BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006G04 569 bp,:Filtered

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774366.1|  PREDICTED: putative DNA-binding protein ESCA...  82.8    1e-15   Nicotiana sylvestris
ref|XP_009601583.1|  PREDICTED: putative DNA-binding protein ESCA...  81.6    4e-15   Nicotiana tomentosiformis
ref|XP_011070240.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    2e-13   Sesamum indicum [beniseed]
gb|EYU44096.1|  hypothetical protein MIMGU_mgv1a014599mg              74.7    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_002281340.1|  PREDICTED: putative DNA-binding protein ESCA...  76.3    3e-13   Vitis vinifera
emb|CAN74881.1|  hypothetical protein VITISV_001409                   75.5    4e-13   Vitis vinifera
ref|XP_009783446.1|  PREDICTED: uncharacterized protein LOC104232053  74.7    2e-12   Nicotiana sylvestris
ref|XP_011082370.1|  PREDICTED: uncharacterized protein LOC105165162  73.6    4e-12   Sesamum indicum [beniseed]
ref|XP_010677253.1|  PREDICTED: uncharacterized protein LOC104892928  69.7    1e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDP13005.1|  unnamed protein product                              67.4    3e-10   Coffea canephora [robusta coffee]
ref|XP_008353577.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    7e-09   
ref|XP_002519830.1|  DNA binding protein, putative                    62.8    2e-08   Ricinus communis
ref|XP_004148734.1|  PREDICTED: uncharacterized protein LOC101204243  62.4    2e-08   Cucumis sativus [cucumbers]
ref|XP_008448696.1|  PREDICTED: uncharacterized protein LOC103490790  62.4    2e-08   Cucumis melo [Oriental melon]
ref|XP_009377075.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_009347386.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_006368415.1|  hypothetical protein POPTR_0001s02600g           59.7    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011018587.1|  PREDICTED: putative DNA-binding protein ESCA...  59.3    2e-07   Populus euphratica
ref|XP_010325554.1|  PREDICTED: LOW QUALITY PROTEIN: neurogenic p...  59.3    3e-07   Solanum lycopersicum
ref|XP_008373567.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    5e-07   Malus domestica [apple tree]
ref|XP_010104314.1|  Putative DNA-binding protein ESCAROLA            57.8    7e-07   Morus notabilis
ref|XP_011028193.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    4e-06   Populus euphratica
ref|XP_009616006.1|  PREDICTED: uncharacterized protein LOC104108630  55.5    4e-06   Nicotiana tomentosiformis
ref|XP_007209253.1|  hypothetical protein PRUPE_ppa007231mg           54.7    7e-06   Prunus persica
gb|KJB51653.1|  hypothetical protein B456_008G227100                  53.1    2e-05   Gossypium raimondii
ref|XP_004301686.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    5e-05   Fragaria vesca subsp. vesca
ref|XP_006436724.1|  hypothetical protein CICLE_v10031852mg           52.4    5e-05   Citrus clementina
ref|XP_006385642.1|  DNA-binding family protein                       52.4    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008238260.1|  PREDICTED: histone acetyltransferase KAT6A-like  52.0    6e-05   Prunus mume [ume]
ref|XP_010055329.1|  PREDICTED: hormone receptor 4                    51.6    8e-05   Eucalyptus grandis [rose gum]
gb|KHF99586.1|  Putative DNA-binding ESCAROLA -like protein           48.9    7e-04   Gossypium arboreum [tree cotton]
gb|KDP24418.1|  hypothetical protein JCGZ_26547                       48.9    8e-04   Jatropha curcas



>ref|XP_009774366.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=362

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 5/101 (5%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AA+ VQ+IVGSFIA+GKKPK K PSSTP P   SNMLNF A    A+ PS+DASS SS
Sbjct  264  LTAATPVQVIVGSFIAEGKKPKSKTPSSTPPP---SNMLNFGAPHLGASLPSQDASSDSS  320

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
            D+NGG +PL+     YGNA QP+  M MYANMGWPN+++KM
Sbjct  321  DENGG-SPLSHEQGPYGNAGQPLHGMPMYANMGWPNNSMKM  360



>ref|XP_009601583.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=370

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 5/101 (5%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AA+ VQ+IVGSFIA+GKKPK K PSSTP     SNMLNF A   EA+ PS+DASS SS
Sbjct  272  LTAATPVQVIVGSFIAEGKKPKSKTPSSTP---PLSNMLNFGAPHLEASLPSQDASSNSS  328

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
            D+NGG +PL+     YGNA QP+  M MYANMGWPN+++K+
Sbjct  329  DENGG-SPLSHEQGPYGNAGQPLHGMPMYANMGWPNNSMKL  368



>ref|XP_011070240.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=400

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaasp--sedassas  213
            LKAAS VQ++VGSF A+GKK K  PS++P     SNMLNF        +   S  ASS S
Sbjct  302  LKAASPVQVVVGSFTAEGKKSKNAPSASP-----SNMLNFGGSVTGTGAGPPSPGASSES  356

Query  214  sddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
            +++N G +PL+ G   Y NA QP+  MQMY+NMGWPNS +KM
Sbjct  357  AEENDGTSPLDHGSGPYTNAGQPMQNMQMYSNMGWPNS-IKM  397



>gb|EYU44096.1| hypothetical protein MIMGU_mgv1a014599mg [Erythranthe guttata]
Length=184

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 66/98 (67%), Gaps = 8/98 (8%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  219
            LKAAS VQ++VGSFIADGKKPK  P+STP     SNMLNF    A  ASP   ASS S++
Sbjct  85   LKAASPVQVVVGSFIADGKKPKAGPTSTP----PSNMLNF-GAPAPQASPPPGASSESAE  139

Query  220  dNGGGTPLNR---GPPTYGNANQPVPTMQMYANMGWPN  324
            +N  G+PL R   GP +     QPV ++ MYANMGWPN
Sbjct  140  ENDDGSPLERDSSGPYSTNAGQQPVQSIPMYANMGWPN  177



>ref|XP_002281340.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CBI33917.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPS-STPLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AA+ VQ++VGSFIADGKK     S S+  P AQ  MLNF A    A+     +S +S 
Sbjct  254  LTAATPVQVVVGSFIADGKKTNTNQSGSSSAPPAQ--MLNFGAPVVPASPSQGGSSESSD  311

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
            ++  GG+PLNRGP  Y N +QP+  M MYA MGWPNST+KM
Sbjct  312  EN--GGSPLNRGPLPYNNVSQPIHQMPMYAAMGWPNSTMKM  350



>emb|CAN74881.1| hypothetical protein VITISV_001409 [Vitis vinifera]
Length=313

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 64/101 (63%), Gaps = 5/101 (5%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPS-STPLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AA+ VQ++VGSFIADGKK     S S+  P AQ  MLNF A    A+     +S +S 
Sbjct  214  LTAATPVQVVVGSFIADGKKTNTNQSGSSSAPPAQ--MLNFGAPVVPASPSQGGSSESSD  271

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
                GG+PLNRGP  Y N +QP+  M MYA MGWPNST+KM
Sbjct  272  --ENGGSPLNRGPLPYNNVSQPIHQMPMYAAMGWPNSTMKM  310



>ref|XP_009783446.1| PREDICTED: uncharacterized protein LOC104232053 [Nicotiana sylvestris]
Length=432

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AA+ VQ+IVGSFIA+GKKPK K PSSTP     SNMLNF A   EA+ PS+ ASS SS
Sbjct  340  LMAATPVQVIVGSFIAEGKKPKSKAPSSTP----PSNMLNFGAPVTEASPPSQGASSDSS  395

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNS  327
            D+NG  +P +  P  +GNA QP+  M M+ANMGWP S
Sbjct  396  DENGN-SPFHHEPGPFGNAGQPMHGMSMFANMGWPKS  431



>ref|XP_011082370.1| PREDICTED: uncharacterized protein LOC105165162 [Sesamum indicum]
Length=386

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  219
            LKAAS VQ++VGSFIADGKK K   SSTP     SNMLNF A    A+     +S +  D
Sbjct  291  LKAASPVQVVVGSFIADGKKSKSGTSSTP----PSNMLNFGAPMTGASPSPGASSESGED  346

Query  220  dNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
            ++   +PLNRG   YGNA QP   M MY+ MGW NS +KM
Sbjct  347  NDD--SPLNRGSGPYGNAGQPGQNMPMYSTMGWANS-IKM  383



>ref|XP_010677253.1| PREDICTED: uncharacterized protein LOC104892928 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 6/101 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaasps-edassass  216
            L AA+ VQ+IVGSFIA+GKK KY PS   +PQ  S++L+F+A    AA  S     S+  
Sbjct  343  LMAATPVQIIVGSFIANGKKTKYMPS---VPQ--SHVLSFAAPPLPAADRSPSQEVSSEG  397

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  339
             +  G   ++R   +YGN+N PV  MQMY  MGWPNS  KM
Sbjct  398  SEENGSNHIDRTMGSYGNSNHPVHNMQMYTTMGWPNSASKM  438



>emb|CDP13005.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 66/101 (65%), Gaps = 8/101 (8%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  219
            L AA+ VQ++VGSFIADGKKPK   +  P P     ML+F      A+ PS+ ASS SSD
Sbjct  227  LMAATPVQVVVGSFIADGKKPKGS-TVAPAP----GMLSFGNPVIGASPPSQGASSDSSD  281

Query  220  dNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKMH  342
            DNG  +PLNR    Y NA Q +  + MY NMGWPNSTVKMH
Sbjct  282  DNG--SPLNRSSGPYNNA-QTIQNIPMYTNMGWPNSTVKMH  319



>ref|XP_008353577.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=181

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  213
            L AAS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ 
Sbjct  82   LMAASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSE  140

Query  214  sddNGGGTPLN---RGPPTYGNANQPVPTMQMY  303
            S D  G +PLN   RGP  Y NANQP+  MQMY
Sbjct  141  SSDENGSSPLNNSNRGPVLYSNANQPIHNMQMY  173



>ref|XP_002519830.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF42434.1| DNA binding protein, putative [Ricinus communis]
Length=376

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKP-----KYKPSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSFIADGKK      K  PSS P  Q    MLNF A    ++ PS+  S
Sbjct  279  LMAASPVQVIVGSFIADGKKSNSNIHKSGPSSAPTSQ----MLNFGAPMTTSSPPSQGVS  334

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  318
            S SSD+NG  +PLNR PP Y NA QP+  M MY  + W
Sbjct  335  SESSDENGS-SPLNRDPPIYSNATQPLHNMNMYHQL-W  370



>ref|XP_004148734.1| PREDICTED: uncharacterized protein LOC101204243 [Cucumis sativus]
 ref|XP_004163876.1| PREDICTED: uncharacterized LOC101204243 [Cucumis sativus]
 gb|KGN55770.1| hypothetical protein Csa_3G011720 [Cucumis sativus]
Length=362

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKK-----PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSF+ DGKK      K  PSST       NMLNF    A        ++
Sbjct  268  LTAASTVQVIVGSFLVDGKKLGASIQKSGPSST-----SPNMLNFGTPVAAGCPSEGASN  322

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  318
            ++S   + GG+PL+RGP  Y NANQP+  MQMY  + W
Sbjct  323  NSSD--DNGGSPLSRGPGMYTNANQPIHNMQMYQQL-W  357



>ref|XP_008448696.1| PREDICTED: uncharacterized protein LOC103490790 [Cucumis melo]
Length=362

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKK-----PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSF+ DGKK      K  PSST       NMLNF    A        ++
Sbjct  268  LTAASTVQVIVGSFLVDGKKLGASIQKSGPSST-----SPNMLNFGTPVAAGCPSEGASN  322

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  318
            ++S   + GG+PL+RGP  Y NANQP+  MQMY  + W
Sbjct  323  NSSD--DNGGSPLSRGPGMYTNANQPIHNMQMYQQL-W  357



>ref|XP_009377075.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=374

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  213
            L AAS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ 
Sbjct  275  LVAASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSE  333

Query  214  sddNGGGTPLN---RGPPTYGNANQPVPTMQMY  303
            S D  G +PLN   RGP  Y NANQP+  MQMY
Sbjct  334  SSDENGSSPLNNSNRGPVLYSNANQPIHNMQMY  366



>ref|XP_009347386.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=377

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  213
            L AAS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ 
Sbjct  278  LVAASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSE  336

Query  214  sddNGGGTPLN---RGPPTYGNANQPVPTMQMY  303
            S D  G +PLN   RGP  Y NANQP+  MQMY
Sbjct  337  SSDENGSSPLNNSNRGPVLYSNANQPIHNMQMY  369



>ref|XP_006368415.1| hypothetical protein POPTR_0001s02600g [Populus trichocarpa]
 gb|ERP64984.1| hypothetical protein POPTR_0001s02600g [Populus trichocarpa]
Length=377

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 10/93 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK-----PSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+I+GSFIADGKK   K     PSSTP PQ    MLNF A    A+ PS   S
Sbjct  281  LTAASAVQVILGSFIADGKKSNSKSLKSGPSSTPPPQ----MLNFGAPLTTASPPSRGGS  336

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            S SSD+NGG +P+NR P  YGN +QP+  MQMY
Sbjct  337  SESSDENGG-SPVNRTPGIYGNPSQPIHNMQMY  368



>ref|XP_011018587.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=381

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 10/93 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK-----PSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+I+GSFIADGKK K K     PSSTP PQ    MLNF A     + PS   S
Sbjct  285  LTAASAVQVILGSFIADGKKSKSKALKSGPSSTPPPQ----MLNFGAPLTTVSPPSRGGS  340

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            S SSD+NGG +P+NR P  YGN +QP+  MQMY
Sbjct  341  SESSDENGG-SPVNRTPGIYGNPSQPIHNMQMY  372



>ref|XP_010325554.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic protein mastermind 
[Solanum lycopersicum]
Length=418

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = +1

Query  1    ADgkvvgggvagTLKAASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaae  177
            ADG+V+GGGV+G L AA+ VQ+IVGSF+A+GKKPK K PSSTP     SNMLNF A A  
Sbjct  303  ADGRVMGGGVSGVLMAATPVQVIVGSFLAEGKKPKSKVPSSTP----PSNMLNFGAPATG  358

Query  178  aaspsedassassddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  318
             + PS+  +S+ S +  G +P       YGNA QP+  M MY  + W
Sbjct  359  ESPPSQGDASSDSSEENGDSPFQHESGPYGNAGQPMHGMSMYXQI-W  404



>ref|XP_008373567.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=376

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYK--PSSTPLPQAQSNMLNFsaqaaeaaspsedassas  213
            L AAS VQ+IVGSFIADGKK       S T  P A S MLNF A    A+  S+   S+ 
Sbjct  277  LMAASPVQVIVGSFIADGKKSNSNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSE  335

Query  214  sddNGGGTPLN---RGPPTYGNANQPVPTMQMY  303
            S D  G +PLN   RGP  Y NANQP+  MQMY
Sbjct  336  SSDENGSSPLNNSNRGPVLYSNANQPIHNMQMY  368



>ref|XP_010104314.1| Putative DNA-binding protein ESCAROLA [Morus notabilis]
 gb|EXB99734.1| Putative DNA-binding protein ESCAROLA [Morus notabilis]
Length=391

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQA-QSNMLNFsaqaaeaaspsedassass  216
            L AAS VQ+IVGSFI DG K     +    P A Q  MLNF    A   SPS   SS SS
Sbjct  295  LMAASPVQVIVGSFIVDGNKSNTNSAVKSAPAAPQPQMLNFGGPMAGGDSPSHGDSSESS  354

Query  217  ddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNST  330
            ++NG G  LNRGP  Y NA+QP+  MQMY ++ W N T
Sbjct  355  EENGNGH-LNRGPGFY-NASQPIHNMQMYHHL-WGNQT  389



>ref|XP_011028193.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=375

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 59/93 (63%), Gaps = 10/93 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSS-----TPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSFIADGKK     S      TP PQ    MLNFSA    A+  S+  S
Sbjct  279  LTAASPVQVIVGSFIADGKKSNSSASKSGPSSTPPPQ----MLNFSAPLTTASPTSQGGS  334

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            S SSD+NGG +P+NR P  YGN NQP+  MQMY
Sbjct  335  SDSSDENGG-SPVNRNPGIYGNPNQPIHNMQMY  366



>ref|XP_009616006.1| PREDICTED: uncharacterized protein LOC104108630 [Nicotiana tomentosiformis]
Length=366

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  219
            L AA+ VQ++VGSFIA+GKKPK K    P P   SNMLNF A   EA+SPS+ ASS SSD
Sbjct  278  LMAATPVQVVVGSFIAEGKKPKSK---APSPTPTSNMLNFGAPVTEASSPSQGASSDSSD  334

Query  220  dNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            +N GG+PL+     +GNA QP+  M  Y
Sbjct  335  EN-GGSPLSHEQGPFGNAAQPMHGMPTY  361



>ref|XP_007209253.1| hypothetical protein PRUPE_ppa007231mg [Prunus persica]
 gb|EMJ10452.1| hypothetical protein PRUPE_ppa007231mg [Prunus persica]
Length=377

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPK---YKPSSTPLPQAQSNMLNFsaqaaeaaspsedassa  210
            L AAS VQ+IVGSFIADGKK      K   +  P +Q  MLNF A    A+  S+ ASS 
Sbjct  282  LVAASPVQVIVGSFIADGKKSNSNFLKSGPSSPPPSQ--MLNFGAPMTAASPSSQGASSE  339

Query  211  ssddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            SSD+NG  +PLNRGP  Y NA+QP+  MQMY
Sbjct  340  SSDENGS-SPLNRGPVLYNNASQPIHNMQMY  369



>gb|KJB51653.1| hypothetical protein B456_008G227100 [Gossypium raimondii]
Length=391

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSST-PLPQAQSNMLNFsaqaaeaaspsedassass  216
            L AAS VQ+IVGSFIADGKK     S T P     S+MLNF A     + PS+  SS SS
Sbjct  293  LHAASPVQVIVGSFIADGKKQSQDVSKTGPSSMLTSSMLNFGAPGLTGSPPSQGGSSESS  352

Query  217  ddNGGGTPLNRGPPTYGNANQPVP--TMQMY  303
            D+N GG+PLNRG   YGN+   +    MQMY
Sbjct  353  DEN-GGSPLNRGSGFYGNSAPSIHNNNMQMY  382



>ref|XP_004301686.1| PREDICTED: putative DNA-binding protein ESCAROLA [Fragaria vesca 
subsp. vesca]
Length=383

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKY----KPSSTPLPQAQSNMLNFsaqaaeaaspsedass  207
            L AA  VQ+IVGSFIA+GKK         +S+P P   S MLNF A    A+  S+   S
Sbjct  285  LVAAGPVQVIVGSFIAEGKKSSSNLLKSGTSSPPP---SQMLNFGAPMTAASPSSQGGGS  341

Query  208  assddNGGGTPLNRGPPT-YGNANQPVPTMQMY  303
              S D  G +PLNR PP  Y N +QP+  MQMY
Sbjct  342  TESSDENGSSPLNRAPPVLYSNPSQPMHNMQMY  374



>ref|XP_006436724.1| hypothetical protein CICLE_v10031852mg [Citrus clementina]
 ref|XP_006485573.1| PREDICTED: uncharacterized protein LOC102612198 [Citrus sinensis]
 gb|ESR49964.1| hypothetical protein CICLE_v10031852mg [Citrus clementina]
 gb|KDO51114.1| hypothetical protein CISIN_1g017146mg [Citrus sinensis]
Length=376

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKP-----KYKPSSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSFIA+GKK      K  PSS P P     ML+F A    ++ PS+ AS
Sbjct  279  LMAASPVQVIVGSFIAEGKKSNSNFLKSGPSSAPTPH----MLSFGAPMTTSSPPSQGAS  334

Query  205  sassddNGGGTPLNRGPPTYGN-ANQPVPTMQMY  303
            S SSDDN G +PLNRG   Y N A QP+  M MY
Sbjct  335  SESSDDN-GSSPLNRGAGLYNNAAQQPIHNMHMY  367



>ref|XP_006385642.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP63439.1| DNA-binding family protein [Populus trichocarpa]
Length=375

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 59/93 (63%), Gaps = 10/93 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSS-----TPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSFIADGKK     S      TP PQ    MLNFSA    A+ PS+  S
Sbjct  279  LTAASPVQVIVGSFIADGKKSNSSASKSGPSSTPPPQ----MLNFSAPLTTASPPSQGGS  334

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            S SSD+NGG +P+NR P  YGN NQ +  MQMY
Sbjct  335  SDSSDENGG-SPVNRNPGIYGNPNQSIHNMQMY  366



>ref|XP_008238260.1| PREDICTED: histone acetyltransferase KAT6A-like [Prunus mume]
Length=377

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPK---YKPSSTPLPQAQSNMLNFsaqaaeaaspsedassa  210
            L AAS VQ+IVGSFIADGKK      K   +  P +Q  MLNF A    A+  S+ ASS 
Sbjct  282  LVAASPVQVIVGSFIADGKKSNSNFLKSGPSSPPPSQ--MLNFGAPMTAASPSSQGASSE  339

Query  211  ssddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            SSD+NG  +PLNRGP  Y N +QP+  MQMY
Sbjct  340  SSDENGS-SPLNRGPVLYNNPSQPIHNMQMY  369



>ref|XP_010055329.1| PREDICTED: hormone receptor 4 [Eucalyptus grandis]
 gb|KCW71797.1| hypothetical protein EUGRSUZ_E00286 [Eucalyptus grandis]
Length=419

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPK---YKPSSTPLPQA-QSNMLNFsaqaaeaaspsedass  207
            L AA+ VQ+IVGSF+A+ KK      K  ++P PQ  QS+MLNF       + PS+ AS+
Sbjct  318  LIAATPVQVIVGSFLANSKKASSSALKSDASPTPQGPQSHMLNFGTAGTAVSPPSDGASA  377

Query  208  assddNGGGTPLNRGPP-TYGNANQPVPTMQMYANMGWPNST  330
             SSD+N G +P+N  P   Y N +QP+  MQMY ++ W   T
Sbjct  378  DSSDEN-GNSPINHRPTGIYNNTSQPIHNMQMYHHL-WAGQT  417



>gb|KHF99586.1| Putative DNA-binding ESCAROLA -like protein [Gossypium arboreum]
Length=391

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKPSST-PLPQAQSNMLNFsaqaaeaaspsedassass  216
            L+AAS VQ+IVGSFIADGKK     S T P      +MLNF A     + PS+  SS SS
Sbjct  293  LRAASPVQVIVGSFIADGKKQSQDVSKTGPSSMLTPSMLNFGAPGMTGSPPSKGGSSESS  352

Query  217  ddNGGGTPLNRGPPTYGNANQPVP--TMQMY  303
            D+N GG+PLNR    YGN+   +    MQMY
Sbjct  353  DEN-GGSPLNRESGFYGNSAPSIHNNNMQMY  382



>gb|KDP24418.1| hypothetical protein JCGZ_26547 [Jatropha curcas]
Length=371

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 57/93 (61%), Gaps = 10/93 (11%)
 Frame = +1

Query  40   LKAASQVQLIVGSFIADGKKPKYKP-----SSTPLPQAQSNMLNFsaqaaeaaspsedas  204
            L AAS VQ+IVGSFIADGKK          SS  LPQ    MLNF A    ++ PS+ AS
Sbjct  275  LLAASPVQVIVGSFIADGKKSSSNISKSGTSSGTLPQ----MLNFGAPLTTSSPPSQGAS  330

Query  205  sassddNGGGTPLNRGPPTYGNANQPVPTMQMY  303
            S SSD+N G +PLNR P  Y NANQ +  M +Y
Sbjct  331  SESSDEN-GSSPLNRDPTIYSNANQSIHNMPVY  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490