BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006F12 638 bp,

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              268   8e-88   Solanum lycopersicum
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    268   9e-88   Solanum tuberosum [potatoes]
gb|ABB29925.1|  unknown                                                 267   2e-87   Solanum tuberosum [potatoes]
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         266   5e-87   Solanum tuberosum [potatoes]
ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              266   5e-87   Nicotiana sylvestris
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         266   7e-87   Solanum lycopersicum
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    266   8e-87   Solanum tuberosum [potatoes]
emb|CDP06299.1|  unnamed protein product                                265   9e-87   Coffea canephora [robusta coffee]
gb|ADE42972.1|  putative 60S ribosomal protein L18a                     265   1e-86   Gardenia jasminoides
ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              265   2e-86   Nicotiana tomentosiformis
ref|NP_001275252.1|  uncharacterized protein LOC102577837               265   2e-86   Solanum tuberosum [potatoes]
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              264   3e-86   Sesamum indicum [beniseed]
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         264   3e-86   Nicotiana tomentosiformis
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         264   4e-86   Sesamum indicum [beniseed]
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a-like         263   6e-86   Cucumis sativus [cucumbers]
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         263   7e-86   Nicotiana sylvestris
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              263   7e-86   Cucumis melo [Oriental melon]
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              263   9e-86   Cucumis melo [Oriental melon]
ref|XP_004147412.1|  PREDICTED: 60S ribosomal protein L18a-like         263   9e-86   
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       263   1e-85   Populus trichocarpa [western balsam poplar]
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                263   1e-85   Erythranthe guttata [common monkey flower]
gb|KHG29727.1|  60S ribosomal L18a                                      262   2e-85   Gossypium arboreum [tree cotton]
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    263   2e-85   Citrus sinensis [Valencia orange]
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                262   2e-85   Erythranthe guttata [common monkey flower]
gb|KHG02356.1|  60S ribosomal L18a                                      261   3e-85   Gossypium arboreum [tree cotton]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              261   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    261   3e-85   Vitis vinifera
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             261   4e-85   Citrus clementina
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              261   4e-85   Phoenix dactylifera
gb|KJB57268.1|  hypothetical protein B456_009G155900                    261   4e-85   Gossypium raimondii
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              261   5e-85   Vitis vinifera
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         261   6e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              261   7e-85   Elaeis guineensis
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   261   7e-85   Citrus sinensis [Valencia orange]
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              260   8e-85   Vitis vinifera
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              260   8e-85   Phoenix dactylifera
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         260   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    260   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               259   2e-84   Ricinus communis
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             259   2e-84   Prunus persica
gb|ABK92715.1|  unknown                                                 259   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       259   2e-84   Sesamum indicum [beniseed]
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            259   2e-84   Populus euphratica
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       259   2e-84   Populus trichocarpa [western balsam poplar]
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       259   3e-84   Castanea sativa
gb|KJB10614.1|  hypothetical protein B456_001G211400                    259   3e-84   Gossypium raimondii
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         259   3e-84   Populus euphratica
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             259   3e-84   Citrus clementina
gb|KHG16522.1|  60S ribosomal L18a                                      259   3e-84   Gossypium arboreum [tree cotton]
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                259   3e-84   Erythranthe guttata [common monkey flower]
gb|KHG16962.1|  60S ribosomal L18a                                      259   4e-84   Gossypium arboreum [tree cotton]
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     259   4e-84   Eucalyptus grandis [rose gum]
gb|KHN38335.1|  60S ribosomal protein L18a                              258   5e-84   Glycine soja [wild soybean]
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         258   5e-84   Tarenaya hassleriana [spider flower]
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         258   5e-84   Phoenix dactylifera
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            258   5e-84   Phoenix dactylifera
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       258   6e-84   Populus trichocarpa [western balsam poplar]
gb|ABK94361.1|  unknown                                                 258   8e-84   Populus trichocarpa [western balsam poplar]
gb|ACS96446.1|  60S ribosomal protein L18a                              258   8e-84   Jatropha curcas
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          258   1e-83   Theobroma cacao [chocolate]
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     260   1e-83   Eucalyptus grandis [rose gum]
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             259   1e-83   Citrus clementina
gb|KHG27228.1|  60S ribosomal L18a                                      257   1e-83   Gossypium arboreum [tree cotton]
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     258   2e-83   Eucalyptus grandis [rose gum]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              257   2e-83   Tarenaya hassleriana [spider flower]
gb|KJB42782.1|  hypothetical protein B456_007G174800                    257   2e-83   Gossypium raimondii
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              257   2e-83   Eucalyptus grandis [rose gum]
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         257   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238728.1|  uncharacterized protein LOC100306174               256   2e-83   Glycine max [soybeans]
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    256   3e-83   Eucalyptus grandis [rose gum]
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              256   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         256   3e-83   Elaeis guineensis
ref|NP_001236918.1|  uncharacterized protein LOC100500108               255   7e-83   Glycine max [soybeans]
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          255   7e-83   Theobroma cacao [chocolate]
gb|KHG26670.1|  60S ribosomal L18a                                      255   8e-83   Gossypium arboreum [tree cotton]
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             255   8e-83   Phaseolus vulgaris [French bean]
gb|KJB69800.1|  hypothetical protein B456_011G042900                    255   8e-83   Gossypium raimondii
ref|XP_006841639.1|  hypothetical protein AMTR_s00003p00234980          255   9e-83   Amborella trichopoda
gb|AFK44558.1|  unknown                                                 255   9e-83   Lotus japonicus
ref|NP_001237679.1|  uncharacterized protein LOC100306365               255   9e-83   Glycine max [soybeans]
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            255   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             255   1e-82   Phaseolus vulgaris [French bean]
ref|NP_001237207.1|  uncharacterized protein LOC100527007               255   1e-82   Glycine max [soybeans]
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             255   1e-82   Eutrema salsugineum
gb|AFK40398.1|  unknown                                                 254   1e-82   Medicago truncatula
emb|CDX97587.1|  BnaA05g24920D                                          254   2e-82   Brassica napus [oilseed rape]
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         254   2e-82   Cicer arietinum [garbanzo]
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         254   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             254   3e-82   Phaseolus vulgaris [French bean]
gb|AFK46978.1|  unknown                                                 253   1e-81   Lotus japonicus
emb|CDX75778.1|  BnaC03g38610D                                          255   1e-81   Brassica napus [oilseed rape]
ref|NP_001056335.1|  Os05g0565000                                       252   2e-81   
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         252   2e-81   Oryza brachyantha
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    252   2e-81   Cicer arietinum [garbanzo]
ref|XP_003597433.1|  60S ribosomal protein L18a                         252   2e-81   Medicago truncatula
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          251   3e-81   Sorghum bicolor [broomcorn]
gb|ACN28455.1|  unknown                                                 251   3e-81   Zea mays [maize]
gb|ACG30921.1|  60S ribosomal protein L18a                              251   3e-81   Zea mays [maize]
gb|AFK33651.1|  unknown                                                 251   3e-81   Lotus japonicus
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         251   3e-81   Oryza brachyantha
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       251   3e-81   Brassica rapa
ref|NP_001148024.1|  60S ribosomal protein L18a                         251   4e-81   Zea mays [maize]
gb|ABK26330.1|  unknown                                                 251   4e-81   Picea sitchensis
ref|NP_001043805.2|  Os01g0666900                                       251   4e-81   
ref|NP_001044264.1|  Os01g0752300                                       251   4e-81   
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         251   4e-81   Setaria italica
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    250   5e-81   Saccharomyces cerevisiae [brewer's yeast]
ref|NP_001149475.1|  LOC100283101                                       251   5e-81   Zea mays [maize]
gb|EMS54441.1|  60S ribosomal protein L18a                              251   5e-81   Triticum urartu
ref|NP_001152227.1|  60S ribosomal protein L18a                         251   5e-81   Zea mays [maize]
gb|EMT07340.1|  60S ribosomal protein L18a                              251   6e-81   Aegilops tauschii
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    267   6e-81   Glycine max [soybeans]
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       250   7e-81   Malus domestica [apple tree]
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            250   1e-80   Brassica rapa
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          250   1e-80   Sorghum bicolor [broomcorn]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         250   1e-80   Setaria italica
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             250   1e-80   Eutrema salsugineum
emb|CDX79564.1|  BnaC03g19000D                                          249   1e-80   Brassica napus [oilseed rape]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             249   2e-80   Prunus persica
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         249   2e-80   Brachypodium distachyon [annual false brome]
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         249   2e-80   Brachypodium distachyon [annual false brome]
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    249   2e-80   
gb|KEH33554.1|  60S ribosomal protein L18a-3                            249   2e-80   Medicago truncatula
gb|ACF78859.1|  unknown                                                 249   2e-80   Zea mays [maize]
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    249   3e-80   Malus domestica [apple tree]
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    264   7e-80   Cucumis melo [Oriental melon]
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       248   7e-80   Brassica rapa
ref|XP_004166596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    264   9e-80   
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    265   9e-80   Prunus mume [ume]
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    252   9e-80   Vitis vinifera
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         247   9e-80   Sesamum indicum [beniseed]
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            247   1e-79   Beta vulgaris subsp. vulgaris [Swiss chard]
dbj|BAJ85943.1|  predicted protein                                      247   2e-79   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              246   2e-79   Brachypodium distachyon [annual false brome]
ref|XP_003617399.1|  60S ribosomal protein L18a                         263   2e-79   
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    246   2e-79   Arabis alpina [alpine rockcress]
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    251   3e-79   Tarenaya hassleriana [spider flower]
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             246   3e-79   Capsella rubella
gb|EMT24993.1|  60S ribosomal protein L18a                              246   3e-79   Aegilops tauschii
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            246   3e-79   Brassica rapa
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             246   3e-79   Capsella rubella
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    246   4e-79   
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    250   6e-79   Citrus sinensis [Valencia orange]
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    262   9e-79   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    262   1e-78   
gb|ACG47612.1|  60S ribosomal protein L18a                              244   1e-78   Zea mays [maize]
ref|NP_180995.1|  60S ribosomal protein L18a-2                          244   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            244   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            244   3e-78   Camelina sativa [gold-of-pleasure]
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    244   3e-78   Arabis alpina [alpine rockcress]
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    244   3e-78   Fragaria vesca subsp. vesca
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    259   5e-78   
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               247   7e-78   Ricinus communis
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             243   9e-78   Eutrema salsugineum
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            242   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         242   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       242   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002882886.1|  60S ribosomal protein L18A                         242   1e-77   Arabidopsis lyrata subsp. lyrata
ref|NP_188078.1|  60S ribosomal protein L18a-3                          242   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       242   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         241   2e-77   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001152434.1|  LOC100286074                                       241   3e-77   
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    245   5e-77   Eucalyptus grandis [rose gum]
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    245   5e-77   Malus domestica [apple tree]
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    245   7e-77   Pyrus x bretschneideri [bai li]
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     240   7e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    244   2e-76   
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             244   2e-76   Eutrema salsugineum
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            239   2e-76   Brassica rapa
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    238   4e-76   Fragaria vesca subsp. vesca
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             243   4e-76   Capsella rubella
emb|CDY35269.1|  BnaC03g59540D                                          238   6e-76   Brassica napus [oilseed rape]
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             238   6e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         243   9e-76   
gb|EEE55145.1|  hypothetical protein OsJ_02939                          236   4e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762693.1|  predicted protein                                  235   7e-75   Physcomitrella patens
ref|XP_001765218.1|  predicted protein                                  235   7e-75   Physcomitrella patens
dbj|BAB90499.1|  ribosomal protein L18a-like                            236   7e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       234   1e-74   Elaeis guineensis
ref|XP_001752605.1|  predicted protein                                  233   3e-74   Physcomitrella patens
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            233   5e-74   Elaeis guineensis
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             232   1e-73   Selaginella moellendorffii
ref|XP_001760636.1|  predicted protein                                  231   4e-73   Physcomitrella patens
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       233   2e-72   Arabidopsis lyrata subsp. lyrata
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       233   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    231   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       224   1e-70   Coccomyxa subellipsoidea C-169
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              224   2e-70   Chlorella variabilis
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    224   1e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30857.3|  unnamed protein product                                214   1e-67   Vitis vinifera
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              215   6e-67   Fragaria vesca subsp. vesca
gb|ABQ42114.1|  60S ribosomal protein L18a                              211   2e-66   Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              210   5e-66   Sonneratia alba
gb|ADU56180.1|  hypothetical protein                                    211   7e-66   Jatropha curcas
gb|AAT08714.1|  ribosomal protein L18A                                  210   5e-65   Hyacinthus orientalis [common hyacinth]
gb|KDD75676.1|  ribosomal protein L18ae/LX                              210   6e-65   Helicosporidium sp. ATCC 50920
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       209   1e-64   Auxenochlorella protothecoides
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             207   3e-64   Phaseolus vulgaris [French bean]
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    208   4e-64   Chlamydomonas reinhardtii
gb|KJB10615.1|  hypothetical protein B456_001G211400                    206   5e-64   Gossypium raimondii
gb|KJB34967.1|  hypothetical protein B456_006G092900                    206   1e-63   Gossypium raimondii
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             206   1e-63   Populus trichocarpa [western balsam poplar]
emb|CDX98480.1|  BnaC05g38950D                                          205   1e-63   Brassica napus [oilseed rape]
emb|CDX82474.1|  BnaA03g33470D                                          205   1e-63   Brassica napus [oilseed rape]
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            206   2e-63   Monoraphidium neglectum
ref|NP_001237792.1|  uncharacterized protein LOC100305604               204   3e-63   Glycine max [soybeans]
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                204   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    205   4e-63   Volvox carteri f. nagariensis
emb|CDX84313.1|  BnaC04g10750D                                          202   2e-62   Brassica napus [oilseed rape]
ref|XP_004144680.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    217   3e-62   
emb|CDY43672.1|  BnaA04g20190D                                          201   8e-62   Brassica napus [oilseed rape]
emb|CDX84643.1|  BnaA03g15870D                                          201   9e-62   Brassica napus [oilseed rape]
gb|ACS68696.1|  60S RPL18aB                                             198   3e-61   Sonneratia alba
dbj|BAH20340.1|  AT3G14600                                              191   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    192   5e-58   Ostreococcus lucimarinus CCE9901
ref|XP_007508296.1|  unknown                                            193   6e-58   Bathycoccus prasinos
emb|CEF98555.1|  Ribosomal protein L18ae                                187   2e-56   Ostreococcus tauri
ref|XP_003062312.1|  predicted protein                                  186   9e-56   Micromonas pusilla CCMP1545
gb|ADV03035.1|  ribosomal protein L18A                                  185   4e-55   Karlodinium veneficum
ref|XP_002501229.1|  predicted protein                                  181   2e-53   Micromonas commoda
gb|KFH68950.1|  60S ribosomal protein L20                               178   9e-53   Mortierella verticillata NRRL 6337
ref|XP_008880083.1|  hypothetical protein H310_14105                    175   2e-51   Aphanomyces invadans
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   176   4e-51   Mortierella verticillata NRRL 6337
gb|KJB69797.1|  hypothetical protein B456_011G042800                    173   6e-51   Gossypium raimondii
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        172   2e-50   Saprolegnia diclina VS20
ref|XP_009831602.1|  hypothetical protein H257_07690                    172   4e-50   Aphanomyces astaci
ref|XP_006828776.1|  hypothetical protein AMTR_s00001p00102800          171   4e-50   
dbj|BAK07344.1|  predicted protein                                      172   6e-50   Hordeum vulgare subsp. vulgare [barley]
gb|EGU11460.1|  60S ribosomal protein L20A                              171   9e-50   Rhodotorula toruloides ATCC 204091
gb|EPZ32213.1|  60S ribosomal protein L20-B                             171   1e-49   Rozella allomycis CSF55
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             171   1e-49   Perkinsus marinus ATCC 50983
ref|XP_003841410.1|  similar to 60S ribosomal protein L18a              170   2e-49   Leptosphaeria maculans JN3
emb|CDS03349.1|  Putative 60S ribosomal protein L20                     170   2e-49   Lichtheimia ramosa
emb|CDS14547.1|  Putative 60S ribosomal protein L20                     170   2e-49   Lichtheimia ramosa
emb|CDH57447.1|  60s ribosomal protein l20                              169   3e-49   Lichtheimia corymbifera JMRC:FSU:9682
gb|KDR72699.1|  hypothetical protein GALMADRAFT_142989                  169   3e-49   Galerina marginata CBS 339.88
ref|XP_007394375.1|  hypothetical protein PHACADRAFT_253712             169   4e-49   Phanerochaete carnosa HHB-10118-sp
ref|XP_007415007.1|  hypothetical protein MELLADRAFT_72927              169   4e-49   Melampsora larici-populina 98AG31
gb|KIK70034.1|  hypothetical protein GYMLUDRAFT_34471                   169   4e-49   Gymnopus luxurians FD-317 M1
gb|ERS97659.1|  60S ribosomal protein L20                               169   5e-49   Sporothrix schenckii ATCC 58251
ref|XP_007313367.1|  hypothetical protein SERLADRAFT_456475             169   5e-49   Serpula lacrymans var. lacrymans S7.9
gb|KJA26912.1|  hypothetical protein HYPSUDRAFT_132230                  168   6e-49   Hypholoma sublateritium FD-334 SS-4
gb|EUC60950.1|  60S ribosomal protein L20                               168   6e-49   Rhizoctonia solani AG-3 Rhs1AP
gb|KIO01130.1|  hypothetical protein M404DRAFT_1003406                  168   6e-49   Pisolithus tinctorius Marx 270
gb|KIL64760.1|  hypothetical protein M378DRAFT_77817                    168   7e-49   Amanita muscaria Koide BX008
ref|XP_007717889.1|  hypothetical protein COCCADRAFT_9694               169   7e-49   Bipolaris zeicola 26-R-13
ref|XP_001614192.1|  60S ribosomal protein L18a                         169   8e-49   Plasmodium vivax Sal-1
gb|KDQ32854.1|  hypothetical protein PLEOSDRAFT_1051744                 168   9e-49   Pleurotus ostreatus PC15
ref|XP_003029116.1|  60S ribosomal protein L20                          168   9e-49   Schizophyllum commune H4-8
ref|XP_003617398.1|  60S ribosomal protein L18a                         167   1e-48   
gb|KIM56681.1|  hypothetical protein SCLCIDRAFT_1220115                 168   1e-48   Scleroderma citrinum Foug A
ref|XP_008815720.1|  50S ribosomal protein L18Ae                        168   1e-48   Plasmodium inui San Antonio 1
emb|CBK25105.2|  unnamed protein product                                168   1e-48   Blastocystis hominis
ref|XP_003656447.1|  60S ribosomal protein L20                          167   2e-48   Thielavia terrestris NRRL 8126
emb|CDO75758.1|  hypothetical protein BN946_scf184921.g34               167   2e-48   Trametes cinnabarina
gb|KIK92807.1|  hypothetical protein PAXRUDRAFT_13013                   167   2e-48   Paxillus rubicundulus Ve08.2h10
emb|CEG71682.1|  Putative 60S ribosomal protein L20                     167   2e-48   Rhizopus microsporus
ref|XP_001652207.1|  AAEL006785-PB                                      167   2e-48   Aedes aegypti
gb|KIK23334.1|  hypothetical protein PISMIDRAFT_679451                  167   2e-48   Pisolithus microcarpus 441
ref|XP_002469001.1|  60S ribosomal protein L18A                         167   2e-48   Postia placenta Mad-698-R
gb|EMD87012.1|  hypothetical protein COCHEDRAFT_1227999                 168   3e-48   Bipolaris maydis C5
ref|XP_007791911.1|  putative 60s ribosomal protein l20 protein         167   3e-48   Eutypa lata UCREL1
ref|XP_011127067.1|  hypothetical protein AOL_s00193g154                169   3e-48   Arthrobotrys oligospora ATCC 24927
gb|KDQ60389.1|  hypothetical protein JAAARDRAFT_126134                  166   4e-48   Jaapia argillacea MUCL 33604
ref|XP_006696013.1|  60S ribosomal protein l20-like protein             166   4e-48   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_011274808.1|  60S ribosomal protein L18a                         167   4e-48   Wickerhamomyces ciferrii
emb|CCX05992.1|  Similar to 60S ribosomal protein L20-A; acc. no....    166   4e-48   Pyronema omphalodes CBS 100304
ref|XP_002484037.1|  60S ribosomal protein L20                          166   4e-48   Talaromyces stipitatus ATCC 10500
dbj|GAM38126.1|  ribosomal L18ae protein family protein                 167   4e-48   Talaromyces cellulolyticus
ref|XP_007867854.1|  60S ribosomal protein L18A                         166   5e-48   Gloeophyllum trabeum ATCC 11539
gb|AAV90708.1|  60S ribosomal protein L18a                              166   5e-48   Aedes albopictus [forest day mosquito]
ref|XP_004223603.1|  60S ribosomal protein L18a                         166   5e-48   Plasmodium cynomolgi strain B
ref|XP_007772738.1|  60S ribosomal protein L18A                         166   5e-48   Coniophora puteana RWD-64-598 SS2
ref|XP_505817.1|  60S ribosomal protein L20                             166   5e-48   Yarrowia lipolytica CLIB122
ref|XP_001882521.1|  60S ribosomal protein L20                          166   6e-48   Laccaria bicolor S238N-H82
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        166   6e-48   Galdieria sulphuraria
ref|XP_001935145.1|  60S ribosomal protein L20                          166   6e-48   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007303851.1|  60S ribosomal protein L20                          166   6e-48   Stereum hirsutum FP-91666 SS1
ref|XP_003297118.1|  60S ribosomal protein L20                          166   6e-48   Pyrenophora teres f. teres 0-1
gb|KDN45848.1|  hypothetical protein RSAG8_04681                        167   7e-48   
ref|XP_320252.4|  AGAP012284-PA                                         166   7e-48   
gb|KIH90052.1|  60S ribosomal protein l20                               169   7e-48   
gb|ADV03042.1|  ribosomal protein L18A                                  166   7e-48   
emb|CCG80842.1|  Ribosomal L18ae protein family                         166   8e-48   
gb|KIJ91891.1|  hypothetical protein K443DRAFT_114419                   166   8e-48   
gb|KDE03132.1|  60S ribosomal protein L20                               166   9e-48   
gb|KIP09725.1|  hypothetical protein PHLGIDRAFT_28839                   165   1e-47   
ref|XP_001549060.1|  60S ribosomal protein L20                          166   1e-47   
ref|XP_001592983.1|  60S ribosomal protein L20                          166   1e-47   
gb|KIJ63802.1|  hypothetical protein HYDPIDRAFT_91738                   165   1e-47   
gb|AFK46142.1|  unknown                                                 165   1e-47   
gb|EIF45355.1|  60s ribosomal protein l20                               166   1e-47   
gb|ESZ99063.1|  60S ribosomal protein L20                               166   1e-47   
gb|EPS96483.1|  hypothetical protein FOMPIDRAFT_1025390                 165   1e-47   
ref|XP_002150233.1|  60S ribosomal protein L20                          165   1e-47   
ref|XP_009552266.1|  hypothetical protein HETIRDRAFT_442343             165   1e-47   
ref|XP_004200777.1|  Piso0_003381                                       165   1e-47   
ref|XP_007848531.1|  60s ribosomal protein l20                          165   2e-47   
ref|XP_001839657.1|  60S ribosomal protein L20                          165   2e-47   
ref|XP_007352772.1|  ribosomal protein L18ae                            165   2e-47   
gb|KFM72761.1|  60S ribosomal protein L18a                              164   2e-47   
gb|KIM74091.1|  hypothetical protein PILCRDRAFT_99202                   165   2e-47   
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       165   2e-47   
dbj|GAA88696.1|  60S ribosomal protein L20                              164   2e-47   
gb|AGE89254.1|  60S ribosomal protein L18a                              165   2e-47   
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             164   2e-47   
ref|XP_007874905.1|  hypothetical protein PNEG_02868                    165   2e-47   
ref|XP_006464014.1|  hypothetical protein AGABI2DRAFT_194625            164   2e-47   
emb|CDR97128.1|  60S ribosomal protein L18ae, putative                  165   3e-47   
ref|NP_001037219.1|  ribosomal protein L18A                             164   3e-47   
gb|KIW08808.1|  60S ribosomal protein L20-B                             165   3e-47   
gb|KFB49813.1|  AGAP012284-PA-like protein                              164   3e-47   
gb|EHA26343.1|  hypothetical protein ASPNIDRAFT_137752                  164   3e-47   
ref|XP_001388788.2|  60S ribosomal protein L20                          164   3e-47   
emb|CAK36896.1|  unnamed protein product                                165   3e-47   
ref|XP_008020166.1|  hypothetical protein SETTUDRAFT_29919              164   3e-47   
gb|KIY70561.1|  60S ribosomal protein L18A                              164   3e-47   
gb|KIM42469.1|  hypothetical protein M413DRAFT_444884                   164   3e-47   
gb|KIJ04866.1|  hypothetical protein PAXINDRAFT_159230                  164   3e-47   
gb|EWM27710.1|  60s ribosomal protein l18a                              167   3e-47   
ref|XP_001245490.1|  60S ribosomal protein L20                          164   3e-47   
gb|EMR86198.1|  putative 60s ribosomal protein l20 protein              166   3e-47   
ref|XP_003672513.1|  ribosomal protein L20                              164   4e-47   
gb|KDO27995.1|  hypothetical protein SPRG_22195                         176   4e-47   
gb|KEQ75912.1|  60S ribosomal protein L18ae                             164   4e-47   
gb|KIW08809.1|  60S ribosomal protein L20-B, variant                    164   4e-47   
gb|KII84587.1|  hypothetical protein PLICRDRAFT_146717                  164   4e-47   
gb|KIV96880.1|  60S ribosomal protein L20-A                             164   5e-47   
emb|CEL63282.1|  60S ribosomal protein L20-A OS=Saccharomyces cer...    164   5e-47   
gb|KIY48970.1|  60S ribosomal protein L18A                              164   5e-47   
gb|EYE94501.1|  ribosomal protein L18ae                                 164   5e-47   
ref|XP_009159133.1|  60S ribosomal protein L20                          163   6e-47   
emb|CDP22704.1|  Putative cytosolic 60S ribosomal protein Rpl18a        163   6e-47   
gb|EHN05474.1|  Rpl20bp                                                 164   7e-47   
ref|XP_001221038.1|  60S ribosomal protein L20                          163   7e-47   
emb|CCM00446.1|  predicted protein                                      164   7e-47   
gb|EIE90718.1|  60S ribosomal protein L18ae                             163   7e-47   
gb|KFX43566.1|  60S ribosomal protein L20-B                             164   7e-47   
emb|CAA88652.1|  unknown                                                163   7e-47   
gb|EIE86590.1|  60S ribosomal protein L18ae                             163   8e-47   
gb|EHN00058.1|  Rpl20bp                                                 163   8e-47   
ref|XP_007580415.1|  putative 60s ribosomal protein l20 protein         163   8e-47   
gb|AEL28892.1|  ribosomal protein L18A                                  163   8e-47   
ref|XP_002108947.1|  expressed hypothetical protein                     163   8e-47   
gb|ESW95865.1|  60S ribosomal protein L20-A                             163   9e-47   
gb|KIJ28628.1|  hypothetical protein M422DRAFT_37236                    163   9e-47   
ref|XP_007687479.1|  hypothetical protein COCMIDRAFT_94025              164   9e-47   
gb|AJS98744.1|  Rpl20ap                                                 163   9e-47   
emb|CAA62167.1|  orf 06116                                              163   9e-47   
ref|NP_013969.3|  ribosomal 60S subunit protein L20A                    163   1e-46   
gb|EJT99201.1|  ribosomal protein L18ae                                 163   1e-46   
emb|CCD33810.1|  hypothetical protein BofuT4_P064120.1                  164   1e-46   
ref|XP_007719951.1|  60S ribosomal protein L20                          163   1e-46   
ref|NP_985877.3|  60S ribosomal protein L20                             162   1e-46   
ref|XP_007704720.1|  hypothetical protein COCSADRAFT_203472             163   1e-46   
dbj|GAM87453.1|  hypothetical protein ANO11243_054780                   162   1e-46   
gb|KIY02830.1|  hypothetical protein Z520_01295                         163   1e-46   
ref|XP_003658479.1|  hypothetical protein MYCTH_2122073                 162   2e-46   
gb|KGK37450.1|  hypothetical protein JL09_g3403                         163   2e-46   
gb|EDN64179.1|  ribosomal protein L20A                                  162   2e-46   
gb|KIK40382.1|  hypothetical protein CY34DRAFT_87440                    162   2e-46   
gb|EGA73566.1|  Rpl20ap                                                 163   2e-46   
emb|CEP13249.1|  hypothetical protein                                   162   2e-46   
ref|XP_003716235.1|  60S ribosomal protein L20                          162   2e-46   
gb|EJT44404.1|  RPL20A-like protein                                     164   2e-46   
gb|EHN00736.1|  Rpl20bp                                                 164   2e-46   
gb|KHJ31045.1|  putative 60s ribosomal protein l20                      162   2e-46   
ref|XP_003644532.1|  hypothetical protein Ecym_1491                     162   2e-46   
gb|EJT45352.1|  60s ribosomal protein l20 (yl17)                        162   2e-46   
gb|ADT80712.1|  ribosomal protein L18A                                  162   2e-46   
ref|XP_448543.1|  60S ribosomal protein L20                             162   3e-46   
ref|XP_001212923.1|  60S ribosomal protein L20                          162   3e-46   
emb|CEG68118.1|  Putative 60S ribosomal protein L20                     162   3e-46   
gb|KIW61227.1|  hypothetical protein PV05_01378                         162   3e-46   
gb|EFX00968.1|  60S ribosomal protein l20                               162   3e-46   
dbj|GAD92811.1|  60S ribosomal protein L20                              164   3e-46   
gb|KIW37335.1|  hypothetical protein PV06_10383                         161   4e-46   
ref|XP_658037.1|  hypothetical protein AN0433.2                         161   4e-46   
ref|XP_007784343.1|  60S ribosomal protein L20                          162   4e-46   
emb|CDR47151.1|  CYFA0S29e00936g1_1                                     161   4e-46   
gb|ABS19978.1|  ribosomal protein L18a                                  161   4e-46   
gb|ELK19170.1|  60S ribosomal protein L18a                              162   4e-46   
ref|XP_773195.1|  60S ribosomal protein L20                             161   5e-46   
gb|ADG23110.1|  60S ribosomal protein L20                               161   5e-46   
ref|XP_007803531.1|  60S ribosomal protein L20-B                        162   5e-46   
ref|XP_003670112.1|  ribosomal protein L20                              161   5e-46   
gb|KIW75002.1|  60S ribosomal protein L20-B                             161   5e-46   
gb|KIR47203.1|  50S small subunit ribosomal protein L18Ae               161   5e-46   
ref|XP_003196123.1|  60s ribosomal protein l20 (yl17)                   161   6e-46   
gb|EEQ45313.1|  60S ribosomal protein L20                               161   6e-46   
ref|XP_004178642.1|  hypothetical protein TBLA_0B02810                  161   6e-46   
ref|XP_722704.1|  likely cytosolic ribosomal protein L20 (L18)          161   6e-46   
gb|AGH70166.1|  60S ribosomal protein L18a                              161   6e-46   
dbj|BAH28893.1|  ribosomal protein L18a                                 161   6e-46   
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    161   7e-46   
ref|XP_003955787.1|  hypothetical protein KAFR_0B03550                  160   7e-46   
emb|CEG80127.1|  Putative 60S ribosomal protein L20                     160   8e-46   
dbj|GAA95901.1|  hypothetical protein E5Q_02559                         160   8e-46   
gb|KEQ93295.1|  hypothetical protein AUEXF2481DRAFT_81514               160   8e-46   
gb|KEQ58402.1|  ribosomal L18ae protein family                          160   9e-46   
emb|CCK72147.1|  hypothetical protein KNAG_0J00640                      160   9e-46   
gb|KIW87333.1|  60S ribosomal protein L20-B                             160   9e-46   
ref|XP_007925856.1|  hypothetical protein MYCFIDRAFT_51495              160   9e-46   
ref|XP_007741872.1|  60S ribosomal protein L20                          160   1e-45   
ref|XP_637982.2|  S60 ribosomal protein L18a                            160   1e-45   
ref|XP_002419817.1|  60S ribosomal protein L20                          160   1e-45   
ref|XP_003856132.1|  60S ribosomal protein L20                          160   1e-45   
emb|CDO66197.1|  60S ribosomal protein L18, putative                    160   1e-45   
gb|KIW69117.1|  hypothetical protein PV04_05012                         160   1e-45   
gb|KEQ84974.1|  ribosomal protein L18ae                                 160   1e-45   
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             160   1e-45   
ref|XP_002849494.1|  60S ribosomal protein L20                          161   1e-45   
gb|AAR09828.1|  similar to Drosophila melanogaster RpL18A               160   1e-45   
ref|XP_001265211.1|  60S ribosomal protein L20                          161   1e-45   
gb|KIM98051.1|  hypothetical protein OIDMADRAFT_147541                  160   1e-45   
emb|CEG74192.1|  Putative 60S ribosomal protein L20                     160   1e-45   
gb|EEH38031.2|  60S ribosomal protein L20                               160   1e-45   
ref|NP_523774.1|  ribosomal protein L18A                                160   1e-45   
ref|XP_002394051.1|  hypothetical protein MPER_06120                    159   1e-45   
emb|CDM26451.1|  60S ribosomal protein L20                              162   1e-45   
ref|XP_003233919.1|  60S ribosomal protein L20                          160   1e-45   
ref|XP_002897608.1|  60S ribosomal protein L18a                         160   1e-45   
ref|XP_005174872.1|  PREDICTED: 60S ribosomal protein L18a              160   1e-45   
gb|KGB80154.1|  60S ribosomal protein L20                               161   1e-45   
emb|CDF88589.1|  BN860_13806g1_1                                        160   1e-45   
ref|XP_002797093.1|  60S ribosomal protein L20                          160   2e-45   
gb|EGE06819.1|  Ribosomal L18ae family protein                          160   2e-45   
gb|KFY17461.1|  hypothetical protein V492_00655                         160   2e-45   
ref|XP_001611594.1|  60S ribosomal  protein L18ae                       160   2e-45   
ref|XP_001360626.1|  GA19650                                            160   2e-45   
gb|ETN61400.1|  hypothetical protein AND_006941                         165   2e-45   
gb|EZF34867.1|  60S ribosomal protein L20                               160   2e-45   
dbj|BAN65814.1|  60S ribosomal protein L18ae, putative                  160   2e-45   
ref|XP_001960744.1|  GF13512                                            160   2e-45   
ref|XP_005715079.1|  unnamed protein product                            160   2e-45   
ref|XP_001387514.1|  60S ribosomal protein L20                          159   2e-45   
ref|XP_003170190.1|  60S ribosomal protein L20                          159   2e-45   
gb|KIO31910.1|  hypothetical protein M407DRAFT_241644                   159   2e-45   
gb|EEQ86274.1|  60S ribosomal protein L18A                              159   2e-45   
gb|EKV11298.1|  Ribosomal L18ae protein family                          161   2e-45   
gb|ABR27953.1|  60S ribosomal protein L18a                              159   2e-45   
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    159   2e-45   
gb|EGD98622.1|  60S ribosomal protein L18A                              160   2e-45   
ref|NP_593336.1|  60S ribosomal protein L20                             159   2e-45   
ref|XP_001269707.1|  60S ribosomal protein L20                          160   2e-45   
ref|XP_002545416.1|  60S ribosomal protein L20                          159   2e-45   
gb|ELK32292.1|  60S ribosomal protein L18a                              160   3e-45   
ref|XP_008727176.1|  60S ribosomal protein L20                          160   3e-45   
gb|EMG48306.1|  Ribosomal protein, large subunit, putative              159   3e-45   
gb|EPS27971.1|  hypothetical protein PDE_02916                          160   3e-45   
ref|XP_009224397.1|  60S ribosomal protein L20                          159   3e-45   
ref|XP_011111918.1|  hypothetical protein H072_6117                     169   3e-45   
emb|CCO32560.1|  60S ribosomal protein L20-A AltName: Full=L18a         159   3e-45   
gb|ELR06554.1|  60S ribosomal protein L20                               159   3e-45   
ref|XP_002063423.1|  GK21403                                            159   3e-45   
gb|EPQ64215.1|  Protein component of the large (60S) ribosomal su...    159   3e-45   
ref|XP_001350134.1|  60S ribosomal protein L18, putative                159   3e-45   
gb|KEZ42433.1|  hypothetical protein SAPIO_CDS5629                      159   3e-45   
gb|ACY95363.1|  ribosomal protein L18A                                  159   3e-45   
ref|XP_001985733.1|  GH20961                                            159   3e-45   
gb|EUT80094.1|  hypothetical protein PFAG_04738                         159   3e-45   
ref|XP_007002534.1|  hypothetical protein TREMEDRAFT_42617              159   3e-45   
gb|KFY52161.1|  hypothetical protein V496_08621                         159   3e-45   
emb|CDO95724.1|  unnamed protein product                                159   3e-45   
gb|KFY29381.1|  hypothetical protein V491_00056                         159   4e-45   
ref|XP_003022051.1|  hypothetical protein TRV_03792                     159   4e-45   
ref|XP_001524279.1|  60S ribosomal protein L20                          159   4e-45   
gb|KIW11360.1|  hypothetical protein PV08_10660                         160   4e-45   
gb|KFX98087.1|  hypothetical protein O988_04540                         159   4e-45   
gb|ETW59457.1|  hypothetical protein PFMC_04646                         159   4e-45   
gb|EFA83144.1|  S60 ribosomal protein L18a                              159   4e-45   
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               159   4e-45   
ref|XP_006387717.1|  hypothetical protein POPTR_0647s00210g             158   4e-45   
ref|XP_003679449.1|  60S ribosomal protein L20                          159   4e-45   
dbj|BAJ93879.1|  predicted protein                                      159   4e-45   
ref|XP_007297620.1|  60S ribosomal protein L20                          161   4e-45   
ref|XP_002006863.1|  GI21298                                            159   4e-45   
ref|XP_002618653.1|  hypothetical protein CLUG_02112                    159   4e-45   
ref|XP_006680278.1|  hypothetical protein BATDEDRAFT_17251              159   5e-45   
gb|EMF14474.1|  60S ribosomal protein L20                               159   5e-45   
dbj|BAN20250.1|  hypothetical protein                                   159   5e-45   
ref|XP_003292885.1|  ribosomal protein L18a                             158   5e-45   
ref|XP_007383455.1|  60S ribosomal protein L18A                         158   5e-45   
ref|XP_007914565.1|  putative 60s ribosomal protein l20 protein         159   5e-45   
ref|XP_001541495.1|  60S ribosomal protein L20                          159   5e-45   
ref|XP_010759221.1|  60S ribosomal protein L20                          159   5e-45   
ref|XP_003869824.1|  Rpl20b predicted ribosomal protein L20             158   5e-45   
ref|XP_567335.1|  60s ribosomal protein l20 (yl17)                      161   6e-45   
gb|EHH59357.1|  hypothetical protein EGM_09444                          158   6e-45   
gb|KDN42179.1|  putative 60S large subunit ribosomal protein L20        158   6e-45   
gb|EPX72144.1|  60S ribosomal protein L20                               158   6e-45   
emb|CCE44296.1|  hypothetical protein CPAR2_400980                      158   6e-45   
ref|XP_006689073.1|  60S ribosomal protein L18A                         158   6e-45   
gb|EPY50958.1|  60S ribosomal protein L20                               158   6e-45   
emb|CCJ29034.1|  unnamed protein product                                158   6e-45   
emb|CCU81505.1|  60S ribosomal protein L20                              159   6e-45   
ref|XP_008082174.1|  60S ribosomal protein L20                          159   6e-45   
gb|KIV82076.1|  60S ribosomal protein L20-B                             158   7e-45   
gb|KIW28290.1|  hypothetical protein PV07_07966                         160   7e-45   
ref|XP_011300735.1|  PREDICTED: 60S ribosomal protein L18a              158   7e-45   



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   268 bits (685),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   268 bits (685),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   266 bits (680),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV Y+FHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   266 bits (680),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   266 bits (679),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   266 bits (679),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   265 bits (678),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTAT+
Sbjct  121  HCIQIIKTATV  131



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTAT+
Sbjct  121  HCIQIIKTATV  131



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGR LP+ETDEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRGLPTETDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIK ATI
Sbjct  121  HCIQIIKIATI  131



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004162601.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   263 bits (672),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004147412.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004164939.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
Length=178

 Score =   263 bits (671),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  184  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  363
            ++E  S  +KMVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  17   TEERESEQSKMVTYKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  76

Query  364  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  543
            KKVKKSNGQ+LAINEIFEK PT +KN+G+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYT
Sbjct  77   KKVKKSNGQMLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYT  136

Query  544  EMASRHRVRHHCIQIIKTATI  606
            EMASRHRVR HCIQIIKTATI
Sbjct  137  EMASRHRVRPHCIQIIKTATI  157



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  190  EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  369
            E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK
Sbjct  17   EPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  76

Query  370  VKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEM  549
            VKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEM
Sbjct  77   VKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEM  136

Query  550  ASRHRVRHHCIQIIKTATI  606
            ASRHRVR  CIQII+TATI
Sbjct  137  ASRHRVRSPCIQIIRTATI  155



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTYRFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRC  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT++FHQYQVVGRALPSE+DEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFKFHQYQVVGRALPSESDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   261 bits (667),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  11   MVAFRFHQYQVVGRALPTAADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  70

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  71   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  130

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  131  HCIQIIKTATI  141



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   261 bits (666),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   261 bits (666),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            VLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  571  HHCIQIIKTATI  606
              CIQIIKTATI
Sbjct  122  SPCIQIIKTATI  133



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS T+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTNEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSSTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLW+TNEVRAKSKFWYFLRKLKKVK+SNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDDHPKIYRMKLWSTNEVRAKSKFWYFLRKLKKVKRSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  SCIQIIKTATI  131



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  YRF QYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAIYRFRQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M T+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGR LPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            VLAINEIFEK P K+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  571  HHCIQIIKTATI  606
              CIQIIKTATI
Sbjct  122  SPCIQIIKTATI  133



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTYR HQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYRIHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  381
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  382  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  561
            NGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  151

Query  562  RVRHHCIQIIKTATI  606
            RVR  CIQIIKTAT+
Sbjct  152  RVRFPCIQIIKTATV  166



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   258 bits (660),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTY+FHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYKFHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKT TI
Sbjct  121  PCIQIIKTGTI  131



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+R+HQYQVVGRALP+E+DEHPKIYRM+LWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRYHQYQVVGRALPTESDEHPKIYRMRLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  199  SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  378
             + ++MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK
Sbjct  73   PLASEMVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  132

Query  379  SNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  558
            SNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  133  SNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  192

Query  559  HRVRHHCIQIIKTATI  606
            HRVR  CIQIIKTAT+
Sbjct  193  HRVRFPCIQIIKTATV  208



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  190  EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  369
            E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK
Sbjct  39   EPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  98

Query  370  VKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEM  549
            VKKSNGQ+LAI+EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEM
Sbjct  99   VKKSNGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEM  158

Query  550  ASRHRVRHHCIQIIKTATI  606
            ASRHRVR  CIQII+TATI
Sbjct  159  ASRHRVRSPCIQIIRTATI  177



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR LP++ DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTDADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  381
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  382  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  561
            NGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  151

Query  562  RVRHHCIQIIKTATI  606
            RVR  CIQIIKTAT+
Sbjct  152  RVRFPCIQIIKTATV  166



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             C+QIIKTAT+
Sbjct  121  PCVQIIKTATV  131



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRQ  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVV RALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVERALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRD TLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDITLNGAVEQMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   256 bits (654),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALPS TDEHP+IYRMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPRIYRMKLWTTNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDT LNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTALNGAVEHMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEAMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++R+HQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRYHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MVTFRFHQYQVVGRAHPAESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSIGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_006841639.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ T+EHPK+YRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPTEEHPKLYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+++D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+ MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVDAMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALPSE D HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGIFRFHQYQVVGRALPSEADPHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KN GIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT++FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M T+++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MATFKYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRH  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++++HQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFKYHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV+ MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVDLMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYNEMASRHRVRC  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV++RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV ++FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            +MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  80   EMVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  139

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            +LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR
Sbjct  140  MLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  199

Query  571  HHCIQIIKTATI  606
              CIQIIKTAT+
Sbjct  200  FPCIQIIKTATV  211



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV ++FHQYQVVGRALP+E+D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTESDDHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWASNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR+LP+ TDEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNFRFHQYQVVGRSLPTPTDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVQQMYDEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   250 bits (639),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   251 bits (640),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   267 bits (682),  Expect = 6e-81, Method: Composition-based stats.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +1

Query  208  AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  387
            A+MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG
Sbjct  574  AEMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  633

Query  388  QVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRV  567
            QVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRV
Sbjct  634  QVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRV  693

Query  568  RHHCIQIIKTATI  606
            RH CIQIIKTATI
Sbjct  694  RHPCIQIIKTATI  706



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   250 bits (639),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTE+ASRHRVR 
Sbjct  61   LAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTELASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV + FHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFGFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGSVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPADEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M T++FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFKFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            +++  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  4    RLLLKQFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  63

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            VLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR
Sbjct  64   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVR  123

Query  571  HHCIQIIKTATI  606
              CIQIIKTATI
Sbjct  124  FPCIQIIKTATI  135



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            ++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN
Sbjct  3    QYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH CIQ
Sbjct  63   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRHPCIQ  122

Query  586  IIKTATI  606
            IIKTATI
Sbjct  123  IIKTATI  129



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLR LKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRNLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  ++FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFKFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   264 bits (675),  Expect = 7e-80, Method: Composition-based stats.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  573  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  632

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            +LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR
Sbjct  633  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  692

Query  571  HHCIQIIKTATI  606
              CIQIIKTAT+
Sbjct  693  CPCIQIIKTATV  704



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   248 bits (632),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKESRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004166596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=752

 Score =   264 bits (674),  Expect = 9e-80, Method: Composition-based stats.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  633

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            +LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR
Sbjct  634  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  693

Query  571  HHCIQIIKTATI  606
              CIQIIKTAT+
Sbjct  694  CPCIQIIKTATV  705



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  199  SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  378
            S  ++MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK
Sbjct  594  SPTSQMVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  653

Query  379  SNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  558
            SNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  654  SNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASR  713

Query  559  HRVRHHCIQIIKTATI  606
            HRVR  CIQIIKTATI
Sbjct  714  HRVRSPCIQIIKTATI  729



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 127/140 (91%), Gaps = 2/140 (1%)
 Frame = +1

Query  187  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  366
            +E   ++A   T  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK
Sbjct  115  REKPGLIA--CTIAFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  172

Query  367  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  546
            KVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY E
Sbjct  173  KVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAE  232

Query  547  MASRHRVRHHCIQIIKTATI  606
            MASRHRVR  CIQIIKTATI
Sbjct  233  MASRHRVRSPCIQIIKTATI  252



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   247 bits (631),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 3/131 (2%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVTYR   YQVVGR+LP+ET+EHPKIYRMKLWA NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYR---YQVVGRSLPTETEEHPKIYRMKLWAPNEVRAKSKFWYFLRKLKKVKKSNGQI  57

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  58   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRP  117

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  118  HCIQIIKTATI  128



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E+D HPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MGQFRFHQYQVVGRALPTESDAHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGR LP+ T+E PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEEKPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LA NEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  184  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  363
            SQ +   VAKMV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  562  SQSESVFVAKMVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  621

Query  364  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  543
            KKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  622  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  681

Query  544  EMASRHRVRHHCIQIIKTATI  606
            EMASRHRVR  CIQIIKTATI
Sbjct  682  EMASRHRVRFPCIQIIKTATI  702



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  144  FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  203

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  204  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  263

Query  589  IKTATI  606
            IKTAT+
Sbjct  264  IKTATV  269



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW TNEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            +FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  11   QFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAIN  70

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR  CIQ
Sbjct  71   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRSPCIQ  130

Query  586  IIKTATI  606
            IIKTATI
Sbjct  131  IIKTATI  137



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  135  FHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  194

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  195  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQI  254

Query  589  IKTATI  606
            IKTATI
Sbjct  255  IKTATI  260



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   262 bits (669),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  390
            KMV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  606  KMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  665

Query  391  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  570
            VLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR
Sbjct  666  VLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVR  725

Query  571  HHCIQIIKTATI  606
            H CIQIIKTATI
Sbjct  726  HPCIQIIKTATI  737



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   262 bits (670),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQV
Sbjct  643  MVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQV  702

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  703  LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  762

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  763  PCIQIIKTATI  773



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V QMY EM SRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGXVXQMYNEMXSRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGLFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALPSE +  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPSEKELQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +R+HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAPFRYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  121  PCIQIIKTATI  131



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  184  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  363
            SQ +     KMV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  561  SQSESVFFVKMVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKL  620

Query  364  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  543
            KKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  621  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  680

Query  544  EMASRHRVRHHCIQIIKTATI  606
            EMASRHRVR  CIQIIKTATI
Sbjct  681  EMASRHRVRFPCIQIIKTATI  701



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGR LP+E D+HPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  131  FHQYQVVGRGLPTEADDHPKIYRMKLWATNEFRAKSKFWYFLRKLKKVKKSNGQVLAINE  190

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  191  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  250

Query  589  IKTATI  606
            IKTATI
Sbjct  251  IKTATI  256



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   243 bits (621),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  31   FHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQMLAINE  90

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  91   IFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  150

Query  589  IKTATI  606
            IKTAT+
Sbjct  151  IKTATV  156



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+   EHPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MTIFRFHQYQVVGRALPTAAVEHPKIYRMKLWATNEARAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAIN IFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  574  HCIQIIKTATI  606
             CIQII+TATI
Sbjct  121  LCIQIIRTATI  131



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV A SKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAMSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            +RFHQYQVVGRALP+E+ EHPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQVLAI
Sbjct  3    FRFHQYQVVGRALPTESVEHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQVLAI  62

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIYEKNPTIIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYCEMASRHRVRAPCI  122

Query  583  QIIKTATI  606
            QIIKTAT+
Sbjct  123  QIIKTATV  130



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRAL + TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQ+
Sbjct  1    MVAHRFHQYQVVGRALXTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSXGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+R TTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYKEYRXTTLNGAVEQMYNEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  145  FHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  204

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  589  IKTATI  606
            IKTAT+
Sbjct  265  IKTATV  270



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  220  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  399
            T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  140  TIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  199

Query  400  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  579
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  200  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  259

Query  580  IQIIKTATI  606
            IQIIKTATI
Sbjct  260  IQIIKTATI  268



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  220  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  399
            T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  146  TIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  205

Query  400  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  579
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  206  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  265

Query  580  IQIIKTATI  606
            IQIIKTATI
Sbjct  266  IQIIKTATI  274



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTE+ASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEIASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  220  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  399
            T  FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  145  TIAFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  204

Query  400  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  579
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  205  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  264

Query  580  IQIIKTATI  606
            IQIIKTATI
Sbjct  265  IQIIKTATI  273



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            FHQYQVVGRALP+E + HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  145  FHQYQVVGRALPTEKELHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  204

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  589  IKTATI  606
            IKTAT+
Sbjct  265  IKTATV  270



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  381
            +  KM  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKS
Sbjct  13   LTTKMGVFRFHQYQVVGRALPTENEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKS  72

Query  382  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  561
            NGQ+LAINEIFEK PT + N+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH
Sbjct  73   NGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  132

Query  562  RVRHHCIQIIKTATI  606
            RVR  CIQIIKTAT+
Sbjct  133  RVRFPCIQIIKTATV  147



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            ++HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  8    QYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQILAIN  67

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR  CIQ
Sbjct  68   EIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRSPCIQ  127

Query  586  IIKTATI  606
            IIKTATI
Sbjct  128  IIKTATI  134



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQYQVVGRALP+E DEHPKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  147  LHQYQVVGRALPTEKDEHPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  206

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  207  IFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  266

Query  589  IKTATI  606
            IKTAT+
Sbjct  267  IKTATV  272



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   238 bits (606),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   238 bits (606),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M   R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+
Sbjct  1    MSVIRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIKTAT+
Sbjct  121  PCIQIIKTATV  131



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  217  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  396
             T  FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+L
Sbjct  163  CTIAFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQML  222

Query  397  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  576
            AINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  223  AINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRAP  282

Query  577  CIQIIKTATI  606
            CIQIIKTAT+
Sbjct  283  CIQIIKTATV  292



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 123/151 (81%), Gaps = 20/151 (13%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  394  LAINE--------------------IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTT  513
            LAIN                     IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTT
Sbjct  61   LAINGGGPSAFANEFFIFLHHGFVGIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTT  120

Query  514  LNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            LNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  121  LNGAVEQMYTEMASRHRVRFPCIQIIKTATV  151



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   235 bits (599),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  217  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  396
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  397  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  576
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  577  CIQIIKTATI  606
            CIQIIKTATI
Sbjct  121  CIQIIKTATI  130



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   235 bits (599),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  217  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  396
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  397  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  576
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  577  CIQIIKTATI  606
            CIQIIKTATI
Sbjct  121  CIQIIKTATI  130



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   236 bits (601),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 124/148 (84%), Gaps = 17/148 (11%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKF----------W------  345
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKF          W      
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFCSSYLVRFADWGACPVC  60

Query  346  -YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNG  522
             YFLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG
Sbjct  61   RYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNG  120

Query  523  AVEQMYTEMASRHRVRHHCIQIIKTATI  606
            AVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  121  AVEQMYTEMASRHRVRFPCIQIIKTATV  148



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  217  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  396
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNEAPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  397  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  576
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  577  CIQIIKTATI  606
            CIQIIKT TI
Sbjct  121  CIQIIKTGTI  130



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   233 bits (594),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRY  120

Query  574  HCIQIIKTATI  606
            HCIQIIKTATI
Sbjct  121  HCIQIIKTATI  131



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            +RFHQYQVVGRA P+  +EHPK+YRMKLWA +EVRAKSKFWYFLRKLKKVKKS+GQ+LAI
Sbjct  3    FRFHQYQVVGRATPTPDNEHPKMYRMKLWAGDEVRAKSKFWYFLRKLKKVKKSHGQILAI  62

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIFEKNPTTIKNYGIWVRYQSRTGYHNMYKEYRDITLNGAVEQMYDEMASRHRVRFPCI  122

Query  583  QIIKTATI  606
            QIIKTA++
Sbjct  123  QIIKTASV  130



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   231 bits (588),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            +RFHQYQVVGRALP+  +E PK YRMKLWAT+EVRAKSKFWYFLRKL+KVKK++GQ+LAI
Sbjct  3    FRFHQYQVVGRALPTPGNETPKAYRMKLWATDEVRAKSKFWYFLRKLQKVKKAHGQLLAI  62

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRSPCI  122

Query  583  QIIKTATI  606
            QIIKTATI
Sbjct  123  QIIKTATI  130



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQYQVVGRALP E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  142  LHQYQVVGRALPMEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  201

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  202  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  261

Query  589  IKTATI  606
            IKTAT+
Sbjct  262  IKTATV  267



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  140  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  199

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  200  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  259

Query  589  IKTATI  606
            IKTAT+
Sbjct  260  IKTATV  265



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  187  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  366
            ++ G +   +    +H +     ALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK
Sbjct  129  EKPGYIACAIAVSSYHCFV---PALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  185

Query  367  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  546
            KVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTE
Sbjct  186  KVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTE  245

Query  547  MASRHRVRHHCIQIIKTATI  606
            MASRHRVR  CIQIIKTAT+
Sbjct  246  MASRHRVRFPCIQIIKTATV  265



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  Y++HQYQVVGR LP+E +  P IYRMKLWAT+ VRAKSKFWYFLRKL+KVKK+NGQ+
Sbjct  1    MGGYKYHQYQVVGRHLPTEKEPEPTIYRMKLWATDPVRAKSKFWYFLRKLRKVKKANGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LA NEIFEK PT VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGAVEQ+Y EMASRHRVR 
Sbjct  61   LAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAVEQLYQEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             C+QIIKTAT+
Sbjct  121  PCMQIIKTATV  131



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            Y++HQYQVVGR LPSE D  P IYRMKLWA + VRAKSKFWYFLRKL+KVKK+NGQ+LA 
Sbjct  6    YKYHQYQVVGRHLPSEKDAEPTIYRMKLWAQDPVRAKSKFWYFLRKLRKVKKANGQILAC  65

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFE+ PT VKNYGIW+RYQSRTG+HN YKE+RDTTLNGAVEQMY EM SRHRVR  CI
Sbjct  66   NEIFERNPTTVKNYGIWVRYQSRTGFHNAYKEYRDTTLNGAVEQMYQEMGSRHRVRSPCI  125

Query  583  QIIKTATI  606
            QIIKTATI
Sbjct  126  QIIKTATI  133



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 117/138 (85%), Gaps = 12/138 (9%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  137  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  196

Query  409  ------------IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMA  552
                        IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMA
Sbjct  197  VLAVGSEFDLFSIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMA  256

Query  553  SRHRVRHHCIQIIKTATI  606
            SRHRVR  CIQIIKTAT+
Sbjct  257  SRHRVRFPCIQIIKTATV  274



>emb|CBI30857.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/106 (93%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE  531
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA+ 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGALS  106



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MV  ++HQYQVVGRALP + ++ PKIYRMKLW TNEVRAKSKFWYFL+KLKKVKKSNGQ+
Sbjct  1    MVALKYHQYQVVGRALPKDAEDTPKIYRMKLWHTNEVRAKSKFWYFLKKLKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINEIFEK PT V+NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR 
Sbjct  61   LAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYKEYRDTTLNGAVDQMYNEMASRHRVRF  120

Query  574  HCIQIIKTATI  606
             CIQIIK ATI
Sbjct  121  PCIQIIKIATI  131



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  274  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIW  453
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIW  60

Query  454  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  594
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   210 bits (534),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  274  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIW  453
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIW  60

Query  454  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  594
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   211 bits (538),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  286  KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQ  465
            KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQ
Sbjct  1    KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQ  60

Query  466  SRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            SRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKT TI
Sbjct  61   SRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTGTI  107



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 113/135 (84%), Gaps = 8/135 (6%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  +RFHQYQVVGRALP+ +DEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGGFRFHQYQVVGRALPTPSDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHN----MYKEFRDTTLNGAVEQMYTEMASRH  561
            LAINEIFEK PTK+    I LR+ +     N    MYKE+RDTTLNG VEQMYTEMASRH
Sbjct  61   LAINEIFEKNPTKI----IELRHMAEVPEQNRLSYMYKEYRDTTLNGGVEQMYTEMASRH  116

Query  562  RVRHHCIQIIKTATI  606
            RVR  CIQIIKTATI
Sbjct  117  RVRFPCIQIIKTATI  131



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  205  VAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSN  384
            + K   +++ QYQVVGR LP+E D  P ++RMKLWA + VRAKSKFWYF+RKL+KVKK+N
Sbjct  1    MPKQGIFKYKQYQVVGRHLPTEKDAEPALFRMKLWAEDSVRAKSKFWYFMRKLRKVKKAN  60

Query  385  GQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHR  564
            GQV+A+NEI EK PT VKNYGIW+RY SRTG HNMYKEFRDTTLNGAV QMY+EMA RHR
Sbjct  61   GQVVAVNEIVEKRPTVVKNYGIWVRYTSRTGVHNMYKEFRDTTLNGAVSQMYSEMAGRHR  120

Query  565  VRHHCIQIIKTATI  606
            VRH  +QIIKTA I
Sbjct  121  VRHSALQIIKTAEI  134



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            Y++HQYQVVGR LP+E D  P I+RMKLWA + VRAKSKFWYFL KL+KVKK+NGQ++A+
Sbjct  7    YKYHQYQVVGRHLPTEKDAEPPIFRMKLWAQDTVRAKSKFWYFLAKLRKVKKANGQIVAV  66

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFE+ PT +KN+GIW+RY SRTG HNM+KE+RD TLNGAVEQMY EM SRHRVR   +
Sbjct  67   NEIFERRPTTIKNFGIWVRYTSRTGVHNMFKEYRDVTLNGAVEQMYQEMGSRHRVRSSAL  126

Query  583  QIIKTATI  606
            QIIKTATI
Sbjct  127  QIIKTATI  134



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 108/131 (82%), Gaps = 19/131 (15%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRK+KKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKVKKVKKSNGQM  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            LAINE                   SRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINE-------------------SRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  101

Query  574  HCIQIIKTATI  606
             CIQIIKTATI
Sbjct  102  PCIQIIKTATI  112



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            ++FHQYQVVGR LP+  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFE+ PT  KNYGIW+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGIWVRYQSRTGVHNMYKEYRDVTLNGSVSQMYQEMASRHRVRPSSI  126

Query  583  QIIKTATI  606
            QIIKTAT+
Sbjct  127  QIIKTATV  134



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATI
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATI  103



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATI
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATI  103



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATI
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATI  103



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATV  103



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWASNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATV  103



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            +++HQYQVVGR  P+  + +P +YRMK+WA + V AKSKFWYFLRKL++VKK+NGQVLA+
Sbjct  7    FKYHQYQVVGRHNPTTAEPNPTVYRMKVWAPDAVCAKSKFWYFLRKLRRVKKANGQVLAV  66

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFE+  T VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGA+ QMY EMASRHRVR+ CI
Sbjct  67   NEIFERKTTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAIGQMYGEMASRHRVRYPCI  126

Query  583  QIIKTATI  606
            Q+IKTAT+
Sbjct  127  QVIKTATV  134



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTAT  603
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVRH CIQIIKTAT
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTAT  102



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVR+HCIQIIKTATI
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRYHCIQIIKTATI  103



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  402
            ++FHQYQVVGR LP+  D  P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADATPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  403  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  582
            NEIFE+ PT  KNYG+W+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGVWVRYQSRTGVHNMYKEYRDVTLNGSVAQMYQEMASRHRVRPSSI  126

Query  583  QIIKTATI  606
            QIIKTAT+
Sbjct  127  QIIKTATV  134



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATV  103



>ref|XP_004144680.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=757

 Score =   217 bits (552),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 107/144 (74%), Positives = 115/144 (80%), Gaps = 19/144 (13%)
 Frame = +1

Query  211  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFW------------YFL  354
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFW            + L
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWCVVILSVDVSLSFXL  633

Query  355  RKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQ  534
                K+K + G       IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQ
Sbjct  634  VTCXKMKANKG-------IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQ  686

Query  535  MYTEMASRHRVRHHCIQIIKTATI  606
            MYTEMASRHRVR  CIQIIKTAT+
Sbjct  687  MYTEMASRHRVRCPCIQIIKTATV  710



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   201 bits (510),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATV  103



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATV  103



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   198 bits (503),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRY  462
            PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIWLRY
Sbjct  1    PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRY  60

Query  463  QSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            QSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  61   QSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQ  101



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  298  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  477
            MKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  478  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATI  606
            YHNMYKE+RDTTLNG VEQMYTEMASRHRVR  CIQIIKTAT+
Sbjct  61   YHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATV  103



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M   R+HQYQVVGR +P++    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            +A NEIFE   T VKN+GIW+RYQSRTGYHN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAAVDALYEEMASRHRVRA  120

Query  574  HCIQIIKTATI  606
             C+QIIK A +
Sbjct  121  SCLQIIKIAEV  131



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            +HQYQ+VGR +P+E +  P++YRMKLWA +  RA+SKFWYFL +L+KVKK+NGQ++A NE
Sbjct  38   YHQYQIVGRRVPTEQEPTPQVYRMKLWALDATRARSKFWYFLSRLRKVKKANGQIIACNE  97

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFEK  T VKNYG+W+RYQSR G+HN YKE+R+TT+N AV+ +YTEMASRHRVR H +QI
Sbjct  98   IFEKDDTTVKNYGVWIRYQSRVGFHNAYKEYRETTMNAAVDALYTEMASRHRVRSHALQI  157

Query  589  IKTATI  606
            IK A +
Sbjct  158  IKIAEV  163



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M  YR+ Q+QVVGR LP+E    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAPYRYRQFQVVGRHLPTEATPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            +A NEIFE+  T VKN+GIW+RYQSRTG+HN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYKEYRETTMNKAVDALYEEMASRHRVRS  120

Query  574  HCIQIIKTATI  606
              +QIIK A +
Sbjct  121  SQLQIIKIAEV  131



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   186 bits (473),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  381
            +V  +  +R+HQY +VGR +P++ D +P++YRMKLW+ ++ RAKSKFWYFL +LKKVKK+
Sbjct  1    MVKGLKPHRYHQYHIVGRHVPTDADPNPQVYRMKLWSLDDTRAKSKFWYFLSRLKKVKKA  60

Query  382  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  561
            NGQ++A NEIFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRH
Sbjct  61   NGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREISMNKAVDALYEEMASRH  120

Query  562  RVRHHCIQIIKTATI  606
            RVR  C+QIIK   +
Sbjct  121  RVRAPCLQIIKICQV  135



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = +1

Query  187  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  366
            + D S+ A+M     HQYQ+VGRA P+  +  PKIYRM+L+A N V AKS+FWYF++K+ 
Sbjct  6    KADASLQARM-----HQYQIVGRAAPTPKNPTPKIYRMRLFAKNAVLAKSRFWYFMKKIN  60

Query  367  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  546
            K K+S G++L +NE+F++ PTKVKNYGIWLRY+SRT  HNMYKEFRD T+NGAV Q+Y+E
Sbjct  61   KAKRSGGELLGVNELFDRAPTKVKNYGIWLRYESRTNTHNMYKEFRDVTINGAVSQLYSE  120

Query  547  MASRHRVRHHCIQIIKTATI  606
            MA RHR +   IQII T  +
Sbjct  121  MAGRHRAQPGSIQIIDTKVL  140



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            + Q+ +VGR +P++    P++YRMKLW+T++ RAKSKFWYFL +LKKVKK+NGQ+LA NE
Sbjct  13   YRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTRAKSKFWYFLSRLKKVKKANGQILACNE  72

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            IFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRHRVR  C+QI
Sbjct  73   IFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREVSMNKAVDALYEEMASRHRVRAPCLQI  132

Query  589  IKTATI  606
            IK A +
Sbjct  133  IKIAQV  138



>gb|KFH68950.1| 60S ribosomal protein L20 [Mortierella verticillata NRRL 6337]
Length=176

 Score =   178 bits (452),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            R H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ IN
Sbjct  3    RLHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGIN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EI EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQ
Sbjct  63   EIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQ  122

Query  586  IIKTATI  606
            II+ A +
Sbjct  123  IIRVAEV  129



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L+INE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSINE  63

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLNGA+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNGAIEQLYAELAGRHRARPRSIQI  123

Query  589  IKTATI  606
            ++TA +
Sbjct  124  MRTAIL  129



>gb|KFH68928.1| large subunit ribosomal protein L18Ae [Mortierella verticillata 
NRRL 6337]
Length=244

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ INE
Sbjct  72   LHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGINE  131

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQI
Sbjct  132  IHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQI  191

Query  589  IKTATI  606
            I+ A +
Sbjct  192  IRVAEV  197



>gb|KJB69797.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=145

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  346  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  525
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  12   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  71

Query  526  VEQMYTEMASRHRVRHHCIQIIKTATI  606
            VEQMYTEMASRHRVR  CIQIIKTATI
Sbjct  72   VEQMYTEMASRHRVRFPCIQIIKTATI  98



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQYQVVGR  P+E+D +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L +NE
Sbjct  4    IHQYQVVGRKAPTESDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILCLNE  63

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TL GAVEQMY E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAVEQMYAELAGRHRARPRSIQI  123

Query  589  IKTATI  606
            ++TA +
Sbjct  124  MRTAIL  129



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L++NE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSVNE  63

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLN A+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNSAIEQLYAELAGRHRARPRSIQI  123

Query  589  IKTATI  606
            ++TA +
Sbjct  124  MRTAIL  129



>ref|XP_006828776.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
 gb|ERM96192.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
Length=138

 Score =   171 bits (432),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  346  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  525
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  5    YFLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  64

Query  526  VEQMYTEMASRHRVRHHCIQIIKTATI  606
            VEQMY EMASRHRVR  CIQIIKTATI
Sbjct  65   VEQMYNEMASRHRVRSPCIQIIKTATI  91



>dbj|BAK07344.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  184  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  363
            S +   VVAKM   RF +Y ++GR+LP+E++  PK+YRM+++A N+V AKS+FWYFLR+L
Sbjct  11   SSKKECVVAKMA--RFTEYSILGRSLPTESEPTPKLYRMRIFAPNQVVAKSRFWYFLRQL  68

Query  364  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  543
            KKVKK+NG+++ +N I EK P KVKN+GIWLRY SR+G HNMYKEFR+ +  GAVE +Y 
Sbjct  69   KKVKKANGEIVGVNVIHEKRPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRVGAVEALYQ  128

Query  544  EMASRHRVRHHCIQIIKTATI  606
            ++A+RHR R   + I++ A I
Sbjct  129  DLAARHRARFRSVHILRVAEI  149



>gb|EGU11460.1| 60S ribosomal protein L20A [Rhodotorula glutinis ATCC 204091]
 gb|EMS20203.1| 60S ribosomal protein l20 [Rhodosporidium toruloides NP11]
 emb|CDR48607.1| RHTO0S19e00606g1_1 [Rhodosporidium toruloides]
Length=172

 Score =   171 bits (432),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            RF +YQV+GR LPS+ +  PK+YRM+++A NEV AKS+FWYFLRKL+KVKK+ G+V+A+N
Sbjct  3    RFQEYQVIGRKLPSDKEPQPKLYRMRIFAPNEVVAKSRFWYFLRKLRKVKKATGEVVAVN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
             I EK P KVKN+GIWLRY SR+G HNMYKEFR+ +   AV   Y +MA+RHR R   +Q
Sbjct  63   VISEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVHACYQDMAARHRARFRSVQ  122

Query  586  IIKTATI  606
            I++ A I
Sbjct  123  ILRVAEI  129



>gb|EPZ32213.1| 60S ribosomal protein L20-B [Rozella allomycis CSF55]
Length=178

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            M   ++H+YQ++GR LP+  +  P++Y+M+++A NEV  KS+FWYFL+KLKKVKK+NG++
Sbjct  1    MTESKYHEYQIIGRKLPTAAEPVPRLYKMRVFAKNEVVGKSRFWYFLQKLKKVKKANGEI  60

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            +A+NEIFEK P +VKNYGIWLRY SRTG HNMYKE+R+ +   AV   Y +MASRHR R 
Sbjct  61   VAVNEIFEKRPNQVKNYGIWLRYDSRTGTHNMYKEYREMSRVDAVHSCYQDMASRHRARF  120

Query  574  HCIQIIKTATI  606
              IQIIK   I
Sbjct  121  RSIQIIKVEEI  131



>ref|XP_002783609.1| 60S ribosomal protein L18A-2, putative [Perkinsus marinus ATCC 
50983]
 gb|EER15405.1| 60S ribosomal protein L18A-2, putative [Perkinsus marinus ATCC 
50983]
Length=184

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  217  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  396
            ++ + H YQ+VGRA PS  +  PKI+RMK++A N V AKSKFWY+++++ K K + G++L
Sbjct  8    ISMKMHLYQLVGRAAPSVKNPKPKIFRMKMFARNSVVAKSKFWYYMKRITKAKLTGGEML  67

Query  397  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  576
             I E FEK PT V NYGIWLRY SR+G HNMYKE+RDTTL GAV QMY EMA RHR    
Sbjct  68   GITECFEKHPTTVNNYGIWLRYDSRSGTHNMYKEYRDTTLTGAVGQMYQEMAGRHRALAS  127

Query  577  CIQIIKTATI  606
             +QIIKTAT+
Sbjct  128  NVQIIKTATL  137



>ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans 
JN3]
 emb|CBX97931.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans 
JN3]
Length=182

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  199  SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  378
            ++V +  + RF +YQ++GR LPSE +  PKIYRM+++A NEV AKS+FWYFL KL+K+KK
Sbjct  2    AMVVQKESARFQEYQIIGRHLPSEANPAPKIYRMRIFAPNEVVAKSRFWYFLGKLRKIKK  61

Query  379  SNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  558
            +NG+++++N+I EK P KVKN+GIW+RY SR+G HNMYKE+R+ +   AV+ +Y +MA+R
Sbjct  62   ANGEIVSVNQIHEKRPQKVKNFGIWIRYDSRSGTHNMYKEYREMSRVAAVDALYQDMAAR  121

Query  559  HRVRHHCIQIIKTATI  606
            HR R   +QI+K   I
Sbjct  122  HRSRFRSVQILKVVEI  137



>emb|CDS03349.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
Length=175

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK P ++KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+RHR R   +Q
Sbjct  63   EIFEKRPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAARHRARFSSVQ  122

Query  586  IIKTATI  606
            I++ A +
Sbjct  123  IMRVAEV  129



>emb|CDS14547.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
 emb|CDS04618.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
Length=175

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK P ++KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+RHR R   +Q
Sbjct  63   EIFEKRPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAARHRARFSSVQ  122

Query  586  IIKTATI  606
            I++ A +
Sbjct  123  IMRVAEV  129



>emb|CDH57447.1| 60s ribosomal protein l20 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=175

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EIFEK P ++KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+RHR R   +Q
Sbjct  63   EIFEKHPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAARHRARFSSVQ  122

Query  586  IIKTATI  606
            I++ A +
Sbjct  123  IMRVAEV  129



>gb|KDR72699.1| hypothetical protein GALMADRAFT_142989 [Galerina marginata CBS 
339.88]
Length=170

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              ++QVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEFQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+RHR R   I +
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAARHRARFRSIHV  122

Query  589  IKTATI  606
            ++   I
Sbjct  123  LRVVEI  128



>ref|XP_007394375.1| hypothetical protein PHACADRAFT_253712 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56529.1| hypothetical protein PHACADRAFT_253712 [Phanerochaete carnosa 
HHB-10118-sp]
Length=170

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              +YQVVGR LP+ETD +PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTETDPNPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKALYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   I
Sbjct  123  LRVVEI  128



>ref|XP_007415007.1| hypothetical protein MELLADRAFT_72927 [Melampsora larici-populina 
98AG31]
 gb|EGG01662.1| hypothetical protein MELLADRAFT_72927 [Melampsora larici-populina 
98AG31]
Length=172

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            RF +YQV+GR LPS+ D +PK+YRM+++A N+V AKS+FWY+LR+L+KVKK++G+++ IN
Sbjct  3    RFKEYQVIGRKLPSDKDPNPKLYRMRIFAPNDVVAKSRFWYYLRQLRKVKKASGEIVGIN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            +I EK P KVKN+GIWLRY SR+G HNMYKEFR+ +   AV   Y +MASRHR R   IQ
Sbjct  63   QIHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFREMSRADAVHACYQDMASRHRARFRSIQ  122

Query  586  IIKTATI  606
            +++ A I
Sbjct  123  VLRVAEI  129



>gb|KIK70034.1| hypothetical protein GYMLUDRAFT_34471 [Gymnopus luxurians FD-317 
M1]
Length=170

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKE+R+ +   AV+ MY +MA+RHR R   I I
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEYRELSRADAVKSMYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   I
Sbjct  123  LRVVEI  128



>gb|ERS97659.1| 60S ribosomal protein L20 [Sporothrix schenckii ATCC 58251]
Length=185

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            R H+YQV+GR LP+ET+  P +YRM+++A N V AKS+FWYFLR LKKVKK+ G+++A+N
Sbjct  14   RLHEYQVIGRHLPTETNPSPALYRMRIFAPNTVVAKSRFWYFLRGLKKVKKATGEIVAVN  73

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            EI EK P KVKN+GIWLRY SR+G HNMYKE+R+ +   A E +Y++MA+RHR R   I 
Sbjct  74   EISEKHPLKVKNFGIWLRYDSRSGTHNMYKEYRELSRTAAAESLYSDMAARHRARFRSIH  133

Query  586  IIKTATI  606
            I++   I
Sbjct  134  ILRVVEI  140



>ref|XP_007313367.1| hypothetical protein SERLADRAFT_456475 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO03354.1| hypothetical protein SERLA73DRAFT_174811 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO29125.1| hypothetical protein SERLADRAFT_456475 [Serpula lacrymans var. 
lacrymans S7.9]
Length=170

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P K+KN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IHEKKPLKIKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   I
Sbjct  123  LRVVEI  128



>gb|KJA26912.1| hypothetical protein HYPSUDRAFT_132230 [Hypholoma sublateritium 
FD-334 SS-4]
Length=170

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            F +YQVVGR LP+E +  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    FTEYQVVGRHLPTEAEPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   +
Sbjct  123  LRVIEV  128



>gb|EUC60950.1| 60S ribosomal protein L20 [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP50517.1| 60S ribosomal protein L20 [Rhizoctonia solani 123E]
Length=171

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  405
            RF++YQV+GR LP+  +E PK+YRM+++A NEV AKS+FWY+LR+LKKVKK+ G+++++N
Sbjct  3    RFNEYQVIGRKLPTAAEETPKLYRMRIFAPNEVVAKSRFWYYLRQLKKVKKATGEIVSVN  62

Query  406  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  585
            +I EK P K+KN+GIWLRY SR+G HNMYKEFR+ +   AV  +Y +MA+RHR R   IQ
Sbjct  63   KISEKSPLKIKNFGIWLRYDSRSGTHNMYKEFRELSRADAVHALYQDMAARHRARFRSIQ  122

Query  586  IIKTATI  606
            I++   I
Sbjct  123  ILRVQEI  129



>gb|KIO01130.1| hypothetical protein M404DRAFT_1003406 [Pisolithus tinctorius 
Marx 270]
Length=170

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I+EK P KVKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IYEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   +
Sbjct  123  LRVVEL  128



>gb|KIL64760.1| hypothetical protein M378DRAFT_77817 [Amanita muscaria Koide 
BX008]
Length=170

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+V+A+N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEVIAVNT  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P K+K +GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IQEKRPLKIKIFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   +
Sbjct  123  LRVVEV  128



>ref|XP_007717889.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13]
 gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13]
 gb|EUN23340.1| hypothetical protein COCVIDRAFT_29773 [Bipolaris victoriae FI3]
Length=191

 Score =   169 bits (428),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  214  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  393
            ++  RF +YQ++GR LPSE +  PKIYRM+++A NEV AKS+FWYFL KL+K+KK+NG++
Sbjct  16   VLNPRFQEYQIIGRHLPSEANPAPKIYRMRIFAPNEVVAKSRFWYFLGKLRKIKKANGEI  75

Query  394  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  573
            +++N+I EK P KVKN+GIW++Y SR+G HNMYKE+R+ +   AVE +Y +MA+RHR R 
Sbjct  76   VSVNQIHEKKPQKVKNFGIWIKYDSRSGTHNMYKEYREMSRVAAVEALYQDMAARHRTRF  135

Query  574  HCIQIIKTATI  606
              +QI+K   +
Sbjct  136  RSVQILKVVEV  146



>ref|XP_001614192.1| 60S ribosomal protein L18a [Plasmodium vivax Sal-1]
 gb|EDL44465.1| 60S ribosomal protein L18a, putative [Plasmodium vivax]
Length=184

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
             HQY +VGRA+P+E D++P +YRM ++A N+  AKS+FWYF++K+ K+KKSNG++LA  +
Sbjct  13   IHQYHIVGRAIPTEKDKNPNVYRMCIFAKNDTNAKSRFWYFMKKINKLKKSNGELLACEQ  72

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I E+ P +VKNYG+ LRY SRTG HNMYKEFRDTT  GA+ Q+Y+EMA RHR R   I +
Sbjct  73   IRERFPLRVKNYGVLLRYDSRTGTHNMYKEFRDTTKEGAIAQLYSEMAGRHRARASSISV  132

Query  589  IKTATI  606
            I+ + I
Sbjct  133  IRISEI  138



>gb|KDQ32854.1| hypothetical protein PLEOSDRAFT_1051744 [Pleurotus ostreatus 
PC15]
Length=170

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
              ++QVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEFQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   I
Sbjct  123  LRVVEI  128



>ref|XP_003029116.1| 60S ribosomal protein L20 [Schizophyllum commune H4-8]
 gb|EFI94213.1| hypothetical protein SCHCODRAFT_83207 [Schizophyllum commune 
H4-8]
Length=171

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  229  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  408
            F +YQVVGR LP+E D +PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    FVEYQVVGRHLPTEQDPNPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  409  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  588
            I EK P KVKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+RHR R   I I
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRTAAVKSLYQDMAARHRARFRSIHI  122

Query  589  IKTATI  606
            ++   +
Sbjct  123  LRVVEV  128



>ref|XP_003617398.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=147

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  346  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  525
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  14   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  73

Query  526  VEQMYTEMASRHRVRHHCIQIIKTATI  606
            VE MY EMASRHRVR  CIQIIKTATI
Sbjct  74   VETMYNEMASRHRVRFPCIQIIKTATI  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800