

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  73   FPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRN  252
            F  +S+S  TE       + KS + +   G  +PE++R+KRVA Y MY++EGK K S R 
Sbjct  30   FRSYSASYATETNIYNIKKEKSIARSKSWGITDPELQRKKRVASYKMYSVEGKVKGSFRK  89

Query  253  SFKWIKTKFTHTYY  294
            SF+W+K ++T   Y
Sbjct  90   SFRWLKQRYTQVVY  103



>gb|KJB56940.1| hypothetical protein B456_009G142700 [Gossypium raimondii]
Length=116

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 6/51 (12%)
 Frame = +1

Query  118  FEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIK  270
            F   +KS+SFN      +PE++R+KRVAGY +YA+EGK K SLR SF+WIK
Sbjct  64   FGSSSKSWSFN------DPELQRKKRVAGYKVYAVEGKMKGSLRKSFRWIK  108



>ref|XP_003597563.1| hypothetical protein MTR_2g099630 [Medicago truncatula]
 gb|AES67814.1| DUF3511 domain protein [Medicago truncatula]
Length=108

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF +     +PE++R+KR+AGY MY  EGK K SLR S +WIK  +T   Y
Sbjct  56   SKSWSFMN-----DPELQRKKRIAGYKMYGAEGKMKGSLRKSLRWIKNTYTQAIY  105



>ref|XP_010915301.1| PREDICTED: uncharacterized protein LOC105040464 [Elaeis guineensis]
Length=120

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRV GY  YA+EGK K SLR SF+W+K ++T   Y
Sbjct  76   DPELQRKKRVVGYKAYAVEGKMKGSLRKSFRWLKERYTQVVY  117



>ref|XP_009397468.1| PREDICTED: uncharacterized protein LOC103982302 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397470.1| PREDICTED: uncharacterized protein LOC103982302 [Musa acuminata 
subsp. malaccensis]
Length=119

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY  YA+EGK K SLR SF+W+K + T   Y
Sbjct  75   DPELQRKKRVAGYKAYAVEGKMKGSLRRSFRWLKDRCTQVVY  116



>ref|XP_008791272.1| PREDICTED: uncharacterized protein LOC103708229 [Phoenix dactylifera]
Length=120

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +PE++R+KRV GY  YA+EGK K SLR SF+W+K ++T   Y  S
Sbjct  76   DPELQRKKRVVGYKAYAVEGKMKGSLRKSFRWLKERYTQAVYGWS  120



>ref|XP_009131248.1| PREDICTED: uncharacterized protein LOC103855949 [Brassica rapa]
 emb|CDX78460.1| BnaA03g03720D [Brassica napus]
Length=106

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  73   FPYHSSSAYTEARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRN  252
            F  +S+S  TE       + KS + +   G  +PE++R+KRVA Y MY++EGK K S R 
Sbjct  30   FRSYSTSYATENNIYNIKKEKSIARSKSWGITDPELQRKKRVASYKMYSVEGKVKGSFRK  89

Query  253  SFKWIKTKFTHTYY  294
            SF+W+K ++T   Y
Sbjct  90   SFRWLKQRYTQVVY  103



>gb|KJB65518.1| hypothetical protein B456_010G098600 [Gossypium raimondii]
Length=115

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +R+KRVA Y MY++EGK K SLR SF+W+K K+T   Y
Sbjct  70   ADPEFQRKKRVASYKMYSVEGKVKGSLRRSFRWLKVKYTQVVY  112



>ref|XP_006842334.1| hypothetical protein AMTR_s00079p00164570 [Amborella trichopoda]
 gb|ERN04009.1| hypothetical protein AMTR_s00079p00164570 [Amborella trichopoda]
Length=87

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            +PEVKRRKRVAGY +YA+EG+ K+S R SF+WIK K
Sbjct  44   DPEVKRRKRVAGYKVYAVEGRVKASFRKSFRWIKDK  79



>ref|NP_001237797.1| uncharacterized protein LOC100527044 [Glycine max]
 gb|ACU16083.1| unknown [Glycine max]
Length=115

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVA Y MY++EGK K S   SF+W+K K++H  Y
Sbjct  65   SKSWSF------ADPELRRKKRVASYKMYSVEGKIKGSFMKSFRWLKNKYSHVVY  113



>emb|CDX97159.1| BnaC09g44660D [Brassica napus]
Length=105

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            GR+KS+      G  +PE+KR+KRVA Y MY++EG+ K S R SF+W+K ++T   Y
Sbjct  52   GRSKSW------GITDPELKRKKRVASYKMYSVEGQVKGSFRKSFRWLKHRYTQVVY  102



>ref|XP_006387696.1| hypothetical protein POPTR_0667s00200g [Populus trichocarpa]
 gb|ERP46610.1| hypothetical protein POPTR_0667s00200g [Populus trichocarpa]
Length=122

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 6/60 (10%)
 Frame = +1

Query  115  DFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + E  +KS+SFN      + E++R++RVA Y +YA+EGK K SLR SF+WIK   T   Y
Sbjct  66   NLESSSKSWSFN------DHELQRKRRVANYKVYAIEGKMKGSLRKSFRWIKDTCTQVVY  119



>ref|XP_006399717.1| hypothetical protein EUTSA_v10015080mg [Eutrema salsugineum]
 gb|ESQ41170.1| hypothetical protein EUTSA_v10015080mg [Eutrema salsugineum]
Length=107

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  127  RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            + KS + +   G  +PE++R+KRVA Y MY++EGK K S R SF+W+K ++T   Y
Sbjct  49   KGKSIARSKSWGITDPELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVY  104



>ref|XP_010090075.1| hypothetical protein L484_027306 [Morus notabilis]
 gb|EXB38872.1| hypothetical protein L484_027306 [Morus notabilis]
Length=133

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K++SFN      +PE++R+KRVA Y +YA+EGK K SLR SF+W+K + T   Y
Sbjct  83   SKTWSFN------DPELQRKKRVASYKVYAVEGKVKGSLRKSFRWLKERCTRVVY  131



>gb|AEW08166.1| hypothetical protein 2_1728_01, partial [Pinus radiata]
 gb|AFG44222.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44223.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44224.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44225.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44227.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44231.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44232.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44233.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44234.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44235.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44236.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44237.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44238.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
Length=111

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PEVKRRKRVA Y +Y +EGK K S R SF+W+K K+T   Y
Sbjct  64   GLNDPEVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVY  108



>gb|AFG44226.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44228.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44229.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44230.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
Length=111

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PEVKRRKRVA Y +Y +EGK K S R SF+W+K K+T   Y
Sbjct  64   GLNDPEVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVY  108



>ref|XP_002976822.1| hypothetical protein SELMODRAFT_105899 [Selaginella moellendorffii]
 ref|XP_002980551.1| hypothetical protein SELMODRAFT_112741 [Selaginella moellendorffii]
 gb|EFJ18202.1| hypothetical protein SELMODRAFT_112741 [Selaginella moellendorffii]
 gb|EFJ21932.1| hypothetical protein SELMODRAFT_105899 [Selaginella moellendorffii]
Length=95

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  82   HSSSAYT------EARFDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSS  243
            HS+ +Y+      EA +  +   KS S  S     +PE+KR+KRVA Y ++ +EGK KSS
Sbjct  16   HSAPSYSSGYNNPEAGYQIKEHKKSSSSRSWDFRNDPEMKRKKRVASYKVFTVEGKVKSS  75

Query  244  LRNSFKWIKTKFTHTYY  294
            +RNSF+WIK K+    Y
Sbjct  76   VRNSFRWIKNKYLEMRY  92



>ref|NP_001239917.1| uncharacterized protein LOC100818486 [Glycine max]
 gb|ACU17866.1| unknown [Glycine max]
 gb|KHN11261.1| hypothetical protein glysoja_023325 [Glycine soja]
Length=121

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVAGY +Y++EGK K SLR S +WIK  +    +
Sbjct  70   SKSWSFN------DPELQRKKRVAGYKIYSVEGKMKGSLRKSLRWIKNTYAQAVH  118



>ref|XP_006465997.1| PREDICTED: uncharacterized protein LOC102621718 [Citrus sinensis]
Length=114

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +1

Query  118  FEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            F   +KS+SFN      +PE++R+KRVA Y +Y +EGK K SLR S KW+K  +T   +
Sbjct  59   FGSASKSWSFN------DPELQRKKRVASYKVYTVEGKMKGSLRKSLKWVKNTYTQIVH  111



>ref|XP_009631852.1| PREDICTED: uncharacterized protein LOC104121539 [Nicotiana tomentosiformis]
Length=111

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = +1

Query  55   MEKSKSFPYHSSSAYTEARFDFEGRTK---------SYSFNSPAGDCNPEVKRRKRVAGY  207
            M+  +SF  +S + Y+    D E + K         +++FN      +PE++R++RV GY
Sbjct  26   MQDLRSFSTNSYAPYSYGGIDKEVKIKKSKSTASSRNWAFN------DPELQRKRRVIGY  79

Query  208  NMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
              YAMEGK K SLR SF+WIK    H  +
Sbjct  80   KSYAMEGKMKGSLRKSFRWIKNTCNHVVH  108



>ref|XP_007136845.1| hypothetical protein PHAVU_009G079000g [Phaseolus vulgaris]
 gb|ESW08839.1| hypothetical protein PHAVU_009G079000g [Phaseolus vulgaris]
Length=113

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  142  SFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            SF+      +PE++R+KRVA Y MY++EGK K S R SF+W+K K++   Y
Sbjct  61   SFSKSLTLSDPELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSQVVY  111



>ref|XP_007135522.1| hypothetical protein PHAVU_010G136400g [Phaseolus vulgaris]
 gb|ESW07516.1| hypothetical protein PHAVU_010G136400g [Phaseolus vulgaris]
Length=119

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVAGY +Y++EGK K SLR S +WIK  +    +
Sbjct  68   SKSWSFN------DPELQRKKRVAGYKIYSVEGKMKGSLRKSLRWIKNTYIQAVH  116



>gb|ABK21328.1| unknown [Picea sitchensis]
Length=122

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PEVKRRKRVA Y +Y +EGK K S R SF+W+K K+T   Y
Sbjct  75   GLNDPEVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVY  119



>gb|KJB54405.1| hypothetical protein B456_009G032700 [Gossypium raimondii]
Length=124

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +KS+S N      +PE++R+KRVA Y +Y +EG+ K SL+ SF+W+K ++T   Y SS
Sbjct  71   SKSWSLN------DPELQRKKRVASYKVYDVEGRVKGSLKKSFRWLKDRYTRIVYGSS  122



>ref|XP_006426586.1| hypothetical protein CICLE_v10026799mg [Citrus clementina]
 gb|ESR39826.1| hypothetical protein CICLE_v10026799mg [Citrus clementina]
 gb|KDO65155.1| hypothetical protein CISIN_1g033649mg [Citrus sinensis]
Length=114

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +1

Query  118  FEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            F   +KS+SFN      +PE++R+KRVA Y +Y +EGK K SLR S KW+K  +T   +
Sbjct  59   FGSVSKSWSFN------DPELQRKKRVASYKVYTVEGKMKGSLRKSLKWVKNTYTQIVH  111



>ref|XP_007012782.1| Uncharacterized protein TCM_037625 [Theobroma cacao]
 gb|EOY30401.1| Uncharacterized protein TCM_037625 [Theobroma cacao]
Length=123

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE+KR+KRVA Y +Y +EGK K SL+ SF+W+K +++   Y
Sbjct  73   SKSWSFN------DPELKRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRYSRVVY  121



>ref|XP_009334737.1| PREDICTED: uncharacterized protein LOC103927523 [Pyrus x bretschneideri]
Length=128

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R SF+W+K K+T   Y
Sbjct  83   ADPELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLY  125



>gb|ABK22684.1| unknown [Picea sitchensis]
 gb|ACN40692.1| unknown [Picea sitchensis]
Length=105

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 7/62 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNP-------EVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            + +Y+FN P    N        ++KR+KRVA Y + A+EGK K+S+R+SFKW+KTK+T  
Sbjct  42   SNAYNFNGPKVKANAFGVQNDADMKRKKRVASYKVLAVEGKMKNSVRSSFKWLKTKYTEI  101

Query  289  YY  294
             Y
Sbjct  102  RY  103



>gb|EYU29346.1| hypothetical protein MIMGU_mgv1a024776mg [Erythranthe guttata]
Length=116

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+S N      +PEV+R+KRVA Y +Y++EGK K S R SF+W+K ++T   Y
Sbjct  64   SKSWSLN------DPEVQRKKRVASYKVYSVEGKVKGSFRKSFRWLKDRYTQVVY  112



>ref|XP_004157365.1| PREDICTED: uncharacterized protein LOC101228331 isoform 1 [Cucumis 
sativus]
 ref|XP_004157366.1| PREDICTED: uncharacterized protein LOC101228331 isoform 2 [Cucumis 
sativus]
 gb|KGN55347.1| hypothetical protein Csa_4G646210 [Cucumis sativus]
Length=112

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE +R+KRVA Y MY++EGK K S RNSF+W+K K  H  Y
Sbjct  61   SKSWSF------SDPEFQRKKRVANYKMYSVEGKMKGSFRNSFRWLKRKCEHVVY  109



>gb|KCW81706.1| hypothetical protein EUGRSUZ_C03059 [Eucalyptus grandis]
Length=132

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVA Y MYA+EGK K S R SF+W+K ++T  +Y
Sbjct  82   DPELQRKKRVASYKMYAVEGKVKGSFRKSFRWLKDRYTRVFY  123



>ref|XP_008393620.1| PREDICTED: uncharacterized protein LOC103455808 [Malus domestica]
Length=126

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R SF+W+K K+T   Y
Sbjct  81   ADPELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLY  123



>ref|XP_009362205.1| PREDICTED: uncharacterized protein LOC103952357 [Pyrus x bretschneideri]
Length=129

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R SF+W+K K+T   Y
Sbjct  84   ADPELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLY  126



>gb|KJB54658.1| hypothetical protein B456_009G043500 [Gossypium raimondii]
Length=122

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE +R+KRVA Y MY++EGK K SLR SF+W+K K+T   Y
Sbjct  78   DPEFQRKKRVASYKMYSVEGKVKGSLRRSFRWLKDKYTQVVY  119



>ref|NP_001060710.1| Os07g0690200 [Oryza sativa Japonica Group]
 dbj|BAC16037.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22624.1| Os07g0690200 [Oryza sativa Japonica Group]
 gb|EAZ05223.1| hypothetical protein OsI_27421 [Oryza sativa Indica Group]
 gb|EAZ41168.1| hypothetical protein OsJ_25664 [Oryza sativa Japonica Group]
 dbj|BAG98353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=88

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            +PE+KRR+RVAGY  YA+EGK K+S+R   +WIK K +H 
Sbjct  46   DPEMKRRRRVAGYKSYAVEGKVKASIRRGLRWIKAKCSHI  85



>ref|XP_010491951.1| PREDICTED: uncharacterized protein LOC104769433 [Camelina sativa]
Length=107

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  FDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            +D   + KS   +   G  +PE++R+KRVA Y MY +EGK K S   SF+W+K ++T   
Sbjct  44   YDLNKKEKSIPRSKSWGITDPELQRKKRVASYKMYGVEGKVKGSFTKSFRWLKRRYTQVV  103

Query  292  Y  294
            Y
Sbjct  104  Y  104



>emb|CDP03142.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K SL+ SF+W+K + T   Y
Sbjct  73   SKSWSFN------DPELQRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRCTQVVY  121



>ref|XP_009125840.1| PREDICTED: uncharacterized protein LOC103850805 [Brassica rapa]
Length=105

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PE+ R+KRVA Y MY++EGK K S R SF+W+K ++T   Y
Sbjct  60   GITDPELLRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVLY  104



>ref|XP_010453260.1| PREDICTED: uncharacterized protein LOC104735212 [Camelina sativa]
Length=107

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  FDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            +D   + KS   +   G  +PE++R+KRVA Y MY +EGK K S   SF+W+K ++T   
Sbjct  44   YDLNKKEKSIPRSKSWGITDPELQRKKRVASYKMYGVEGKVKGSFTKSFRWLKRRYTQVV  103

Query  292  Y  294
            Y
Sbjct  104  Y  104



>gb|KHN17682.1| hypothetical protein glysoja_005879 [Glycine soja]
Length=123

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVA Y +YA+EGK K SLR SFKW+K +     Y
Sbjct  74   SKSWSFS------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVY  122



>ref|NP_001239845.1| uncharacterized protein LOC100799273 [Glycine max]
 gb|ACU18953.1| unknown [Glycine max]
Length=105

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 6/47 (13%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIK  270
            +KS+SF+      +PE++R+KRVAGY +YA EGK K SLR SF+WIK
Sbjct  63   SKSWSFS------DPELQRKKRVAGYKIYAAEGKMKGSLRKSFRWIK  103



>gb|EMT32572.1| hypothetical protein F775_29998 [Aegilops tauschii]
Length=120

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +P+++R++RVA Y  YAMEGK K S R SF+WIK ++ H  Y  S
Sbjct  76   DPDMERKRRVAAYKAYAMEGKVKGSFRKSFRWIKDRYLHLVYGVS  120



>ref|NP_001236822.1| uncharacterized protein LOC100527749 [Glycine max]
 gb|ACU16908.1| unknown [Glycine max]
Length=122

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVA Y +YA+EGK K SLR SFKW+K +     Y
Sbjct  73   SKSWSFS------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVY  121



>emb|CDM82593.1| unnamed protein product [Triticum aestivum]
Length=120

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +P+++R++RVA Y  YAMEGK K S R SF+WIK ++ H  Y  S
Sbjct  76   DPDMERKRRVAAYKAYAMEGKVKGSFRKSFRWIKDRYLHLVYGVS  120



>ref|XP_010419781.1| PREDICTED: uncharacterized protein LOC104705466 [Camelina sativa]
Length=107

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  FDFEGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            +D   + KS   +   G  +PE++R+KRVA Y MY +EGK K S   SF+W+K ++T   
Sbjct  44   YDLNKKEKSIPRSKSWGITDPELQRKKRVASYKMYGVEGKVKGSFTKSFRWLKRRYTQVV  103

Query  292  Y  294
            Y
Sbjct  104  Y  104



>gb|KGN47609.1| hypothetical protein Csa_6G364115 [Cucumis sativus]
Length=80

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +R+KRVA Y MY++EGK K S R SF+W+K K+T   Y
Sbjct  35   ADPEFQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQMLY  77



>ref|XP_003603170.1| hypothetical protein MTR_3g104640 [Medicago truncatula]
 gb|AES73421.1| DUF3511 domain protein [Medicago truncatula]
 gb|AFK38313.1| unknown [Medicago truncatula]
Length=110

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVA Y MY++EGK K S R SF+W+K K++   Y
Sbjct  67   DPELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKNKYSQVVY  108



>ref|XP_007154634.1| hypothetical protein PHAVU_003G135000g [Phaseolus vulgaris]
 gb|ESW26628.1| hypothetical protein PHAVU_003G135000g [Phaseolus vulgaris]
Length=116

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVA Y +YA+EGK K SLR SFKW+K +     Y
Sbjct  66   SKSWSFS------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVY  114



>ref|XP_010242270.1| PREDICTED: uncharacterized protein LOC104586667 [Nelumbo nucifera]
Length=124

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVA Y +Y +EGK K SLR SF+W+K ++T   Y
Sbjct  80   DPELQRKKRVASYKVYTVEGKMKGSLRKSFRWLKDRYTQVVY  121



>ref|XP_009388679.1| PREDICTED: uncharacterized protein LOC103975440 [Musa acuminata 
subsp. malaccensis]
Length=119

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIK---TKFTHTYY  294
            +PE++R+KRVAGY  YA+EGK K  LR SF+W+K   TK  H ++
Sbjct  75   DPELQRKKRVAGYKAYAVEGKMKGGLRKSFRWLKDRCTKVVHGWW  119



>ref|XP_009372399.1| PREDICTED: uncharacterized protein LOC103961551 [Pyrus x bretschneideri]
 ref|XP_009340680.1| PREDICTED: uncharacterized protein LOC103932761 [Pyrus x bretschneideri]
Length=125

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY +Y  E K K SLR SFKWIK  +T   Y
Sbjct  81   DPELQRKKRVAGYKVYTAEEKMKGSLRKSFKWIKNTYTQVVY  122



>ref|XP_008391355.1| PREDICTED: uncharacterized protein LOC103453586 [Malus domestica]
Length=125

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY +Y  E K K SLR SFKWIK  +T   Y
Sbjct  81   DPELQRKKRVAGYKVYTAEEKMKGSLRKSFKWIKNTYTQVVY  122



>emb|CDP08289.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE +R+KRVA Y +Y++EGK K S R SF+W+K K+T   Y
Sbjct  99   SKSWSFN------DPEFQRKKRVASYKVYSVEGKVKGSFRRSFRWLKDKYTQVLY  147



>ref|XP_002304103.1| hypothetical protein POPTR_0003s04160g [Populus trichocarpa]
 gb|EEE79082.1| hypothetical protein POPTR_0003s04160g [Populus trichocarpa]
Length=116

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K +SFN      +PE+KR++RVA Y +YAMEGK K +LR S +WIK   T   +
Sbjct  65   SKRWSFN------DPELKRKRRVANYKVYAMEGKMKGTLRKSIRWIKDTCTQVVH  113



>gb|KFK41693.1| hypothetical protein AALP_AA2G160700 [Arabis alpina]
Length=123

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +1

Query  82   HSSSAYTEARFDFEGRTKSYSFNSPA--GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNS  255
            +S+S Y+  +     R KS   N     G C  +++R+KRVAGYN+Y +EGK K S+R S
Sbjct  48   YSTSTYSPHKNPTMVRDKSKRSNKKGFKGLCEADIQRKKRVAGYNVYGVEGKVKGSMRKS  107

Query  256  FKWIKTKFTHTYY  294
            FKW K   ++  Y
Sbjct  108  FKWFKETCSNVVY  120



>gb|AFO66519.1| putative ABC superfamily ATP binding cassette transporter [Brassica 
napus]
Length=356

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            GR+KS+      G  +PE+KR+KRVA Y MY++EGK K S R SF+W+K ++T  
Sbjct  109  GRSKSW------GITDPELKRKKRVASYKMYSVEGKVKGSFRKSFRWLKHRYTQV  157



>ref|XP_007204834.1| hypothetical protein PRUPE_ppa026980mg [Prunus persica]
 gb|EMJ06033.1| hypothetical protein PRUPE_ppa026980mg [Prunus persica]
Length=125

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K SLR SF+W+K       Y
Sbjct  75   SKSWSFN------DPELQRKKRVASYKVYTVEGKLKGSLRKSFRWVKETCNRVVY  123



>ref|XP_008220505.1| PREDICTED: uncharacterized protein LOC103320582 [Prunus mume]
Length=119

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PE++R+KRVA Y MY++EGK K S R SF+W+K K T   Y
Sbjct  72   GLMDPELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKCTQVVY  116



>ref|XP_007223475.1| hypothetical protein PRUPE_ppa013495mg [Prunus persica]
 gb|EMJ24674.1| hypothetical protein PRUPE_ppa013495mg [Prunus persica]
Length=119

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G  +PE++R+KRVA Y MY++EGK K S R SF+W+K K T   Y
Sbjct  72   GLMDPELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKCTQVVY  116



>ref|XP_009785242.1| PREDICTED: uncharacterized protein LOC104233535 [Nicotiana sylvestris]
 ref|XP_009785243.1| PREDICTED: uncharacterized protein LOC104233535 [Nicotiana sylvestris]
 ref|XP_009785244.1| PREDICTED: uncharacterized protein LOC104233535 [Nicotiana sylvestris]
 ref|XP_009785245.1| PREDICTED: uncharacterized protein LOC104233535 [Nicotiana sylvestris]
Length=103

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            T + S   P G  +PE+KRRKR+A Y +Y +EGKFK+S+RN  +W K K +   +
Sbjct  47   TATSSSAKPWGFNDPEMKRRKRIAKYKVYTIEGKFKTSIRNGLRWFKNKCSEIIH  101



>emb|CCM07289.1| Chromosome chr9 scaffold_7, whole genome shotgun sequence [Musa 
balbisiana]
Length=158

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY  YA+EGK K  LR SF+W+K + T   Y
Sbjct  75   DPELQRKKRVAGYKAYAVEGKMKGGLRKSFRWLKDRCTKVVY  116



>ref|XP_004247381.1| PREDICTED: uncharacterized protein LOC101261064 [Solanum lycopersicum]
Length=168

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  142  SFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            S+N P G  +PE+KRRKR+A Y +Y +EGK K+S+RN  +W K K
Sbjct  116  SWNKPWGFNDPEMKRRKRIAKYKVYTIEGKVKTSIRNGLRWFKNK  160



>gb|KGN52839.1| hypothetical protein Csa_4G002560 [Cucumis sativus]
Length=91

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (54%), Gaps = 1/67 (1%)
 Frame = +1

Query  97   YTEARFDFEG-RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKT  273
            Y     D  G R  S +   P G  +PE KRRKR+A Y +Y +EG+ K SLR   +WIK 
Sbjct  23   YRSPNLDTNGNRVGSAATGKPWGFADPEAKRRKRIAKYKVYTVEGRVKDSLRKGLRWIKN  82

Query  274  KFTHTYY  294
            K +   +
Sbjct  83   KCSRIVH  89



>gb|KEH39921.1| DUF3511 domain protein [Medicago truncatula]
Length=119

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            GD +PE +R+KRVA Y MY++EGK K S R SFKW+K ++ H  Y
Sbjct  73   GD-DPEFQRKKRVASYKMYSVEGKVKGSFRKSFKWLKNRYWHVVY  116



>gb|KJB74840.1| hypothetical protein B456_012G010400 [Gossypium raimondii]
Length=183

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 6/53 (11%)
 Frame = +1

Query  136  SYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            ++SFN      +PE++R+KRVA Y +YA+EGK K SLR SF+WIK  +    Y
Sbjct  71   TWSFN------DPELQRKKRVASYKVYAVEGKMKGSLRKSFRWIKDTYIQAVY  117



>ref|XP_002519185.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43049.1| conserved hypothetical protein [Ricinus communis]
Length=123

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +1

Query  127  RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKF  279
            R  S+SF S     +PE+KR++RV  Y  YA+EG  K+SLRNSF+WIK K+
Sbjct  71   RASSWSFTS-----DPELKRQRRVVKYKAYAVEGNMKTSLRNSFRWIKNKY  116



>ref|XP_006575776.1| PREDICTED: uncharacterized protein LOC102665932 [Glycine max]
Length=94

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIK---TKFTHTY  291
            +PE KRRKR+A YN+YA+EGK K++LR+  +WIK   ++  H Y
Sbjct  51   DPESKRRKRIAKYNVYAVEGKVKATLRDGIRWIKHTCSRIVHGY  94



>ref|XP_008242377.1| PREDICTED: uncharacterized protein LOC103340711 [Prunus mume]
Length=157

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K SLR SF+W+K       Y
Sbjct  107  SKSWSFN------DPELQRKKRVASYKVYTVEGKLKGSLRKSFRWVKETCNRVVY  155



>gb|KJB68771.1| hypothetical protein B456_011G063500 [Gossypium raimondii]
Length=132

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE++R+KRVA Y +YA+EGK K S R SF+WIK   T   Y
Sbjct  61   SKSWSF------TDPELQRKKRVASYKVYAVEGKMKGSFRKSFRWIKDTATQVVY  109



>dbj|BAJ85795.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=80

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            GD   E+KRR RVAGY  YA+EGK K+SLR   +WIK K +H  +
Sbjct  36   GD-QAEMKRRGRVAGYKAYAVEGKVKASLRRGLRWIKAKCSHIVH  79



>ref|NP_001236849.1| uncharacterized protein LOC100306567 [Glycine max]
 gb|ACU14797.1| unknown [Glycine max]
Length=116

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVA Y +YA+EGK K SLR SFKW K +     Y
Sbjct  66   SKSWSFS------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWFKDRCNRVVY  114



>ref|XP_007215163.1| hypothetical protein PRUPE_ppa013537mg [Prunus persica]
 gb|EMJ16362.1| hypothetical protein PRUPE_ppa013537mg [Prunus persica]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY +Y  E K K SLR SF+WIK  +T   Y
Sbjct  73   DPELQRKKRVAGYKVYTAEEKMKGSLRKSFRWIKNTYTQVVY  114



>ref|XP_008228257.1| PREDICTED: uncharacterized protein LOC103327672 [Prunus mume]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY +Y  E K K SLR SF+WIK  +T   Y
Sbjct  73   DPELQRKKRVAGYKVYTAEEKMKGSLRKSFRWIKNTYTQVVY  114



>ref|XP_009604506.1| PREDICTED: uncharacterized protein LOC104099273 isoform X3 [Nicotiana 
tomentosiformis]
Length=103

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  154  PAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            P G  +PE+KRRKR+A Y +Y +EGKFK+S+RN  +W K K +   +
Sbjct  55   PWGFNDPEMKRRKRIAKYKVYTIEGKFKTSIRNGLRWFKNKCSEIIH  101



>ref|XP_009105933.1| PREDICTED: uncharacterized protein LOC103831776 [Brassica rapa]
Length=131

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G C  E++R+KRVAGYN+Y +EGK K S++ SFKW K   ++  Y
Sbjct  84   GLCEAEIQRKKRVAGYNVYGVEGKVKGSMKKSFKWFKETCSNAVY  128



>gb|KHN06628.1| hypothetical protein glysoja_040133 [Glycine soja]
Length=116

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF+      +PE++R+KRVA Y +YA+EGK K SLR SFKW K +     Y
Sbjct  66   SKSWSFS------DPELQRKKRVASYKVYAVEGKLKGSLRKSFKWFKDRCNRVVY  114



>ref|XP_010094301.1| hypothetical protein L484_000591 [Morus notabilis]
 gb|EXB55657.1| hypothetical protein L484_000591 [Morus notabilis]
Length=113

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE +R+KRVA Y MY++EGK K S R SF+W+K K+T   Y
Sbjct  69   DPEFQRKKRVASYKMYSVEGKVKGSFRKSFRWLKDKYTQVVY  110



>ref|XP_006357712.1| PREDICTED: uncharacterized protein LOC102593175 [Solanum tuberosum]
Length=140

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K S++ SF+WIK + T   Y
Sbjct  89   SKSWSFN------DPELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVY  137



>gb|KDP33854.1| hypothetical protein JCGZ_07425 [Jatropha curcas]
Length=128

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K++SFN      +PE++R+KRVA Y +Y +EGK K SL+ SF+W+K +++   Y
Sbjct  77   SKNWSFN------DPELQRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRYSRVVY  125



>gb|EAY89674.1| hypothetical protein OsI_11208 [Oryza sativa Indica Group]
Length=145

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK---FTHTYY  294
            +PE+KRR+RVA Y  Y++EGK KSSLR  F+WIK K     H +Y
Sbjct  78   DPEMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAKCSELIHGWY  122



>ref|XP_009604505.1| PREDICTED: uncharacterized protein LOC104099273 isoform X2 [Nicotiana 
tomentosiformis]
Length=108

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  154  PAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            P G  +PE+KRRKR+A Y +Y +EGKFK+S+RN  +W K K +   +
Sbjct  60   PWGFNDPEMKRRKRIAKYKVYTIEGKFKTSIRNGLRWFKNKCSEIIH  106



>gb|EAY89670.1| hypothetical protein OsI_11203 [Oryza sativa Indica Group]
Length=146

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK---FTHTYY  294
            +PE+KRR+RVA Y  Y++EGK KSSLR  F+WIK K     H +Y
Sbjct  79   DPEMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAKCSELIHGWY  123



>ref|XP_009604502.1| PREDICTED: uncharacterized protein LOC104099273 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604503.1| PREDICTED: uncharacterized protein LOC104099273 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604504.1| PREDICTED: uncharacterized protein LOC104099273 isoform X1 [Nicotiana 
tomentosiformis]
Length=109

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  154  PAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            P G  +PE+KRRKR+A Y +Y +EGKFK+S+RN  +W K K +   +
Sbjct  61   PWGFNDPEMKRRKRIAKYKVYTIEGKFKTSIRNGLRWFKNKCSEIIH  107



>ref|XP_002281323.1| PREDICTED: uncharacterized protein LOC100266443 [Vitis vinifera]
Length=116

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K++SF+      +PE++R+KRVA Y +YA+EGK K SL+ SF+W+K ++T   +
Sbjct  66   SKAWSFS------DPELQRKKRVASYKVYAVEGKMKGSLKKSFRWLKDRYTRVIH  114



>ref|XP_006359891.1| PREDICTED: uncharacterized protein LOC102586099 [Solanum tuberosum]
Length=107

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  142  SFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            S N P G  +PE+KRRKR+A Y +Y +EGK K+S+RN  +W K K +   +
Sbjct  55   SSNKPWGFNDPEMKRRKRIAKYKVYTIEGKVKTSIRNGLRWFKNKCSEIIH  105



>ref|XP_007161038.1| hypothetical protein PHAVU_001G037600g [Phaseolus vulgaris]
 gb|ESW33032.1| hypothetical protein PHAVU_001G037600g [Phaseolus vulgaris]
Length=119

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  142  SFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            S + P    +PE +R+KRVA Y MY++EGK K S   SF+W+K K+ H  Y
Sbjct  66   SISKPWSLSDPEFQRKKRVASYKMYSVEGKVKGSFSKSFRWLKDKYWHVVY  116



>gb|EYU45868.1| hypothetical protein MIMGU_mgv1a024058mg [Erythranthe guttata]
Length=121

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  172  PEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            PE++R+KRVAGY  Y +EGK KSS R SFKWIK    H  +
Sbjct  78   PELQRKKRVAGYKAYGVEGKMKSSFRTSFKWIKDTCNHVVH  118



>emb|CBI27887.3| unnamed protein product [Vitis vinifera]
Length=144

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +K++SF+      +PE++R+KRVA Y +YA+EGK K SL+ SF+W+K ++T   +
Sbjct  66   SKAWSFS------DPELQRKKRVASYKVYAVEGKMKGSLKKSFRWLKDRYTRVIH  114



>ref|XP_008665723.1| PREDICTED: uncharacterized protein LOC100274746 [Zea mays]
 gb|ACG24541.1| hypothetical protein [Zea mays]
 tpg|DAA52346.1| TPA: hypothetical protein ZEAMMB73_915649 [Zea mays]
Length=78

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +1

Query  121  EGRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            EGR  S+  +      +PE KRR+RVAGY  YA+E + K+SLR  F+WIK + T
Sbjct  24   EGRAASWWSSG-----DPEAKRRRRVAGYKAYAVEARVKASLRKGFRWIKDRCT  72



>ref|XP_004243747.1| PREDICTED: uncharacterized protein LOC101265147 [Solanum lycopersicum]
Length=125

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K S++ SF+WIK + T   Y
Sbjct  74   SKSWSFN------DPELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVY  122



>ref|XP_003544544.1| PREDICTED: uncharacterized protein LOC100780149 [Glycine max]
 gb|KHN17252.1| hypothetical protein glysoja_010711 [Glycine soja]
Length=127

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 5/55 (9%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF +     +PE++R+KRVA Y MY++EGK K S R SF+W+K ++    Y
Sbjct  75   SKSWSFAT-----DPEIQRKKRVASYKMYSVEGKVKGSFRKSFRWLKDRYWQVVY  124



>gb|AFK43847.1| unknown [Lotus japonicus]
Length=121

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            +KS+SF+      +PE++R+KRVA Y +YA+EG+ K S R SFKWIK + T  
Sbjct  71   SKSWSFS------DPELQRKKRVASYKVYAVEGRLKGSFRKSFKWIKDRCTRV  117



>ref|XP_002516091.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46093.1| conserved hypothetical protein [Ricinus communis]
Length=130

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +R+KRVA Y MY++EGK K S R SF+W+K ++T   Y
Sbjct  85   TDPEFQRKKRVASYKMYSVEGKVKGSFRRSFRWLKDRYTQVVY  127



>ref|XP_010519843.1| PREDICTED: uncharacterized protein LOC104799158 [Tarenaya hassleriana]
Length=111

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  115  DFE-GRTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
            DFE  + KS+S +      +PE  R+KRVAGY MY  EGK + SLRNSF+WIK + +  
Sbjct  48   DFEMKKGKSFSGSKSWRLSDPEFGRKKRVAGYKMYTAEGKVRGSLRNSFRWIKRRCSQV  106



>gb|ADE76925.1| unknown [Picea sitchensis]
Length=114

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            +PEVKRRKRVA Y +YA+EG+ K+S   SF+WIK K++
Sbjct  71   DPEVKRRKRVASYKVYAVEGRVKASFLKSFRWIKDKYS  108



>ref|XP_008338712.1| PREDICTED: uncharacterized protein LOC103401770 [Malus domestica]
Length=126

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +PE++R+KRVAGY +Y  E K K SLR SFKWIK   T   Y
Sbjct  82   DPELQRKKRVAGYKVYTAEEKMKGSLRKSFKWIKNTCTQVVY  123



>ref|XP_004968999.1| PREDICTED: uncharacterized protein LOC101766251 [Setaria italica]
Length=122

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +P+++R++RVA Y  YA+EGK K S R SFKWIK ++ H  Y  S
Sbjct  78   DPDMERKRRVAAYKAYAVEGKVKGSFRKSFKWIKDRYLHLVYGWS  122



>ref|XP_010049210.1| PREDICTED: uncharacterized protein LOC104437857 [Eucalyptus grandis]
 gb|KCW81705.1| hypothetical protein EUGRSUZ_C03059 [Eucalyptus grandis]
Length=123

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            +PE++R+KRVA Y MYA+EGK K S R SF+W+K +F+
Sbjct  82   DPELQRKKRVASYKMYAVEGKVKGSFRKSFRWLKDRFS  119



>dbj|BAK04906.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +P+++R++RVA Y  YAMEGK K S R SFKW+K ++ H  Y  S
Sbjct  76   DPDMERKRRVAVYKAYAMEGKVKGSFRKSFKWMKDRYLHLVYGLS  120



>ref|XP_010924971.1| PREDICTED: uncharacterized protein LOC105047646 [Elaeis guineensis]
Length=121

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +R+KRVA Y +YA+EG+ K SL+ SF+W+K ++T   Y
Sbjct  76   SDPEFERKKRVASYKLYAVEGRVKGSLKRSFRWLKDRYTQVVY  118



>gb|AFK37685.1| unknown [Medicago truncatula]
 gb|KEH32499.1| DUF3511 domain protein [Medicago truncatula]
Length=123

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 6/49 (12%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            +KS+SF+      +PE++R+KRVA Y +Y++EGK K SLR SFKWIK +
Sbjct  73   SKSWSFS------DPELQRKKRVASYKVYSVEGKLKGSLRKSFKWIKDR  115



>ref|XP_008463430.1| PREDICTED: uncharacterized protein LOC103501594 [Cucumis melo]
Length=107

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  172  PEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            PE+KRR+RVA Y +YA+EGK KSS++  F+WIKTK
Sbjct  65   PEMKRRQRVAKYKLYAVEGKVKSSIKKGFRWIKTK  99



>gb|KDP28226.1| hypothetical protein JCGZ_13997 [Jatropha curcas]
Length=104

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  133  KSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIK---TKFTHTY  291
            ++ + ++P G  +PE KR+KR+A Y +Y +EGK K+SL+N  +WIK   +K  H Y
Sbjct  49   QTRTTSTPWGFSDPETKRKKRIAKYKVYTVEGKVKTSLKNGLRWIKNKCSKIIHGY  104



>ref|XP_006480043.1| PREDICTED: uncharacterized protein LOC102625735 [Citrus sinensis]
 gb|KDO87070.1| hypothetical protein CISIN_1g045042mg [Citrus sinensis]
Length=111

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  154  PAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            P G  +PE+KRRKR+A Y +Y +EGK K+SLR   +WIK K +   +
Sbjct  63   PWGFTDPEMKRRKRIAKYKVYTVEGKVKASLRKGLRWIKNKCSQIVH  109



>ref|XP_006474426.1| PREDICTED: uncharacterized protein LOC102623546 [Citrus sinensis]
Length=136

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +R+KRVA Y MY++EGK K S R S +W+K ++TH  Y
Sbjct  91   ADPEFQRKKRVASYKMYSVEGKVKGSFRKSVRWLKDRYTHMLY  133



>ref|XP_004501457.1| PREDICTED: uncharacterized protein LOC101508769 [Cicer arietinum]
Length=112

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHT  288
             +PE++R+KRVA Y MY++EG+ K S R SF+W+K K++  
Sbjct  68   ADPELQRKKRVASYKMYSVEGRVKGSFRKSFRWLKNKYSQV  108



>ref|XP_009615642.1| PREDICTED: uncharacterized protein LOC104108337 [Nicotiana tomentosiformis]
Length=107

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            N E KRRKRVA Y  Y +EGK K S+R+SF+WIK K++
Sbjct  64   NSEAKRRKRVASYKSYTIEGKLKDSIRDSFRWIKNKYS  101



>ref|NP_001049870.1| Os03g0302500 [Oryza sativa Japonica Group]
 gb|ABF95498.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11784.1| Os03g0302500 [Oryza sativa Japonica Group]
 dbj|BAG97671.1| unnamed protein product [Oryza sativa Japonica Group]
Length=120

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            +PE+KRR+RVA Y  Y++EGK KSSLR  F+WIK K
Sbjct  78   DPEMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAK  113



>emb|CDX72939.1| BnaC06g33870D [Brassica napus]
Length=466

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G C  E++R+KRVAGYN+Y +EGK K S++ SFKW K   ++  Y
Sbjct  419  GLCEAEIQRKKRVAGYNVYGVEGKVKGSMKKSFKWFKETCSNAVY  463



>ref|XP_010555044.1| PREDICTED: uncharacterized protein LOC104824634 [Tarenaya hassleriana]
Length=103

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  127  RTKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKF  279
            + KSYS +   G  +PE++R+KRVA Y MY++EGK K   R SF W+K + 
Sbjct  53   KGKSYSGSKSWGLSDPEIQRKKRVASYKMYSVEGKVKGPFRKSFPWLKQRL  103



>ref|XP_002514131.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48085.1| conserved hypothetical protein [Ricinus communis]
Length=124

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R+KRVA Y +Y +EGK K S + SF+W+K ++T   +
Sbjct  73   SKSWSFN------DPELQRKKRVASYKVYTVEGKVKGSFKKSFRWLKDRYTRVVH  121



>ref|XP_008806936.1| PREDICTED: uncharacterized protein LOC103719460 [Phoenix dactylifera]
Length=122

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  124  GRTKSYSFNSPAGDC--NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            G+ K+ S +S  G    +PE +R+KRVA Y +YA+EG+ K SLR SF+W+K ++T
Sbjct  61   GKGKAASGSSKKGWVFSDPEFQRKKRVASYKLYAVEGRVKGSLRRSFRWLKDRYT  115



>ref|XP_009768396.1| PREDICTED: uncharacterized protein LOC104219405 [Nicotiana sylvestris]
Length=114

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            N E KR+KRVA Y  Y +EGK KSS+R+SF+WIK K++
Sbjct  71   NSEAKRKKRVASYKSYTIEGKLKSSIRDSFRWIKNKYS  108



>ref|XP_011079982.1| PREDICTED: uncharacterized protein LOC105163364 [Sesamum indicum]
Length=110

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVAGY  YA+EG+ K S R SF+WIK    H  +
Sbjct  65   VDPELQRKKRVAGYKAYAVEGRMKGSFRKSFRWIKDTCNHLVH  107



>ref|XP_011100119.1| PREDICTED: uncharacterized protein LOC105178320 [Sesamum indicum]
Length=122

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SF       +PE +R+KRVA Y +Y++EGK K + R SF+W+K ++T   Y
Sbjct  71   SKSWSF------TDPEFQRKKRVASYKVYSVEGKVKGTFRKSFRWLKDRYTQVVY  119



>ref|XP_009790773.1| PREDICTED: uncharacterized protein LOC104238174 [Nicotiana sylvestris]
Length=115

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+S N      +PE +R++RVA Y +Y++EGK K SLR SF+W K K T   Y
Sbjct  64   SKSWSLN------DPEFQRKRRVASYKVYSVEGKVKGSLRRSFRWFKDKCTQVVY  112



>ref|XP_010648337.1| PREDICTED: uncharacterized protein LOC104878982 [Vitis vinifera]
Length=115

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS++F       +PE +R+KRVA Y  Y++EGK K SLRNSF+W+K ++    Y
Sbjct  64   SKSWTF------SDPEFQRKKRVASYKAYSVEGKVKGSLRNSFRWLKARYHRIVY  112



>ref|NP_001235468.1| uncharacterized protein LOC100500259 [Glycine max]
 gb|ACU15281.1| unknown [Glycine max]
 gb|KHN37048.1| hypothetical protein glysoja_009076 [Glycine soja]
Length=129

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R SF+W+K ++    Y
Sbjct  84   TDPEIQRKKRVASYKMYSVEGKVKGSFRKSFRWVKDRYCQVVY  126



>emb|CDY68148.1| BnaA07g38930D [Brassica napus]
Length=739

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G C  E++R+KRVAGYN+Y +EGK K S++ SFKW K   ++  Y
Sbjct  692  GLCEAEIQRKKRVAGYNVYGVEGKVKGSMKKSFKWFKETCSNAVY  736



>ref|XP_008347501.1| PREDICTED: uncharacterized protein LOC103410594 [Malus domestica]
Length=128

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVA Y MY++EGK K S R S +W+K K+T   Y
Sbjct  83   ADPELQRKKRVASYKMYSVEGKMKGSFRKSCRWLKDKYTQVLY  125



>ref|XP_006390627.1| hypothetical protein EUTSA_v10019700mg [Eutrema salsugineum]
 gb|ESQ27913.1| hypothetical protein EUTSA_v10019700mg [Eutrema salsugineum]
Length=129

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  160  GDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            G C  E++R+KRVA YN+Y +EG+ K S+R SFKW K   ++  Y
Sbjct  82   GLCEAEIQRKKRVAAYNVYGVEGRVKGSMRKSFKWFKETCSNAVY  126



>ref|XP_008795587.1| PREDICTED: uncharacterized protein LOC103711279 [Phoenix dactylifera]
Length=199

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            +PE+KRR+RVA Y MY++EGK K S+R SF+WIK K
Sbjct  157  DPEMKRRRRVASYKMYSVEGKVKQSIRKSFRWIKGK  192



>ref|XP_009604760.1| PREDICTED: uncharacterized protein LOC104099460 [Nicotiana tomentosiformis]
Length=118

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+S N      +PE +R++RVA Y +Y++EGK K SLR SF+W K K T   Y
Sbjct  67   SKSWSLN------DPEFQRKRRVASYKVYSVEGKVKGSLRRSFRWFKDKCTQVVY  115



>ref|XP_006444450.1| hypothetical protein CICLE_v10022952mg [Citrus clementina]
 gb|ESR57690.1| hypothetical protein CICLE_v10022952mg [Citrus clementina]
Length=111

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  154  PAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            P G  +PE+KRRKR+A Y +Y +EGK K+SLR   +WIK K
Sbjct  63   PWGFTDPEMKRRKRIAKYKVYTVEGKVKASLRKGLRWIKNK  103



>ref|XP_004144117.1| PREDICTED: uncharacterized protein LOC101207995 [Cucumis sativus]
 ref|XP_004158469.1| PREDICTED: uncharacterized LOC101207995 [Cucumis sativus]
 gb|KGN66259.1| hypothetical protein Csa_1G589660 [Cucumis sativus]
Length=123

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +KS+SFN      +PE++R++RVA Y +Y++EGK K SLR SF+W+K + +   +
Sbjct  73   SKSWSFN------DPEMQRKRRVASYKVYSVEGKVKGSLRKSFRWLKERCSRVVF  121



>ref|XP_004981181.1| PREDICTED: uncharacterized protein LOC101770664 [Setaria italica]
Length=71

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            +PE KRR+RVAGY  YA+E + K+SLR  F+WIK + T
Sbjct  28   DPEAKRRRRVAGYKAYAVEARVKASLRKGFRWIKDRCT  65



>ref|XP_009349378.1| PREDICTED: uncharacterized protein LOC103940922 [Pyrus x bretschneideri]
Length=127

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            TKS+S +      +PE++R+KRVA Y +Y +EGK K SLR SF+W+K       Y
Sbjct  77   TKSWSLS------DPELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCNRVVY  125



>gb|KDO71833.1| hypothetical protein CISIN_1g039223mg [Citrus sinensis]
Length=122

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKF  279
            +PEVKR++RV  Y  YA+EGK K+S+RNS +W+K K+
Sbjct  79   DPEVKRQRRVVKYKAYAVEGKMKASIRNSLRWVKNKY  115



>ref|XP_010240664.1| PREDICTED: uncharacterized protein LOC100827619 [Brachypodium 
distachyon]
Length=78

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  157  AGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDS  300
            AGD  PE KRR+RVA Y  YA+E + K+SLR  F+WIK + T   + S
Sbjct  33   AGD--PEAKRRRRVAAYKAYAVEARVKASLRRGFRWIKDRCTGIVHRS  78



>ref|XP_003569228.1| PREDICTED: uncharacterized protein LOC100838787 [Brachypodium 
distachyon]
Length=121

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYYDSS  303
            +P+++R++RVA Y  YA+EGK K S R SF+W+K ++ H  Y  S
Sbjct  77   DPDMERKRRVAAYKAYAVEGKVKGSFRKSFRWVKDRYLHLVYGWS  121



>gb|AFK46816.1| unknown [Medicago truncatula]
Length=123

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTK  276
            +PE++R+KRVA Y +Y++EGK K SLR SFKWIK +
Sbjct  80   DPELQRKKRVASYKVYSVEGKLKGSLRKSFKWIKDR  115



>ref|XP_008337723.1| PREDICTED: uncharacterized protein LOC103400824 [Malus domestica]
 ref|XP_008352373.1| PREDICTED: uncharacterized protein LOC103415871 [Malus domestica]
Length=128

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 6/55 (11%)
 Frame = +1

Query  130  TKSYSFNSPAGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            TKS+S +      +PE++R+KRVA Y +Y +EGK K SLR SF+W+K       Y
Sbjct  78   TKSWSLS------DPELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCNRVVY  126



>ref|XP_009395779.1| PREDICTED: uncharacterized protein LOC103980958 [Musa acuminata 
subsp. malaccensis]
Length=109

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            +P+ +RRKRVA Y  YA+EG+ K S+R  F+W+K K+T   Y
Sbjct  65   DPDFQRRKRVASYKAYAVEGRVKGSVRRGFRWLKDKYTQIVY  106



>ref|XP_009393998.1| PREDICTED: uncharacterized protein LOC103979549 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 2/46 (4%)
 Frame = +1

Query  157  AGDCNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
            AGD  PE +RR+RVAGYN YA E K ++SLRN  +W K + +   Y
Sbjct  59   AGD--PETRRRRRVAGYNAYAAESKVRASLRNGLRWFKARCSALVY  102



>ref|XP_006650843.1| PREDICTED: uncharacterized protein LOC102721534 [Oryza brachyantha]
Length=76

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTY  291
            +PE KRR+RVA Y  YA+E + K+SLR  F+WIK +    +
Sbjct  36   DPEAKRRRRVAAYKAYAVEARVKASLRRGFRWIKDRLVRRW  76



>ref|XP_001772172.1| predicted protein [Physcomitrella patens]
 gb|EDQ62985.1| predicted protein [Physcomitrella patens]
Length=63

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE +RRKRVA Y +  MEGK K ++R+SF+W+K K+    Y
Sbjct  18   ADPEAQRRKRVAKYKIITMEGKAKQTVRSSFRWLKAKYIAVRY  60



>dbj|BAJ86995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  NPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFT  282
            +PEVKRR+RVA Y  Y++EGK K+S R  F+WIK K T
Sbjct  73   DPEVKRRRRVASYKAYSVEGKVKASFRRGFRWIKDKCT  110



>ref|XP_004305730.1| PREDICTED: uncharacterized protein LOC101302578 [Fragaria vesca 
subsp. vesca]
Length=141

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  CNPEVKRRKRVAGYNMYAMEGKFKSSLRNSFKWIKTKFTHTYY  294
             +PE++R+KRVAGY +Y+ E K K S + SFKWIK+ +T   Y
Sbjct  96   ADPELQRKKRVAGYKVYSAEEKMKGSFKKSFKWIKSTYTQVVY  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250