BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006F06 630 bp,

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              369   3e-127   Sesamum indicum [beniseed]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         367   1e-126   Cucumis sativus [cucumbers]
ref|NP_001275235.1|  uncharacterized protein LOC102577830               364   2e-125   Solanum tuberosum [potatoes]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                364   3e-125   Erythranthe guttata [common monkey flower]
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         363   5e-125   Sesamum indicum [beniseed]
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 363   6e-125   Ricinus communis
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              362   1e-124   Solanum lycopersicum
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              362   1e-124   Solanum lycopersicum
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         362   2e-124   Jatropha curcas
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              362   2e-124   Eucalyptus grandis [rose gum]
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         362   2e-124   Nicotiana tomentosiformis
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         362   2e-124   Jatropha curcas
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              361   3e-124   Nicotiana tomentosiformis
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                360   8e-124   Erythranthe guttata [common monkey flower]
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    360   1e-123   Solanum tuberosum [potatoes]
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 359   3e-123   Ricinus communis
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 359   3e-123   Ricinus communis
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                359   3e-123   Erythranthe guttata [common monkey flower]
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    358   4e-123   Populus euphratica
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    358   5e-123   Solanum tuberosum [potatoes]
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         358   7e-123   Eucalyptus grandis [rose gum]
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             357   1e-122   Populus trichocarpa [western balsam poplar]
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    357   3e-122   Solanum tuberosum [potatoes]
ref|XP_010091216.1|  40S ribosomal protein S9-2                         356   4e-122   Morus notabilis
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    356   4e-122   Populus euphratica
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         355   6e-122   Populus euphratica
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             355   7e-122   Populus trichocarpa [western balsam poplar]
gb|AFK46709.1|  unknown                                                 355   8e-122   Lotus japonicus
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         355   1e-121   Nelumbo nucifera [Indian lotus]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              353   3e-121   Sesamum indicum [beniseed]
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             353   3e-121   Phaseolus vulgaris [French bean]
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         353   6e-121   Nicotiana sylvestris
emb|CDP02222.1|  unnamed protein product                                353   7e-121   Coffea canephora [robusta coffee]
gb|ACU15321.1|  unknown                                                 354   7e-121   Glycine max [soybeans]
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              352   9e-121   Nicotiana sylvestris
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              352   9e-121   Vitis vinifera
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         352   1e-120   Cicer arietinum [garbanzo]
gb|ABK21901.1|  unknown                                                 352   1e-120   Picea sitchensis
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         352   2e-120   Nicotiana sylvestris
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              352   2e-120   Nelumbo nucifera [Indian lotus]
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       351   3e-120   Artemisia annua [sweet Annie]
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         351   3e-120   Nicotiana tomentosiformis
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         351   4e-120   Nicotiana tomentosiformis
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              350   7e-120   Eucalyptus grandis [rose gum]
gb|EPS73776.1|  hypothetical protein M569_00980                         350   8e-120   Genlisea aurea
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              350   1e-119   Phoenix dactylifera
gb|KJB74899.1|  hypothetical protein B456_012G055000                    349   2e-119   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    349   2e-119   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    349   2e-119   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        349   2e-119   Gossypium arboreum [tree cotton]
ref|XP_007037295.1|  Ribosomal protein S4                               349   2e-119   Theobroma cacao [chocolate]
gb|KJB11057.1|  hypothetical protein B456_001G238700                    348   3e-119   Gossypium raimondii
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             348   3e-119   Capsella rubella
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              348   4e-119   Camelina sativa [gold-of-pleasure]
emb|CDP00311.1|  unnamed protein product                                348   5e-119   Coffea canephora [robusta coffee]
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         347   9e-119   Brachypodium distachyon [annual false brome]
gb|ABR17162.1|  unknown                                                 347   1e-118   Picea sitchensis
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         347   1e-118   Glycine max [soybeans]
ref|XP_007032505.1|  Ribosomal protein S4                               347   1e-118   Theobroma cacao [chocolate]
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             347   2e-118   Phaseolus vulgaris [French bean]
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              347   2e-118   Elaeis guineensis
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    346   4e-118   Glycine max [soybeans]
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    346   4e-118   Arabis alpina [alpine rockcress]
ref|XP_002870751.1|  40S ribosomal protein S9                           346   5e-118   Arabidopsis lyrata subsp. lyrata
emb|CAG47084.1|  40S ribosomal protein S9                               345   5e-118   Catharanthus roseus [chatas]
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         345   6e-118   Brachypodium distachyon [annual false brome]
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             345   9e-118   Eutrema salsugineum
ref|NP_198801.1|  40S ribosomal protein S9-2                            345   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             345   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         344   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     343   1e-117   Eucalyptus grandis [rose gum]
ref|NP_001238740.1|  uncharacterized protein LOC100305663               344   2e-117   Glycine max [soybeans]
ref|NP_001049004.1|  Os03g0154700                                       344   2e-117   
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             344   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2              344   2e-117   Vitis vinifera
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             344   2e-117   Prunus persica
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   4e-117   Cicer arietinum [garbanzo]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              343   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   5e-117   Fragaria vesca subsp. vesca
ref|NP_001131442.1|  uncharacterized protein LOC100192774               342   1e-116   Zea mays [maize]
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         342   1e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              342   2e-116   Tarenaya hassleriana [spider flower]
ref|XP_003598026.1|  40S ribosomal protein S9                           342   2e-116   Medicago truncatula
gb|AFK40975.1|  unknown                                                 342   2e-116   Medicago truncatula
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like         341   2e-116   Oryza brachyantha
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              341   4e-116   Brachypodium distachyon [annual false brome]
ref|NP_001278530.1|  40S ribosomal protein S9                           340   5e-116   Zea mays [maize]
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         340   6e-116   Setaria italica
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         340   1e-115   Elaeis guineensis
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg             339   1e-115   Prunus persica
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          339   2e-115   Sorghum bicolor [broomcorn]
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like         339   2e-115   Oryza brachyantha
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         339   2e-115   Oryza brachyantha
ref|XP_001754369.1|  predicted protein                                  339   3e-115   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  339   3e-115   Physcomitrella patens
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              338   3e-115   Fragaria vesca subsp. vesca
gb|ACG33443.1|  40S ribosomal protein S9                                338   3e-115   Zea mays [maize]
gb|EMS50632.1|  40S ribosomal protein S9-2                              338   3e-115   Triticum urartu
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         338   4e-115   Elaeis guineensis
ref|XP_001777561.1|  predicted protein                                  338   6e-115   Physcomitrella patens
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              338   6e-115   Malus domestica [apple tree]
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like         337   7e-115   Setaria italica
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              337   9e-115   Malus domestica [apple tree]
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             337   1e-114   Citrus clementina
ref|XP_001754496.1|  predicted protein                                  337   1e-114   Physcomitrella patens
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              337   1e-114   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAT08735.1|  40S ribosomal protein S9                                337   1e-114   Hyacinthus orientalis [common hyacinth]
ref|NP_001149705.1|  40S ribosomal protein S9                           337   1e-114   Zea mays [maize]
ref|XP_003623232.1|  40S ribosomal protein S9                           337   1e-114   Medicago truncatula
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              337   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         337   2e-114   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             336   2e-114   Eutrema salsugineum
ref|NP_197024.1|  40S ribosomal protein S9-1                            336   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             336   3e-114   Capsella rubella
ref|XP_010092050.1|  40S ribosomal protein S9-2                         339   3e-114   Morus notabilis
ref|XP_002873713.1|  40S ribosomal protein S9                           335   6e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263             335   7e-114   Selaginella moellendorffii
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120          335   8e-114   Sorghum bicolor [broomcorn]
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080          335   8e-114   Sorghum bicolor [broomcorn]
ref|XP_003637511.1|  40S ribosomal protein S9                           336   9e-114   
ref|XP_003562635.1|  PREDICTED: 40S ribosomal protein S9-2-like         334   1e-113   Brachypodium distachyon [annual false brome]
gb|ABA94602.1|  40S ribosomal protein S9, putative, expressed           333   2e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              333   3e-113   Brassica rapa
emb|CDX74423.1|  BnaA04g09660D                                          333   3e-113   Brassica napus [oilseed rape]
ref|XP_006657990.1|  PREDICTED: 40S ribosomal protein S9-2-like         333   4e-113   Oryza brachyantha
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          334   5e-113   
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              333   6e-113   Brassica rapa
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like         332   7e-113   Setaria italica
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302              332   7e-113   Selaginella moellendorffii
gb|EMS59613.1|  40S ribosomal protein S9-2                              332   1e-112   Triticum urartu
dbj|BAJ90873.1|  predicted protein                                      332   2e-112   Hordeum vulgare subsp. vulgare [barley]
ref|XP_001762390.1|  predicted protein                                  330   5e-112   Physcomitrella patens
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        329   1e-111   Gossypium arboreum [tree cotton]
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                    328   2e-111   Arabis alpina [alpine rockcress]
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        328   4e-111   Gossypium arboreum [tree cotton]
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         328   5e-111   Jatropha curcas
gb|EEC74543.1|  hypothetical protein OsI_10067                          328   9e-110   Oryza sativa Indica Group [Indian rice]
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        326   2e-109   Gossypium arboreum [tree cotton]
ref|XP_009126038.1|  PREDICTED: 40S ribosomal protein S9-1-like         322   7e-109   Brassica rapa
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    321   2e-108   Chlamydomonas reinhardtii
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    320   4e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010550058.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   5e-108   Tarenaya hassleriana [spider flower]
ref|XP_010545191.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   5e-108   Tarenaya hassleriana [spider flower]
ref|XP_010551858.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   6e-108   Tarenaya hassleriana [spider flower]
gb|ADB77797.1|  40S ribosomal protein S9                                319   7e-108   Chlamydomonas reinhardtii
gb|KHN30826.1|  40S ribosomal protein S9-2                              319   1e-107   Glycine soja [wild soybean]
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    319   1e-107   Volvox carteri f. nagariensis
ref|XP_010524330.1|  PREDICTED: 40S ribosomal protein S9-2-like         319   2e-107   Tarenaya hassleriana [spider flower]
emb|CDY30273.1|  BnaC04g31840D                                          335   5e-105   Brassica napus [oilseed rape]
gb|EAY83173.1|  hypothetical protein OsI_38384                          306   6e-103   Oryza sativa Indica Group [Indian rice]
gb|KIZ06357.1|  40S ribosomal protein S9-2                              307   7e-103   Monoraphidium neglectum
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              304   9e-102   Chlorella variabilis
ref|XP_006431128.1|  hypothetical protein CICLE_v10013599mg             303   4e-101   Citrus clementina
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           302   5e-101   Ostreococcus tauri
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    300   3e-100   Coccomyxa subellipsoidea C-169
ref|XP_002500609.1|  predicted protein                                  300   5e-100   Micromonas commoda
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    299   8e-100   Ostreococcus lucimarinus CCE9901
ref|XP_003056784.1|  predicted protein                                  299   8e-100   Micromonas pusilla CCMP1545
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    299   1e-99    
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980          298   1e-99    Sorghum bicolor [broomcorn]
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             297   3e-99    Populus trichocarpa [western balsam poplar]
gb|EAY83171.1|  hypothetical protein OsI_38381                          292   6e-97    Oryza sativa Indica Group [Indian rice]
gb|KCW56188.1|  hypothetical protein EUGRSUZ_I01938                     286   5e-95    Eucalyptus grandis [rose gum]
gb|KIZ02547.1|  40S ribosomal protein S9-2                              286   3e-94    Monoraphidium neglectum
dbj|BAA78592.1|  40S ribosomal protein S9                               285   5e-94    Chlamydomonas sp. HS-5
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             283   7e-94    Citrus clementina
ref|XP_011399104.1|  40S ribosomal protein S9-1                         282   4e-93    Auxenochlorella protothecoides
ref|XP_005708491.1|  40S ribosomal protein S9e                          280   5e-92    Galdieria sulphuraria
ref|XP_008808061.1|  PREDICTED: 40S ribosomal protein S9-2-like         277   1e-91    Phoenix dactylifera
gb|ADB77798.1|  40S ribosomal protein S9                                277   3e-91    Cladophora coelothrix
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       277   3e-91    Rhizophagus irregularis DAOM 197198w
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  277   4e-91    Rhizophagus irregularis DAOM 181602
gb|KCW87774.1|  hypothetical protein EUGRSUZ_A00153                     275   4e-91    Eucalyptus grandis [rose gum]
ref|XP_003609048.1|  40S ribosomal protein S9                           277   5e-91    
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       276   7e-91    Rhizophagus irregularis DAOM 197198w
gb|EGD95527.1|  ribosomal protein S9                                    275   2e-90    Trichophyton tonsurans CBS 112818
gb|KDD75683.1|  hypothetical protein H632_c551p0                        275   5e-90    Helicosporidium sp. ATCC 50920
ref|XP_003172904.1|  40S ribosomal protein S9                           274   6e-90    Microsporum gypseum CBS 118893
ref|XP_003237660.1|  40S ribosomal protein S9                           274   8e-90    Trichophyton rubrum CBS 118892
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894             273   1e-89    Helobdella robusta
ref|XP_002842953.1|  40S ribosomal protein S9                           273   2e-89    Arthroderma otae CBS 113480
ref|XP_003026421.1|  40S ribosomal protein S9                           273   2e-89    Schizophyllum commune H4-8
gb|KCW56192.1|  hypothetical protein EUGRSUZ_I01938                     271   3e-89    Eucalyptus grandis [rose gum]
ref|XP_004336000.1|  ribosomal protein S4, putative                     272   3e-89    Acanthamoeba castellanii str. Neff
ref|XP_002110068.1|  S9 ribosomal protein                               272   4e-89    Trichoplax adhaerens
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      272   4e-89    Lichtheimia ramosa
ref|XP_002367195.1|  40S ribosomal protein S9, putative                 271   8e-89    Toxoplasma gondii ME49
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   271   9e-89    Jaapia argillacea MUCL 33604
gb|AGH70193.1|  40S ribosomal protein S9                                271   1e-88    Placozoa sp. H4
ref|XP_001824638.1|  40S ribosomal protein S9                           271   1e-88    Aspergillus oryzae RIB40
emb|CBN76630.1|  conserved unknown protein                              271   1e-88    Ectocarpus siliculosus
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                  270   1e-88    Neospora caninum Liverpool
ref|XP_002629546.1|  40S ribosomal protein S9                           270   2e-88    Blastomyces gilchristii SLH14081
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               270   2e-88    Aspergillus nidulans FGSC A4
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             270   3e-88    Heterobasidion irregulare TC 32-1
dbj|BAN20249.1|  ribosomal protein S9                                   270   3e-88    Riptortus pedestris
ref|XP_007860645.1|  ribosomal protein S4                               270   3e-88    Gloeophyllum trabeum ATCC 11539
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative             270   3e-88    Babesia bigemina
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      269   4e-88    Cordyceps militaris CM01
ref|XP_011115175.1|  hypothetical protein H072_9617                     269   4e-88    Dactylellina haptotyla CBS 200.50
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745              270   4e-88    Emiliania huxleyi CCMP1516
emb|CDH55798.1|  40s ribosomal protein s9                               269   5e-88    Lichtheimia corymbifera JMRC:FSU:9682
gb|KIY51995.1|  ribosomal protein S4                                    269   5e-88    Fistulina hepatica ATCC 64428
ref|XP_001609790.1|  40S ribosomal subunit protein S9                   269   6e-88    Babesia bovis T2Bo
gb|KIM31691.1|  hypothetical protein M408DRAFT_236801                   269   6e-88    Serendipita vermifera MAFF 305830
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    269   6e-88    Trichoderma reesei QM6a
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121                268   9e-88    Arthrobotrys oligospora ATCC 24927
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                269   9e-88    Bactrocera cucurbitae [melon fruit fly]
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           268   1e-87    Ceratitis capitata
emb|CDO74409.1|  hypothetical protein BN946_scf184867.g7                268   1e-87    Trametes cinnabarina
ref|XP_008032443.1|  40S ribosomal protein S9                           268   1e-87    Trametes versicolor FP-101664 SS1
ref|XP_007360763.1|  40S ribosomal protein S9                           268   1e-87    Dichomitus squalens LYAD-421 SS1
gb|AET50489.1|  hypothetical protein                                    268   2e-87    Eimeria tenella
gb|AAX62465.1|  ribosomal protein S9                                    268   2e-87    Lysiphlebus testaceipes
ref|XP_010274527.1|  PREDICTED: 40S ribosomal protein S9-2-like         269   2e-87    Nelumbo nucifera [Indian lotus]
emb|CDJ32982.1|  40S ribosomal protein S9, putative                     268   2e-87    Eimeria mitis
emb|CAH04322.1|  S9e ribosomal protein                                  268   2e-87    Meladema coriacea
emb|CDI78299.1|  40S ribosomal protein S9, putative                     268   2e-87    Eimeria acervulina
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9                268   2e-87    Microplitis demolitor
gb|EMD42348.1|  40S ribosomal protein S9                                268   2e-87    Gelatoporia subvermispora B
ref|XP_001400515.1|  40S ribosomal protein S9                           267   3e-87    Aspergillus niger CBS 513.88
ref|XP_001263755.1|  40S ribosomal protein S9                           267   3e-87    Aspergillus fischeri NRRL 181
ref|XP_001217311.1|  40S ribosomal protein S9                           267   3e-87    Aspergillus terreus NIH2624
gb|EKC97706.1|  40S ribosomal protein S9-A                              267   3e-87    Trichosporon asahii var. asahii CBS 8904
ref|XP_008623589.1|  40S ribosomal protein                              267   3e-87    Plasmodium vinckei vinckei
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                267   3e-87    Ceratosolen solmsi marchali
ref|XP_001984182.1|  GH15146                                            267   3e-87    Drosophila grimshawi
gb|ETB62408.1|  40S ribosomal protein S9                                267   4e-87    Plasmodium yoelii 17X
emb|CCA67900.1|  probable 40S ribosomal protein S9                      267   4e-87    Serendipita indica DSM 11827
gb|ABX26127.1|  ribosomal protein S9                                    267   4e-87    Haliotis discus discus
emb|CAJ17220.1|  ribosomal protein S9e                                  267   4e-87    Sphaerius sp. APV-2005
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9                 266   5e-87    Drosophila yakuba
ref|XP_001956309.1|  GF24655                                            266   6e-87    Drosophila ananassae
ref|XP_001270715.1|  40S ribosomal protein S9                           266   6e-87    Aspergillus clavatus NRRL 1
ref|XP_002047289.1|  GJ13353                                            266   6e-87    Drosophila virilis
ref|NP_524004.2|  ribosomal protein S9, isoform A                       266   6e-87    Drosophila melanogaster
gb|ACO10247.1|  40S ribosomal protein S9                                266   7e-87    Caligus rogercresseyi
ref|XP_001352621.1|  GA28351                                            266   8e-87    Drosophila pseudoobscura pseudoobscura
emb|CCQ18585.1|  40S ribosomal protein S9                               266   9e-87    Sycon ciliatum
gb|ADT80642.1|  ribosomal protein S9                                    266   9e-87    Euphydryas aurinia [marsh fritillary]
gb|ADO95157.1|  ribosomal protein S9                                    266   1e-86    Antheraea yamamai [Japanese oak silk moth]
ref|NP_001037265.1|  ribosomal protein S9                               266   1e-86    Bombyx mori [silk moth]
emb|CDJ50108.1|  40S ribosomal protein S9, putative                     266   1e-86    Eimeria brunetti
ref|XP_005181976.1|  PREDICTED: 40S ribosomal protein S9                266   1e-86    Musca domestica
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like           266   1e-86    Astyanax mexicanus [blind cave fish]
dbj|BAM17690.1|  ribosomal protein S9                                   266   1e-86    Papilio xuthus [Chinese swallowtail]
emb|CDS49582.1|  40S ribosomal protein S9, putative                     265   1e-86    Plasmodium berghei ANKA
gb|EHJ71338.1|  ribosomal protein S9                                    266   1e-86    Danaus plexippus [American monarch]
ref|XP_001945527.1|  PREDICTED: 40S ribosomal protein S9                266   1e-86    Acyrthosiphon pisum
ref|XP_001351758.1|  40S ribosomal protein S9, putative                 265   2e-86    Plasmodium falciparum 3D7
ref|XP_003400837.1|  PREDICTED: 40S ribosomal protein S9-like           265   2e-86    
dbj|BAM19012.1|  ribosomal protein S9                                   265   2e-86    Papilio polytes
ref|XP_001613757.1|  40S ribosomal protein S9                           265   2e-86    Plasmodium vivax Sal-1
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                  265   2e-86    Trichoderma virens Gv29-8
emb|CDO63078.1|  40S ribosomal protein S9, putative                     265   2e-86    Plasmodium reichenowi
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9                 265   2e-86    Spadella cephaloptera
gb|KDR16262.1|  40S ribosomal protein S9                                265   2e-86    Zootermopsis nevadensis
gb|ACO15505.1|  40S ribosomal protein S9                                265   2e-86    Caligus clemensi
gb|ABG01896.1|  S9 ribosomal protein                                    265   2e-86    Gryllus firmus
ref|XP_002007973.1|  GI12083                                            265   2e-86    Drosophila mojavensis
ref|XP_008815169.1|  40S ribosomal protein                              265   2e-86    Plasmodium inui San Antonio 1
emb|CCF75909.1|  unnamed protein product                                265   3e-86    Babesia microti strain RI
gb|KDQ15631.1|  hypothetical protein BOTBODRAFT_31523                   265   3e-86    Botryobasidium botryosum FD-172 SS1
ref|XP_002119507.1|  PREDICTED: 40S ribosomal protein S9                265   3e-86    Ciona intestinalis [sea vase]
gb|ACO12686.1|  40S ribosomal protein S9                                265   3e-86    Lepeophtheirus salmonis
ref|XP_001894478.1|  40S ribosomal protein S9                           265   3e-86    Brugia malayi [agent of lymphatic filariasis]
ref|XP_004222815.1|  40S ribosomal protein S9                           265   3e-86    Plasmodium cynomolgi strain B
gb|ADO28208.1|  40S ribosomal protein s9                                265   3e-86    Ictalurus furcatus
ref|NP_001187074.1|  40S ribosomal protein S9                           265   3e-86    Ictalurus punctatus
gb|ACY95323.1|  ribosomal protein S9                                    265   3e-86    Manduca sexta [Carolina sphinx]
ref|XP_003147914.1|  40S ribosomal protein S9                           265   4e-86    Loa loa
gb|ACY71248.1|  ribosomal protein S9                                    265   4e-86    Chrysomela tremula
gb|ADK11698.1|  ribosomal protein S9                                    263   5e-86    Oncorhynchus masou rhodurus
ref|XP_967635.1|  PREDICTED: 40S ribosomal protein S9                   264   5e-86    Tribolium castaneum [rust-red flour beetle]
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like           264   5e-86    
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like           264   5e-86    Alligator sinensis
emb|CEI90627.1|  Putative 40S ribosomal protein S9                      264   5e-86    Rhizopus microsporus
tpg|DAA41535.1|  TPA: hypothetical protein ZEAMMB73_424707              266   6e-86    Zea mays [maize]
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9                264   6e-86    
gb|EER45719.1|  40S ribosomal protein S9                                264   6e-86    
ref|NP_957146.1|  40S ribosomal protein S9                              264   6e-86    
ref|XP_002259613.1|  40S ribosomal subunit protein S9                   264   7e-86    
ref|XP_008601048.1|  40S ribosomal protein S9                           263   7e-86    
ref|XP_003387673.1|  PREDICTED: 40S ribosomal protein S9-like           264   8e-86    
gb|AAT76788.1|  40S ribosomal protein S9                                264   8e-86    
ref|XP_007510860.1|  40S ribosomal protein S9                           265   9e-86    
gb|AHB33642.1|  40S ribosomal protein S9                                263   9e-86    
gb|AGM32374.1|  putative S9e ribosomal protein                          263   1e-85    
tpg|DAA55417.1|  TPA: hypothetical protein ZEAMMB73_005048              262   1e-85    
dbj|BAJ85708.1|  predicted protein                                      263   1e-85    
gb|ACO11706.1|  40S ribosomal protein S9                                263   1e-85    
gb|AAS49601.1|  ribosomal protein S9                                    263   1e-85    
emb|CDQ94630.1|  unnamed protein product                                263   1e-85    
dbj|BAD26701.1|  ribosomal protein S9                                   263   1e-85    
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...    263   1e-85    
ref|XP_011066131.1|  PREDICTED: 40S ribosomal protein S9                263   1e-85    
gb|ABM55670.1|  putative ribosomal protein S9                           263   1e-85    
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9                263   1e-85    
ref|XP_002603611.1|  hypothetical protein BRAFLDRAFT_126921             263   1e-85    
ref|XP_003977663.1|  PREDICTED: 40S ribosomal protein S9-like           263   1e-85    
ref|XP_011144040.1|  PREDICTED: 40S ribosomal protein S9                263   2e-85    
ref|XP_011445733.1|  PREDICTED: 40S ribosomal protein S9                262   2e-85    
ref|XP_005534862.1|  40S ribosomal protein S9                           263   2e-85    
ref|NP_001232711.1|  putative 40S ribosomal protein S9                  263   2e-85    
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9                263   2e-85    
gb|AAY66962.1|  40S ribosomal protein S9                                262   2e-85    
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like           263   2e-85    
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like           263   2e-85    
ref|XP_007811695.1|  40S ribosomal protein S9                           262   2e-85    
ref|XP_791000.2|  PREDICTED: 40S ribosomal protein S9-like              262   3e-85    
ref|XP_010786813.1|  PREDICTED: 40S ribosomal protein S9                262   3e-85    
gb|AEE62422.1|  unknown                                                 262   3e-85    
gb|AAX29348.1|  ribosomal protein S9                                    262   3e-85    
gb|ABF94049.1|  40S ribosomal protein S9, putative, expressed           261   3e-85    
ref|NP_001004.2|  40S ribosomal protein S9                              262   3e-85    
gb|AAX48885.1|  S9                                                      262   3e-85    
gb|KIY62147.1|  ribosomal protein S4                                    262   3e-85    
gb|EIE83578.1|  40S ribosomal protein S9                                262   3e-85    
ref|XP_001625568.1|  predicted protein                                  262   3e-85    
emb|CAA47013.1|  ribosomal protein S9                                   262   3e-85    
gb|ABA94598.1|  40S ribosomal protein S9, putative, expressed           261   4e-85    
gb|KFG83429.1|  40S ribosomal protein S9 (S7)                           262   4e-85    
gb|AEA39492.1|  ribosomal protein S9                                    262   4e-85    
gb|EMP40612.1|  40S ribosomal protein S9                                263   4e-85    
ref|XP_002430661.1|  40S ribosomal protein S9, putative                 261   5e-85    
ref|NP_001290865.1|  ribosomal protein S9                               261   5e-85    
ref|XP_005312659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    261   5e-85    
gb|ACH85276.1|  ribosomal protein S9                                    261   5e-85    
emb|CEG69035.1|  Putative 40S ribosomal protein S9                      261   6e-85    
ref|NP_001006813.1|  ribosomal protein S9                               261   6e-85    
ref|NP_001085809.1|  ribosomal protein S9                               261   6e-85    
gb|ABD98740.1|  putative S9e ribosomal protein                          261   7e-85    
ref|XP_003450729.1|  PREDICTED: 40S ribosomal protein S9-like           261   7e-85    
ref|XP_001829481.1|  40S ribosomal protein S9                           261   8e-85    
ref|XP_002416200.1|  40S ribosomal protein S9, putative                 261   8e-85    
gb|KFB48005.1|  40S ribosomal protein S9                                261   8e-85    
ref|NP_001080124.1|  ribosomal protein S9                               261   9e-85    
ref|XP_004830832.1|  40S ribosomal protein S9, putative                 261   9e-85    
ref|XP_533590.3|  PREDICTED: 40S ribosomal protein S9                   262   1e-84    
ref|XP_007439934.1|  PREDICTED: 40S ribosomal protein S9-like iso...    261   1e-84    
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                  261   1e-84    
gb|EPY49628.1|  40S ribosomal protein S9                                261   1e-84    
gb|EQL04090.1|  Ribosomal protein S4/S9                                 260   1e-84    
tpg|DAA63723.1|  TPA: hypothetical protein ZEAMMB73_488320              263   1e-84    
ref|XP_001653969.1|  AAEL001759-PA                                      260   2e-84    
ref|XP_008486802.1|  PREDICTED: 40S ribosomal protein S9                260   2e-84    
ref|XP_001747599.1|  hypothetical protein                               260   2e-84    
gb|EIE83453.1|  40S ribosomal protein S9                                260   2e-84    
gb|ABG01900.1|  S9 ribosomal protein                                    259   2e-84    
ref|XP_009045417.1|  hypothetical protein LOTGIDRAFT_230231             260   2e-84    
gb|ACF72878.1|  ribosomal protein S9                                    260   2e-84    
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                    260   2e-84    
gb|KFM58001.1|  40S ribosomal protein S9                                260   2e-84    
ref|XP_002741225.1|  PREDICTED: 40S ribosomal protein S9-like           260   2e-84    
gb|AAW31599.1|  ribosomal protein S9                                    260   2e-84    
ref|XP_007002505.1|  40S ribosomal protein S9                           260   2e-84    
gb|ABX44781.1|  putative 40S ribosomal protein RPS9                     260   2e-84    
ref|XP_007307288.1|  40S ribosomal protein S9                           259   3e-84    
ref|XP_004077978.1|  PREDICTED: 40S ribosomal protein S9                260   3e-84    
ref|XP_009038600.1|  hypothetical protein AURANDRAFT_28757              260   3e-84    
ref|XP_313936.2|  AGAP005061-PB                                         259   3e-84    
ref|XP_005852611.1|  small subunit ribosomal protein S9e                260   3e-84    
dbj|BAA82319.1|  ribosomal protein S9 homolog                           259   3e-84    
ref|XP_001846568.1|  conserved hypothetical protein                     259   3e-84    
ref|XP_003325266.1|  40S ribosomal protein S9                           259   4e-84    
gb|AFK33393.1|  unknown                                                 259   4e-84    
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                  259   4e-84    
ref|XP_007391198.1|  hypothetical protein PHACADRAFT_248675             259   4e-84    
ref|XP_004363804.1|  30S ribosomal protein S4                           259   4e-84    
gb|ACD65142.1|  putative 40S ribosomal protein RPS9                     259   4e-84    
ref|NP_595840.1|  40S ribosomal protein S9                              259   4e-84    
gb|ACI68776.1|  40S ribosomal protein S9                                259   5e-84    
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                  259   5e-84    
gb|ETE72572.1|  40S ribosomal protein S9                                259   5e-84    
ref|XP_005880022.1|  PREDICTED: 40S ribosomal protein S9 isoform X1     259   5e-84    
ref|XP_008116661.1|  PREDICTED: 40S ribosomal protein S9                259   5e-84    
ref|XP_003194223.1|  40S ribosomal protein S9-A                         259   6e-84    
ref|XP_730059.1|  ribosomal protein S4                                  259   6e-84    
gb|EJK71823.1|  hypothetical protein THAOC_06697                        259   6e-84    
gb|ETN81469.1|  ribosomal protein S4                                    259   6e-84    
ref|XP_007853601.1|  40s ribosomal protein s9                           259   6e-84    
ref|XP_005836916.1|  small subunit ribosomal protein S9e, cytopla...    258   7e-84    
ref|XP_004341959.2|  40S ribosomal protein S9                           258   8e-84    
gb|ABW23205.1|  ribosomal protein rps9                                  258   8e-84    
ref|NP_592945.1|  40S ribosomal protein S9                              258   8e-84    
ref|XP_007265130.1|  40S ribosomal protein S9                           258   9e-84    
gb|KIK68304.1|  hypothetical protein GYMLUDRAFT_35690                   258   9e-84    
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                  258   9e-84    
gb|AEC11023.1|  40S ribosomal protein s9                                257   9e-84    
ref|XP_002289706.1|  RS9, ribosomal protein 9                           258   9e-84    
gb|AAS49576.1|  ribosomal protein S9                                    258   1e-83    
ref|XP_006902935.1|  PREDICTED: 40S ribosomal protein S9-like           258   1e-83    
ref|XP_002156853.1|  PREDICTED: 40S ribosomal protein S9-like iso...    258   1e-83    
gb|KJE98318.1|  40S ribosomal protein S9                                258   1e-83    
gb|KDN39854.1|  40S ribosomal protein S9                                258   1e-83    
gb|KDQ31494.1|  hypothetical protein PLEOSDRAFT_1054562                 258   1e-83    
emb|CEP13692.1|  hypothetical protein                                   258   1e-83    
dbj|GAN01898.1|  40S ribosomal protein S9                               258   1e-83    
dbj|GAN07351.1|  40S ribosomal protein S9                               258   1e-83    
gb|EPB81471.1|  40S ribosomal protein S9                                258   1e-83    
ref|XP_007922661.1|  hypothetical protein MYCFIDRAFT_60241              258   2e-83    
ref|XP_001873539.1|  40S ribosomal protein S9                           258   2e-83    
dbj|BAA24900.1|  ribosomal protein S9                                   257   2e-83    
ref|XP_007379209.1|  40S ribosomal protein S9                           258   2e-83    
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                   258   2e-83    
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                   258   2e-83    
ref|XP_008475833.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    258   2e-83    
ref|XP_001873538.1|  40S ribosomal protein S9                           258   2e-83    
ref|XP_002471051.1|  ribosomal protein S9                               257   2e-83    
gb|AAV69398.1|  40S ribosomal protein S9                                257   2e-83    
emb|CEJ91392.1|  Putative 40S ribosomal protein S9 (S7)                 257   2e-83    
gb|AAA85659.1|  ribosomal protein S9                                    257   3e-83    
gb|EPZ32298.1|  40S ribosomal protein S9                                257   3e-83    
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                   257   3e-83    
gb|EPS34246.1|  hypothetical protein PDE_09210                          257   4e-83    
gb|EPE04605.1|  40s ribosomal protein s9                                256   4e-83    
gb|KGG50458.1|  putative 40S ribosomal protein S9                       256   4e-83    
gb|EWM23131.1|  40s ribosomal protein s9                                259   4e-83    
gb|EPS99409.1|  hypothetical protein FOMPIDRAFT_1024265                 256   5e-83    
dbj|BAF45897.1|  ribosomal protein S9                                   256   6e-83    
gb|EYC05388.1|  hypothetical protein Y032_0082g1552                     256   6e-83    
gb|EPX74976.1|  40S ribosomal protein S9                                256   6e-83    
gb|EUC58677.1|  40S ribosomal protein S9                                256   6e-83    
emb|CCO33607.1|  40S ribosomal protein S9-A                             256   7e-83    
emb|CEF70379.1|  40S ribosomal protein S9                               256   7e-83    
gb|KFH63847.1|  40S ribosomal protein S9                                256   9e-83    
ref|XP_007763855.1|  40S ribosomal protein S9                           256   9e-83    
gb|KDE04206.1|  40S ribosomal protein S9-A                              256   1e-82    
gb|EME38681.1|  ribosomal protein S9-like protein                       256   1e-82    
gb|EKG11582.1|  Ribosomal protein S4/S9                                 255   1e-82    
gb|KIW73335.1|  40S ribosomal protein S9                                255   1e-82    
ref|XP_008722253.1|  40S ribosomal protein S9                           255   1e-82    
ref|XP_007877369.1|  hypothetical protein PFL1_01668                    256   1e-82    
emb|CEP13909.1|  hypothetical protein                                   255   1e-82    
gb|AAH31746.1|  Ribosomal protein S9                                    255   1e-82    
gb|KIO07111.1|  hypothetical protein M404DRAFT_998525                   255   2e-82    
ref|XP_004995440.1|  40S ribosomal protein S9                           255   2e-82    
gb|KIP02503.1|  hypothetical protein PHLGIDRAFT_20458                   255   2e-82    
emb|CCM02260.1|  predicted protein                                      255   2e-82    
gb|KDR85862.1|  hypothetical protein GALMADRAFT_132501                  255   2e-82    
ref|XP_007698387.1|  hypothetical protein COCSADRAFT_35730              255   2e-82    
ref|XP_005715372.1|  40S ribosomal protein S9                           255   2e-82    
ref|XP_003281304.1|  PREDICTED: 40S ribosomal protein S9-like           255   2e-82    
ref|XP_007731850.1|  40S ribosomal protein S9                           255   2e-82    
gb|KEF58004.1|  40S ribosomal protein S9                                255   2e-82    
gb|KIW44874.1|  40S ribosomal protein S9                                254   2e-82    
gb|KIV80024.1|  40S ribosomal protein S9                                254   2e-82    
ref|XP_001937443.1|  40S ribosomal protein S9                           254   3e-82    
ref|XP_007324335.1|  hypothetical protein SERLADRAFT_480346             254   3e-82    
ref|XP_002179777.1|  predicted protein                                  253   3e-82    
gb|KIM62296.1|  hypothetical protein SCLCIDRAFT_1215157                 254   3e-82    
ref|XP_003838270.1|  similar to 40S ribosomal protein S9                254   3e-82    
ref|XP_009265857.1|  40S ribosomal protein S9-B                         254   4e-82    
ref|XP_003303583.1|  40S ribosomal protein S9                           257   4e-82    
ref|XP_007913411.1|  putative 40s ribosomal protein s9 protein          254   4e-82    
gb|KIJ53746.1|  hypothetical protein M422DRAFT_58531                    254   5e-82    
ref|XP_570885.1|  hypothetical protein CNE02160                         254   5e-82    
ref|XP_001791646.1|  hypothetical protein SNOG_00985                    254   5e-82    
ref|XP_001546443.1|  40S ribosomal protein S9                           254   5e-82    
ref|XP_007687378.1|  hypothetical protein COCMIDRAFT_93683              254   6e-82    
ref|NP_001119227.1|  40S ribosomal protein S9-1                         252   6e-82    
emb|CAO94702.1|  putative ribosomal protein S9                          253   6e-82    
dbj|GAM43906.1|  40S ribosomal protein                                  253   7e-82    
gb|KIW15420.1|  40S ribosomal protein S9                                253   8e-82    
ref|XP_635999.1|  ribosomal protein 1024                                253   1e-81    
ref|XP_007829664.1|  40S ribosomal protein S9                           253   1e-81    
emb|CCF51825.1|  probable 40S ribosomal protein S9                      253   1e-81    
ref|XP_006958740.1|  40S ribosomal protein S9                           253   1e-81    
ref|XP_008876439.1|  ribosomal protein S4                               253   1e-81    
gb|EMF08137.1|  40S ribosomal protein S9                                253   1e-81    
ref|XP_007724904.1|  40S ribosomal protein S9                           253   1e-81    
ref|XP_009155008.1|  40S ribosomal protein S9                           253   1e-81    
ref|XP_003373101.1|  putative ribosomal protein S4                      253   1e-81    
gb|ABE68882.1|  40S ribosomal protein S9                                253   1e-81    
ref|XP_003286040.1|  rp1024 protein                                     253   1e-81    
gb|KIN07697.1|  hypothetical protein OIDMADRAFT_16275                   253   1e-81    
gb|ELK16780.1|  tRNA-splicing endonuclease subunit Sen34                263   1e-81    
gb|KFO36497.1|  tRNA-splicing endonuclease subunit Sen34                263   1e-81    
gb|KFH67080.1|  small subunit ribosomal protein S9e                     256   2e-81    
gb|ETS60861.1|  40s ribosomal protein s9                                253   2e-81    
gb|ABX75477.1|  40S ribosomal protein S9                                252   2e-81    
emb|CBQ71099.1|  probable 40S ribosomal protein S9                      253   2e-81    
gb|ABE68880.1|  40S ribosomal protein S9                                252   2e-81    
gb|KIK29928.1|  hypothetical protein PISMIDRAFT_671906                  253   2e-81    
gb|KIV89206.1|  40S ribosomal protein S9                                253   2e-81    
gb|ACI69386.1|  40S ribosomal protein S9                                253   2e-81    
ref|XP_007788827.1|  putative 40s ribosomal protein s9 protein          252   2e-81    
ref|XP_006682851.1|  hypothetical protein BATDEDRAFT_33834              252   2e-81    
ref|NP_496384.1|  Protein RPS-9                                         252   2e-81    
gb|KEQ66339.1|  40S ribosomal protein S9                                252   2e-81    
gb|KDN65245.1|  putative ribosomal protein S4                           252   2e-81    
ref|XP_011388661.1|  ribosomal 40S subunit protein S9                   252   2e-81    
dbj|GAC98698.1|  40S ribosomal protein S9                               252   2e-81    
gb|EST05865.1|  40S ribosomal protein S9                                252   2e-81    
gb|EJU02852.1|  40S ribosomal protein S9                                252   2e-81    
ref|XP_004204485.1|  Piso0_000336                                       252   2e-81    
gb|ESZ90022.1|  40S ribosomal protein S9                                252   2e-81    
gb|AFK45767.1|  unknown                                                 252   2e-81    
gb|KIJ58198.1|  hypothetical protein HYDPIDRAFT_119825                  252   3e-81    



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   369 bits (947),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   367 bits (943),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   364 bits (935),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   364 bits (934),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+ALLRRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   363 bits (932),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRVKRKNQK  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   363 bits (932),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   362 bits (930),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   362 bits (930),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   362 bits (929),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   362 bits (929),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNTK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   362 bits (928),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   362 bits (928),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   361 bits (927),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   360 bits (924),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCVYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQKHIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRVKR+NQK
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNVPSFMVRMDSQKHIDFSLTSPFGGGRPGRVKRRNQK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   360 bits (923),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDSRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   359 bits (921),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DSQKHIDFSL+SPFGGGRPGRVKR+NQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSQKHIDFSLTSPFGGGRPGRVKRRNQR  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   359 bits (921),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   359 bits (921),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKR+NQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   358 bits (920),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   358 bits (919),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   358 bits (918),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGR GRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRAGRVKRKNLK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   357 bits (916),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+QKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIKQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   357 bits (915),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   356 bits (914),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   356 bits (913),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   355 bits (912),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            +AAK
Sbjct  181  SAAK  184



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   355 bits (912),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   355 bits (911),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQK  180

Query  602  AAAK  613
            AAA+
Sbjct  181  AAAE  184



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   355 bits (910),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   353 bits (907),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIR+GRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRIGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRVKRKNQ  179



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   353 bits (907),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRVKR+NQ+
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRVKRRNQR  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   353 bits (906),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   353 bits (905),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLVRVDSQKHIDFS++SPFGGGR GRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSITSPFGGGRAGRVKRKNQ  179



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   354 bits (908),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKT KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQR  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   352 bits (904),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   352 bits (904),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVR+DSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRMDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKR+N K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRRNLK  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   352 bits (902),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   352 bits (902),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   351 bits (901),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVPFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLEEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   351 bits (901),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLISPFGGGRPGRVKRKNQ  179



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   351 bits (900),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFG GRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGSGRPGRVKRKNQ  179



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   350 bits (899),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKN  178



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   350 bits (898),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+H+RVGRQVVNVPSF+VR+DSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNVPSFMVRLDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ+ALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQFALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDEMQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGCPGRVKRKNQK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   349 bits (896),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   349 bits (896),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   349 bits (896),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   349 bits (896),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   349 bits (895),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+H+RVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKR+NQ+
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQR  180



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   348 bits (894),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  180



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   348 bits (894),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIR+GRQ+VN+PSF+VRV+SQKHIDFSL+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHARVLIRQRHIRIGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   348 bits (894),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   348 bits (893),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRR+FEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRVFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRVKRKNQ  179



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   347 bits (891),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDS+KHIDFSL+SPFGGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSEKHIDFSLTSPFGGGNPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNLK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQR  180



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKR+NQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQR  180



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   347 bits (889),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   347 bits (889),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVRVDS KHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRVDSAKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   346 bits (887),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRVKR+NQ+
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRVKRRNQR  180



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   346 bits (887),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALT+ENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTIENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKHIDFSL+SPFGGGRPGRVKR+N K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRVKRRNDK  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   346 bits (887),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRVKR+N++
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRVKRRNER  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   345 bits (886),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDFS++SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFSITSPFGGGRPGRVKRKN  178



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   345 bits (886),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPFGGG+PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGQPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   345 bits (885),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRSGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPFGGGRPGRVKR+N++
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRVKRRNER  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRVKR+N++
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRVKRRNER  180

Query  602  AAAK  613
            A AK
Sbjct  181  AGAK  184



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVE+FLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVESFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLI+Q+HIRVGRQ VN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIKQRHIRVGRQAVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   344 bits (883),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRVKRKNQ  179



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   343 bits (881),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/173 (95%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGR
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGR  173



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNY KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYEKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQR  180



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLI+Q+H RVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIKQRHTRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ  179



>ref|XP_002276284.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI31983.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV+SQKHIDF+ +SP GGGRPGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVESQKHIDFANTSPLGGGRPGRVKRKN  178



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLEETQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFS++SP GGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSITSPLGGGRPGRVKRRNQ  179



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   343 bits (881),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKR+N
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRRN  178



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   343 bits (880),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRVKRRNQ  179



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   343 bits (880),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRVKRRNQ  179



>ref|XP_004299381.1| PREDICTED: 40S ribosomal protein S9-2-like [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   343 bits (880),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK G+
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTVVFKKGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR DS+KHIDF+++SP GGG PGRVKR+N K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRCDSEKHIDFAITSPLGGGGPGRVKRRNLK  180

Query  602  AAAK  613
            AAAK
Sbjct  181  AAAK  184



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP GGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLGGGEPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDS KHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSAKHIDFSLTSPFGGGRPGRVKRKNQ  179



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPFGGGRPGRVKR+N+
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRVKRRNE  179



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRVKRKN  178



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRVKRKN  178



>ref|XP_006663032.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   341 bits (875),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   341 bits (874),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVD++KHIDFSL+SP GGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDTEKHIDFSLTSPLGGGEPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|NP_001278530.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG32995.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG34689.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACL52933.1| unknown [Zea mays]
 tpg|DAA55418.1| TPA: 40S ribosomal protein S9 isoform 1 [Zea mays]
 tpg|DAA55419.1| TPA: 40S ribosomal protein S9 isoform 2 [Zea mays]
Length=194

 Score =   340 bits (873),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   340 bits (872),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG PGRVKRKNQ 
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRVKRKNQN  180

Query  602  AAA  610
             A 
Sbjct  181  KAT  183



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   340 bits (871),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDF+L+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRVKRKNQ  179



>ref|XP_007209623.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
 ref|XP_008239810.1| PREDICTED: 40S ribosomal protein S9-2-like [Prunus mume]
 gb|EMJ10822.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
Length=197

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTIVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+ SFLVR DS+KHIDFSL+SP G GRPGRVKR+N
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNISSFLVRCDSEKHIDFSLTSPLGAGRPGRVKRRN  178



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   339 bits (869),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG PGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRVKRKNLK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   339 bits (869),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VR+DS+KHIDFSL+SP GGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRLDSEKHIDFSLTSPLGGGEPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   339 bits (869),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPFGGG PGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPFGGGPPGRVKRKNMK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   339 bits (869),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   339 bits (869),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   338 bits (868),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DS+KHIDF+++SP GGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSEKHIDFAITSPLGGGRPGRVKRRNQ  179



>gb|ACG33443.1| 40S ribosomal protein S9 [Zea mays]
Length=194

 Score =   338 bits (868),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPHRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>gb|EMS50632.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT06699.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   338 bits (868),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E Q+KLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLAEGQDKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPFGGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   338 bits (868),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRFGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS KHIDF+L+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRVKRKNQ  179



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   338 bits (866),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   338 bits (866),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKXGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRRNQ  179



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   337 bits (865),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KH+DFSL+SP GGG PGRVKRKNQ 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHVDFSLTSPLGGGEPGRVKRKNQN  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   337 bits (865),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKR+NQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRRNQ  179



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   337 bits (865),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+RYG L+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGFLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPFGGGRPGRVKR+N
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRVKRRN  178



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   337 bits (864),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR+DSQKH+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   337 bits (864),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN++GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQ  179



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   337 bits (864),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYVLSRIRNAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDE+DPRR+FEG+ALLRRM++YGLLDE QNKLDYVLALTVENFLERRLQT VFK GM
Sbjct  61   LLTLDERDPRRVFEGEALLRRMHKYGLLDEEQNKLDYVLALTVENFLERRLQTQVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLV+++S KHIDF+LSSPFGGGRPGRVKRKN +
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVKLESGKHIDFALSSPFGGGRPGRVKRKNTR  180

Query  602  AAA  610
            AAA
Sbjct  181  AAA  183



>ref|NP_001149705.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG36447.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFR11274.1| ribosomal protein S9 [Zea mays]
 tpg|DAA41536.1| TPA: 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   337 bits (863),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   337 bits (864),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLV EYGLRCKRELWRVQYALSRIRNN+R 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVREYGLRCKRELWRVQYALSRIRNNSRT  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRVKRKN  178



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+R+GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  179



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   336 bits (862),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   336 bits (862),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   336 bits (862),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   339 bits (869),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 169/169 (100%), Gaps = 0/169 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK+PR
Sbjct  85   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKNPR  144

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIHHARVL
Sbjct  145  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIHHARVL  204

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKR+NQ
Sbjct  205  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQ  253



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   335 bits (860),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_002985335.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
 ref|XP_002987182.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ11758.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ13465.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
Length=198

 Score =   335 bits (859),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWR+QY LSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRLQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEGDALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGDALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPFGGG PGRVKRKN K
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPFGGGGPGRVKRKNMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_002463229.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
 gb|EER99750.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
Length=194

 Score =   335 bits (858),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_002463225.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
 gb|EER99746.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
Length=194

 Score =   335 bits (858),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   336 bits (861),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  28   MVKVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  87

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTL FK+GM
Sbjct  88   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLAFKSGM  147

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRVKRKN
Sbjct  148  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRVKRKN  205



>ref|XP_003562635.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   334 bits (857),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV ++KHIDFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVATEKHIDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>gb|ABA94602.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=192

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 3/183 (2%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HI   RQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHI---RQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQK  177

Query  602  AAA  610
             A+
Sbjct  178  KAS  180



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   333 bits (855),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRVKR+N++
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRVKRRNER  180



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   333 bits (855),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRVKR+N++
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRVKRRNER  180



>ref|XP_006657990.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=194

 Score =   333 bits (854),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHAR+LIRQ+HIRVGRQ+VN+PSF+VR++S+KHIDFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARILIRQRHIRVGRQLVNIPSFMVRLESEKHIDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +2

Query  77   FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            F   +GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLD
Sbjct  36   FIEVHGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLD  95

Query  257  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  436
            EK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIH
Sbjct  96   EKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIH  155

Query  437  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            HARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRVKRKN KAA+K
Sbjct  156  HARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNLKAASK  214



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   333 bits (853),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_004958404.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   332 bits (852),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRVKRKNQ 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRVKRKNQN  180

Query  602  AAA  610
             A 
Sbjct  181  KAT  183



>ref|XP_002960852.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
 ref|XP_002967162.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ31761.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ38391.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
Length=198

 Score =   332 bits (852),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRN +R 
Sbjct  1    MVHVCVYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNASRH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPFGGG PGRVKRKN K
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPFGGGGPGRVKRKNTK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|EMS59613.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT26225.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   332 bits (851),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KREL+RVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELYRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTV+NFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLTEEQNKLDYVLALTVDNFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP GGG+PGRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPLGGGQPGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>dbj|BAJ90873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   332 bits (850),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGAALLRRMNRYGLLSEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP GGG  GRVKRKNQK
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPLGGGPAGRVKRKNQK  180

Query  602  AAA  610
             A+
Sbjct  181  KAS  183



>ref|XP_001762390.1| predicted protein [Physcomitrella patens]
 gb|EDQ72857.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   330 bits (847),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR++SQKH+DF+LSSP GGGRPGRVKRK  K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLESQKHVDFALSSPLGGGRPGRVKRKYMK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   329 bits (843),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  5    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  64

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  65   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  124

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  125  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  174



>gb|KFK25765.1| hypothetical protein AALP_AA8G156800 [Arabis alpina]
Length=197

 Score =   328 bits (842),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR++SQKHIDF+L+SP GGGR GRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLESQKHIDFALTSPLGGGRAGRVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  3    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  62

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  63   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  122

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKR+NQ+
Sbjct  123  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQR  172



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   328 bits (841),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   HVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLL  247
            H++F  +    F   RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARMLL
Sbjct  9    HIDF--SLTSPFGGGRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLL  66

Query  248  TLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAK  427
            TLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAK
Sbjct  67   TLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAK  126

Query  428  SIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            SIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+AA
Sbjct  127  SIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQRAA  186

Query  608  AK  613
            +K
Sbjct  187  SK  188



>gb|EEC74543.1| hypothetical protein OsI_10067 [Oryza sativa Indica Group]
Length=292

 Score =   328 bits (841),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLDEK+P
Sbjct  107  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNP  166

Query  269  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  448
            RRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIHHARV
Sbjct  167  RRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIHHARV  226

Query  449  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            LIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRVKRKNQK A+
Sbjct  227  LIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQKKAS  280



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
              TFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  64   ATTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  123

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  124  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  183

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQ+
Sbjct  184  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQR  233



>ref|XP_009126038.1| PREDICTED: 40S ribosomal protein S9-1-like [Brassica rapa]
Length=197

 Score =   322 bits (826),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIH +RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHI F+L SPFGGGRPG VKR+N+K
Sbjct  121  AKSIHPSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIGFALISPFGGGRPGSVKRRNEK  180

Query  602  AAAK  613
            +A+K
Sbjct  181  SASK  184



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRVKRKNAK  180

Query  602  AAA  610
               
Sbjct  181  KGG  183



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   320 bits (821),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 2/178 (1%)
 Frame = +2

Query  83   RNYGKTF--KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            R Y KT+  KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLD
Sbjct  6    RTYSKTYSTKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLD  65

Query  257  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  436
            EK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIH
Sbjct  66   EKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIH  125

Query  437  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            HARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRVKRKNQK A+
Sbjct  126  HARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQKKAS  183



>ref|XP_010550058.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   320 bits (820),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRV+RKN+K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPFGGGRPGRVRRKNEK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_010545191.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   320 bits (820),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRV+RKN+K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPFGGGRPGRVRRKNEK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>ref|XP_010551858.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   320 bits (820),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+VN+YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVNYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRV+RKN+K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPFGGGRPGRVRRKNEK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   319 bits (818),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRVKRKN  178



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   319 bits (817),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 168/180 (93%), Gaps = 9/180 (5%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGE         WRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGE---------WRVQYALSRIRNNARN  51

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  52   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  111

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRVKR+NQ+
Sbjct  112  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRVKRRNQR  171



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   319 bits (817),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+RIFEG+AL+RRMNRYGLL ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLEEKDPKRIFEGNALMRRMNRYGLLSESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRVKRKNAK  180



>ref|XP_010524330.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRV+RKN+K
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPFGGGRPGRVRRKNEK  180

Query  602  AAAK  613
            AA+K
Sbjct  181  AASK  184



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   335 bits (859),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  769  MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  828

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  829  LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  888

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRVKR+N++
Sbjct  889  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRVKRRNER  948



>gb|EAY83173.1| hypothetical protein OsI_38384 [Oryza sativa Indica Group]
Length=173

 Score =   306 bits (785),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M+HV+FYRNYGKTFKK RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MMHVSFYRNYGKTFKKQRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPCRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGG  568
            AKSIHHA  LIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPF GG
Sbjct  121  AKSIHHACFLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPFSGG  169



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   307 bits (786),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+QVVN+PSFLVRVDSQKHIDFSL+SPFGGGRPGRVKRK+Q 
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNIPSFLVRVDSQKHIDFSLTSPFGGGRPGRVKRKHQA  180

Query  602  A  604
            A
Sbjct  181  A  181



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   304 bits (779),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ  LS++R  AR 
Sbjct  1    MPSIGFYRNYGKTFKKPRRPFEKERLDAELKVVGEFGLRNKRELWRVQMVLSKLRARARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+R+FEG+ALLRRM RYG LDESQNKLDYVLALT  + LERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRLFEGEALLRRMYRYGFLDESQNKLDYVLALTPADVLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRVKRK+Q 
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSQKHIDFALNSPFGGGRPGRVKRKSQA  180

Query  602  A  604
            +
Sbjct  181  S  181



>ref|XP_006431128.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 ref|XP_006482573.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR44368.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 gb|KDO72548.1| hypothetical protein CISIN_1g046291mg [Citrus sinensis]
Length=197

 Score =   303 bits (775),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVG +GLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGSFGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG ALLRRM RYGLL+ +QNKLDYVLALTVE+FLERRLQT+VFKAG+
Sbjct  61   LLTLDEKDPRRIFEGQALLRRMFRYGLLEATQNKLDYVLALTVESFLERRLQTVVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFG-GGRPGRV  583
            AKSIHHARVLI+QKHIRVGRQ+VN+PSFLVRVD+Q H+  SL+S     GRPGRV
Sbjct  121  AKSIHHARVLIKQKHIRVGRQIVNIPSFLVRVDAQNHVGVSLTSSLTQTGRPGRV  175



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   302 bits (774),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYRNYGKTFKKPRRP+EK+RLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRNYGKTFKKPRRPFEKDRLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLALT E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIIRRMRAYGLLDETQDKLDYVLALTPETFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRVKRK
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRVKRK  177



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   300 bits (767),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H+++YRNYGKTFKKPRRP+EKERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHISYYRNYGKTFKKPRRPFEKERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E+QNKLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEEAQNKLDYVLALTPQDFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDF+L+SPFGGGRPGR KRK  K
Sbjct  121  AKSMHHARVLIRQRHIRVGKQIVNVPSFMVRVDSQKHIDFALNSPFGGGRPGRNKRKALK  180



>ref|XP_002500609.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61867.1| predicted protein [Micromonas sp. RCC299]
Length=194

 Score =   300 bits (767),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD+ELK+VGEYGLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM RYGLLDESQ+KLDYVLALT E FLERRLQT+VFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDESQDKLDYVLALTPEIFLERRLQTIVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AKS+HHARVLI+Q+HIRVG+Q+VN+PSFLVR DSQKHID+SL+SP GGGRPGRVKRK
Sbjct  121  AKSVHHARVLIKQRHIRVGKQIVNIPSFLVRADSQKHIDYSLNSPLGGGRPGRVKRK  177



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   299 bits (766),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    +YRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLAL  E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMRNYGLLDETQDKLDYVLALGPEQFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRVKRK
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRVKRK  177



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   299 bits (766),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD ELK VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRSYSKTFKKPRRPFEKERLDNELKTVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE+Q+KLDYVLAL+ + FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDETQDKLDYVLALSADAFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRVKRK   
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRVKRKRMA  180

Query  602  AAAK  613
            AA +
Sbjct  181  AAGR  184



>ref|XP_008367548.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S9-2-like 
[Malus domestica]
Length=197

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M HV+FYRNYGKT KKPRRPYEKERLDAELKLVGE+GLR  RELWRV  + SRIRNNAR 
Sbjct  1    MFHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEFGLRXPRELWRVSASQSRIRNNARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRI  G+ALLRRMNRY LLDE  NKL YVLAL VENFLERRL T+ FK GM
Sbjct  61   LLTLDEKNPRRIIXGEALLRRMNRYKLLDEGXNKLXYVLALNVENFLERRLXTIXFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIR +HI VGRQV N+PSFLVR D++KHIDFSL+SP GGGRPGRVKR+N  
Sbjct  121  AKSIHHARVLIRLRHIXVGRQVXNIPSFLVRCDTEKHIDFSLTSPLGGGRPGRVKRRNTN  180

Query  602  AAAK  613
            AA K
Sbjct  181  AAXK  184



>ref|XP_002467783.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
 gb|EER94781.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
Length=177

 Score =   298 bits (764),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 159/183 (87%), Gaps = 16/183 (9%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+                NKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGE----------------NKLDYVLALTVENFLQRRLQTIVFKNGM  104

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP  GG PGRVKRKN K
Sbjct  105  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLVGGEPGRVKRKNSK  164

Query  602  AAA  610
             A+
Sbjct  165  KAS  167



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   297 bits (761),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 157/183 (86%), Gaps = 19/183 (10%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGK FKKPRRPYEKE LDAELKLVGEYGLR KRELWRVQYA SRIRN A M
Sbjct  1    MVHVSFYRNYGKNFKKPRRPYEKECLDAELKLVGEYGLRAKRELWRVQYAFSRIRNAATM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ R                   +SQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQR-------------------QSQNKLDYVLALTVENFLERRLQTLVFKAGM  101

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKNQK
Sbjct  102  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQK  161

Query  602  AAA  610
            AA+
Sbjct  162  AAS  164



>gb|EAY83171.1| hypothetical protein OsI_38381 [Oryza sativa Indica Group]
Length=192

 Score =   292 bits (747),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 165/183 (90%), Gaps = 3/183 (2%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKP+RPYEKERLDAELKLVGEYGLRCKRELWRVQYAL+RIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPKRPYEKERLDAELKLVGEYGLRCKRELWRVQYALNRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN Y LL E QNKLD VLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNHYRLLAEGQNKLDCVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+     R+++NVPSF+VR++S+KHIDFSL+SPFGGG  GRVKRKN K
Sbjct  121  AKSIHHARVLIRQR---HIRRIINVPSFMVRLESEKHIDFSLTSPFGGGPAGRVKRKNMK  177

Query  602  AAA  610
             A+
Sbjct  178  KAS  180



>gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=164

 Score =   286 bits (731),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 150/184 (82%), Gaps = 33/184 (18%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ            
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ------------  48

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
                                 MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  49   ---------------------MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  87

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRKN K
Sbjct  88   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNTK  147

Query  602  AAAK  613
            AA+K
Sbjct  148  AASK  151



>gb|KIZ02547.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=227

 Score =   286 bits (732),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 168/216 (78%), Gaps = 35/216 (16%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIR-----------------------------------VGRQVVNV  496
            AKSIHHARVLIRQ+HI                                    VG+QVVN+
Sbjct  121  AKSIHHARVLIRQRHISSSGSSSSSRPAGMVAGAQQPRVRCNAAGGALSNRWVGKQVVNI  180

Query  497  PSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKA  604
            PSF+VRVDSQKHIDFSL+SPFGGGRPGRVKRK+Q A
Sbjct  181  PSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKHQAA  216



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   285 bits (728),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  +  YRNYGKTFKKPRRP+EKERLD ELKLVGEYGLR KRELWRVQ  LS+IRN AR 
Sbjct  1    MPKIGQYRNYGKTFKKPRRPFEKERLDGELKLVGEYGLRNKRELWRVQMILSKIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LL  DE D +R+FEG AL+RRM +YGLL+E+Q+KLDYVLAL   +FLERRLQT+VFK G+
Sbjct  61   LLQHDEDDTKRLFEGQALMRRMYKYGLLNETQDKLDYVLALQPNDFLERRLQTVVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLI+Q HIRVG+QVVN+PSF+VRVDSQKH+DF+L+SPFGGGRPGR KRKN
Sbjct  121  AKSIHHARVLIKQNHIRVGKQVVNIPSFMVRVDSQKHVDFALTSPFGGGRPGRCKRKN  178



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   283 bits (725),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 153/178 (86%), Gaps = 19/178 (11%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            L+ L EK  R+                   SQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LVNLGEKKTRK-------------------SQNKLDYVLALTVENFLERRLQTLVFKSGM  101

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPFGGGRPGRVKR+N
Sbjct  102  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRVKRRN  159



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   282 bits (722),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ YRNYGKTFKKPRRP+EKERLDAELK VGE+GLR KRELWRVQ  LS+ R+ AR 
Sbjct  1    MPSISCYRNYGKTFKKPRRPFEKERLDAELKTVGEFGLRNKRELWRVQLVLSKFRSRARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+AL+RRM RYG L+  ++KLDYVL+LT +  LERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGEALMRRMYRYGFLETHEDKLDYVLSLTPDRVLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGRPGRVKR++
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRIDSQKHIDFALNSPFGGGRPGRVKRRS  178



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   280 bits (715),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR   KT++ PRRP+EKERLDAELKLVGEYGLR KRELWRV++ALS+IR  AR LLTL+E
Sbjct  5    YRTCSKTYRTPRRPFEKERLDAELKLVGEYGLRNKRELWRVEFALSKIRAAARDLLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIFEG+ALLRR+ R+GLLDE++  LD+VL+L V++ LERRLQT V K G+AKSIHH
Sbjct  65   KDPRRIFEGNALLRRLTRFGLLDETRQSLDHVLSLKVQDLLERRLQTQVLKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            ARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDFSL SPFGGGRPGRVKR+  + A+K
Sbjct  125  ARVLIRQRHIRVGKQLVNVPSFMVRVDSQKHIDFSLDSPFGGGRPGRVKRRKLREASK  182



>ref|XP_008808061.1| PREDICTED: 40S ribosomal protein S9-2-like, partial [Phoenix 
dactylifera]
Length=165

 Score =   277 bits (709),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  VGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQ  337
            VGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+Q
Sbjct  1    VGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRFGLLDENQ  60

Query  338  NKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRV  517
            NKLDYVLALTVENFLERRLQT VFK+GMAKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV
Sbjct  61   NKLDYVLALTVENFLERRLQTQVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFMVRV  120

Query  518  DSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
            DS KHIDF+L+SPFGGGRPGRVKRKNQ
Sbjct  121  DSAKHIDFALNSPFGGGRPGRVKRKNQ  147



>gb|ADB77798.1| 40S ribosomal protein S9 [Cladophora coelothrix]
Length=179

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKER D+ELKLVGE+GLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERPDSELKLVGEFGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  418
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  419  MAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            +AKSIHHARV+IRQ+HIRVG+Q+VNVPSF+VR++SQ HIDF+L+SPF GGRPGRVKR++
Sbjct  121  LAKSIHHARVIIRQRHIRVGKQIVNVPSFMVRMESQGHIDFALTSPFSGGRPGRVKRRS  179



>gb|EXX79184.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=190

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN  KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR  AR LLTLD+K
Sbjct  6    RNCSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIRRAARELLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK Q++A K
Sbjct  126  RVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRVKRKRQRSAIK  182



>gb|ESA03224.1| hypothetical protein GLOINDRAFT_243564 [Rhizophagus irregularis 
DAOM 181602]
Length=186

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN  KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR  AR LLTLD+K
Sbjct  6    RNCSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIRRAARELLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK Q++A K
Sbjct  126  RVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRVKRKRQRSAIK  182



>gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis]
Length=140

 Score =   275 bits (703),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVG  478
            AKSIHHARVLIRQ+HIRVG
Sbjct  121  AKSIHHARVLIRQRHIRVG  139



>ref|XP_003609048.1| 40S ribosomal protein S9 [Medicago truncatula]
Length=200

 Score =   277 bits (708),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 151/179 (84%), Gaps = 13/179 (7%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLE RLQTL    G 
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLECRLQTL---CGS  117

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQ  598
              +  H           VGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRVK   Q
Sbjct  118  YLTEAHW----------VGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRVKVGRQ  166



>gb|EXX62810.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=197

 Score =   276 bits (707),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +2

Query  62   MVH--VNFYRNYG---KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIR  226
            M+H  + F++  G   KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR
Sbjct  1    MIHHSLPFFKKVGISSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIR  60

Query  227  NNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLV  406
              AR LLTLD+KDPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT V
Sbjct  61   RAARELLTLDDKDPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQV  120

Query  407  FKAGMAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVK  586
            FK G+AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRVK
Sbjct  121  FKLGLAKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRVK  180

Query  587  RKNQKAAAK  613
            RK Q++A K
Sbjct  181  RKRQRSAIK  189



>gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS 112818]
 gb|EGE05828.1| ribosomal protein S9 [Trichophyton equinum CBS 127.97]
 gb|EZF31376.1| 40S ribosomal protein S9 [Trichophyton interdigitale H6]
 gb|KDB21176.1| 40S ribosomal protein S9 [Trichophyton interdigitale MR816]
Length=191

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRVKRK  KAA K
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRVKRKKMKAAEK  180



>gb|KDD75683.1| hypothetical protein H632_c551p0 [Helicosporidium sp. ATCC 50920]
Length=203

 Score =   275 bits (702),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GK FK PRRP+EKERLDAELK VGEYGLRCKRELWRVQ  LS+ R+ AR LLTL E D R
Sbjct  22   GKVFKVPRRPFEKERLDAELKTVGEYGLRCKRELWRVQLVLSKFRSRARELLTLPENDAR  81

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+AL+RRM RYG LD SQ+KLDYVL+LT  + LERRLQTLVFK G+AKSIHHARVL
Sbjct  82   RVFEGEALMRRMYRYGFLDASQDKLDYVLSLTPADVLERRLQTLVFKLGLAKSIHHARVL  141

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            IRQ+HIRVG+Q+VNVPSFLVRVDSQKHIDF+L+SPFGGGRPGR KR+N   A
Sbjct  142  IRQRHIRVGKQLVNVPSFLVRVDSQKHIDFALNSPFGGGRPGRNKRRNLAKA  193



>ref|XP_003172904.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
 gb|EFR02493.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
Length=191

 Score =   274 bits (700),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRVKRK  KAA K
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRVKRKKMKAAEK  180



>ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EGD86111.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EZF11976.1| 40S ribosomal protein S9 [Trichophyton rubrum MR850]
 gb|EZF38837.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 100081]
 gb|EZF49469.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 288.86]
 gb|EZF60077.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 289.86]
 gb|EZF70598.1| 40S ribosomal protein S9 [Trichophyton soudanense CBS 452.61]
 gb|EZF81480.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1448]
 gb|EZF92037.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1459]
 gb|EZG03407.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 735.88]
 gb|EZG13613.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 202.88]
 gb|KDB30580.1| 40S ribosomal protein S9 [Trichophyton rubrum D6]
Length=191

 Score =   274 bits (700),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRVKRK  +AA K
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRVKRKKMRAAEK  180



>ref|XP_009022737.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
 gb|ESN98765.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
Length=191

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
             KT+  PRRPYEKERLD ELKL+GE+GLR KRE+WRV+YAL++IR  AR LLTLDEKDPR
Sbjct  9    SKTYSTPRRPYEKERLDQELKLIGEFGLRNKREVWRVKYALTKIRTAARELLTLDEKDPR  68

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+ALLRR+ R G+L+ES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHARVL
Sbjct  69   RLFEGNALLRRLVRIGVLEESKMKLDYVLGLKLEDFLERRLQTQVFKLGLAKSIHHARVL  128

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            IRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SP+GGGRPGRVKRKNQ+
Sbjct  129  IRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPYGGGRPGRVKRKNQR  178



>ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
 gb|EEQ35217.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
Length=191

 Score =   273 bits (698),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRVKRK  KAA
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRVKRKKMKAA  178



>ref|XP_003026421.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
 gb|EFI91518.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
Length=193

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RKHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALTLSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP+GGGRPGRVKRK   AAAK
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPYGGGRPGRVKRKRIAAAAK  182



>gb|KCW56192.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=147

 Score =   271 bits (692),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIR  472
            AKSIHHARVLIRQ+HIR
Sbjct  121  AKSIHHARVLIRQRHIR  137



>ref|XP_004336000.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13987.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
Length=188

 Score =   272 bits (696),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKT K PRRP+EKERLD ELKL+GE+GL+ KRE+WRV YALS++R NAR LLTL EK P+
Sbjct  1    GKTVKTPRRPFEKERLDHELKLIGEFGLKNKREVWRVHYALSKVRKNARKLLTLPEKHPK  60

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG A+LRR++R G+++ES+NKLDYVLAL + +FLERRLQT VFK G+AKSIHHARVL
Sbjct  61   RIFEGSAMLRRLHRMGVMEESKNKLDYVLALKINDFLERRLQTQVFKIGLAKSIHHARVL  120

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            IRQ+HIRVG+Q+VNVPSF+VR DSQKH+DF+++SPFGGGRPGR KRK  KA A+
Sbjct  121  IRQRHIRVGKQIVNVPSFIVRTDSQKHVDFAINSPFGGGRPGRNKRKRVKAKAE  174



>ref|XP_002110068.1| S9 ribosomal protein [Trichoplax adhaerens]
 gb|EDV28234.1| S9 ribosomal protein [Trichoplax adhaerens]
Length=194

 Score =   272 bits (696),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+  PRRP+EK RLD ELKL+GEYGLR KRE+WRV+Y L++IR  AR LLTLD+K
Sbjct  4    RVYSKTYTTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKYTLAKIRKAARTLLTLDDK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            D +R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  64   DSKRLFEGNALLRRLVRIGVLDESKMKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSLSSPFGGGR GRVKRKN K  +K
Sbjct  124  RVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLSSPFGGGRAGRVKRKNMKKGSK  180



>emb|CDS04034.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS05828.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS09313.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
Length=190

 Score =   272 bits (695),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT K P+RPYE  RLD ELKLVGEYGL+ KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTSKVPKRPYESARLDQELKLVGEYGLKNKREVWRVGLTLSKIRRAARDLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK  KAA
Sbjct  126  RVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRPGRVKRKRAKAA  180



>ref|XP_002367195.1| 40S ribosomal protein S9, putative [Toxoplasma gondii ME49]
 ref|XP_008883863.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|EPR63525.1| ribosomal protein RPS9 [Toxoplasma gondii GT1]
 gb|EPT25014.1| ribosomal protein RPS9 [Toxoplasma gondii ME49]
 gb|ESS34279.1| ribosomal protein RPS9 [Toxoplasma gondii VEG]
 gb|KEP65652.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|KFG46575.1| ribosomal protein RPS9 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48357.1| ribosomal protein RPS9 [Toxoplasma gondii p89]
 gb|KFG54080.1| ribosomal protein RPS9 [Toxoplasma gondii FOU]
 gb|KFG64413.1| ribosomal protein RPS9 [Toxoplasma gondii RUB]
 gb|KFH12211.1| ribosomal protein RPS9 [Toxoplasma gondii VAND]
 gb|KFH16022.1| ribosomal protein RPS9 [Toxoplasma gondii MAS]
Length=188

 Score =   271 bits (693),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRVFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            ARVLIRQ+HIRVG+ +V++PSF+VRVDS+KH+D++++SPFGGGRPGRVKR++ K  
Sbjct  125  ARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFGGGRPGRVKRRSLKGG  180



>gb|KDQ62955.1| hypothetical protein JAAARDRAFT_28926 [Jaapia argillacea MUCL 
33604]
Length=193

 Score =   271 bits (693),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL VE+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKVEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AA K
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRAAAAQK  182



>gb|AGH70193.1| 40S ribosomal protein S9 [Placozoa sp. H4]
Length=195

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+  PRRP+EK RLD ELKL+GEYGLR KRE+WRV+Y L++IR  AR LLTLD+K
Sbjct  4    RVYSKTYTTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKYTLAKIRKAARTLLTLDDK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
             P+R+FEG+ALLRR+ R G+LDES+ KLDYVL L V++FLERRLQT VFK G+AKSIHHA
Sbjct  64   HPKRLFEGNALLRRLVRIGVLDESKMKLDYVLGLRVDDFLERRLQTQVFKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSLSSPFGGGR GRVKRKN K A K
Sbjct  124  RVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLSSPFGGGRAGRVKRKNLKRATK  180



>ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae RIB40]
 ref|XP_002383988.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 dbj|BAE63505.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED46452.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 gb|EIT72324.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE75201.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=193

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV+RK   +A
Sbjct  126  RVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRVQRKKAASA  180



>emb|CBN76630.1| conserved unknown protein [Ectocarpus siliculosus]
Length=194

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  V  +RNY KTFK PRRPYEKERLD+ELKL GEYGLRCKRE+WRVQ+AL++IR  AR 
Sbjct  1    MPKVGIHRNYRKTFKTPRRPYEKERLDSELKLCGEYGLRCKREIWRVQFALAKIRKAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLD KDP+R+FEG ALLRRM+R+GLL E + +LD+VL LT E  LERRLQT VFK G+
Sbjct  61   LLTLDTKDPKRLFEGPALLRRMSRFGLLGEDEKELDFVLQLTTEKMLERRLQTKVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+ +HIRVG+Q+VNVP F+VR+DS+KHIDFS++SP+G GRPGRV
Sbjct  121  AKSIHHARVLIKHRHIRVGKQLVNVPQFMVRMDSEKHIDFSITSPYGQGRPGRV  174



>ref|XP_003886044.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
 emb|CBZ56018.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
Length=188

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRLFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            ARVLIRQ+HIRVG+ +V++PSF+VRVDS+KH+D++++SPFGGGRPGRVKR++ K  
Sbjct  125  ARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFGGGRPGRVKRRSLKGG  180



>ref|XP_002629546.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ69974.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ91116.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ER-3]
 gb|EGE82757.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL29231.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 26199]
Length=191

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRPYE  RLD+EL+++G+YGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPYESARLDSELEIIGKYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTQVYQLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV+RK  KA  K
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFGEGRPGRVQRKKNKAGEK  180



>ref|XP_662407.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 gb|EAA60373.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 tpe|CBF76749.1| TPA: hypothetical protein similar to 40S ribosomal protein S9 
(Broad) [Aspergillus nidulans FGSC A4]
Length=193

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ+ LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQFTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SPFGGGRPGRV+RK
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPFGGGRPGRVQRK  175



>ref|XP_009540632.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86629.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
Length=193

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AAA
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRALAAA  181



>dbj|BAN20249.1| ribosomal protein S9 [Riptortus pedestris]
Length=193

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            + KT+  PRRPYEK RLD EL+++GEYGLR KRE+WRV+Y L++IR  AR LLTLDEKDP
Sbjct  10   HSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLAKIRKAARELLTLDEKDP  69

Query  269  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  448
            +R+FEG+ALLRR+ R G+LDES+ KLDYVL L VE+FLERRLQT VFK G+AKSIHHARV
Sbjct  70   KRLFEGNALLRRLVRIGVLDESKMKLDYVLGLKVEDFLERRLQTQVFKLGLAKSIHHARV  129

Query  449  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            LIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN +   
Sbjct  130  LIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNSRKGT  183



>ref|XP_007860645.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60181.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
Length=193

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AA K
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRALAAQK  182



>emb|CDR95115.1| 40S ribosomal subunit protein S9, putative [Babesia bigemina]
Length=184

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKS  430
            LDEKD +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VFK G+AKS
Sbjct  62   LDEKDTKRQFQGDALLRRMVRYGLMGENEQKLDFVLGLTLNKMMERRLQTKVFKLGLAKS  121

Query  431  IHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            IHHAR +IRQ+HIRVG+Q+V++PSF+VRVDS+KHIDF+L+SPFGGG PGRV RK  +  +
Sbjct  122  IHHARCMIRQRHIRVGKQIVDIPSFMVRVDSEKHIDFALTSPFGGGHPGRVHRKTLRGGS  181



>ref|XP_006671722.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
 gb|EGX90098.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
Length=190

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT + PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAHSKTSRVPRRPFESARLDSELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV+RK  KAAA+
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRVRRKKAKAAAE  180



>ref|XP_011115175.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36858.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
Length=192

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLDAELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTYKVPRRPFESARLDAELKTVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRAGILDDSRMKLDYVLALKIEDFLERRLQTQVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGR GR KRK  K
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGGGRAGRTKRKRSK  178



>ref|XP_005767233.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
 gb|EOD14804.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
Length=194

 Score =   270 bits (689),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+R+FEG+ALLRR+ R G+LDES+ +LDYVLAL   +F+ERRLQT VFK G+
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDESKAQLDYVLALKPADFMERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR +SQKHIDFS++SPFGGGRPGR KRK
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRTESQKHIDFSITSPFGGGRPGRNKRK  177



>emb|CDH55798.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH49579.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=190

 Score =   269 bits (688),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT K P+RPYE  RLD ELKLVGEYGL+ KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTSKVPKRPYESARLDQELKLVGEYGLKNKREVWRVGLTLSKIRRAARDLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDF+L+SP+GGGR GRVKRK  KAA
Sbjct  126  RVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRAGRVKRKRAKAA  180



>gb|KIY51995.1| ribosomal protein S4 [Fistulina hepatica ATCC 64428]
Length=193

 Score =   269 bits (688),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  8    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDDK  67

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  68   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKIEDFLERRLQTQVFKIGLAKSIHHA  127

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLIRQ+HIRVG+Q+VNVPSF VR+DSQKHIDF+L+SP+GGGRPGRVKRK Q+AA
Sbjct  128  RVLIRQRHIRVGKQIVNVPSFTVRLDSQKHIDFALTSPYGGGRPGRVKRKRQRAA  182



>ref|XP_001609790.1| 40S ribosomal subunit protein S9 [Babesia bovis T2Bo]
 gb|EDO06222.1| 40S ribosomal subunit protein S9, putative [Babesia bovis]
Length=182

 Score =   269 bits (687),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLTLD+K
Sbjct  6    RNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            D +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VFK G+AKSIHHA
Sbjct  66   DVKRQFQGDALLRRMVRYGLMGENERKLDFVLGLTLNKMMERRLQTKVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            R +IRQ+HIRVG+Q+V++PSF+VRVDS+KHIDF+L+SPFGGGRPGRV RK  +AAA+
Sbjct  126  RCMIRQRHIRVGKQIVDIPSFMVRVDSEKHIDFALTSPFGGGRPGRVHRKALRAAAE  182



>gb|KIM31691.1| hypothetical protein M408DRAFT_236801 [Serendipita vermifera 
MAFF 305830]
Length=192

 Score =   269 bits (687),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKL GEYGLR KRE+WR+   LS+IR  AR LL L+ K
Sbjct  6    RTYSKTYKVPRRPFESARLDSELKLAGEYGLRNKREIWRITLILSKIRRAARELLKLEAK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFKAG+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKIEDFLERRLQTQVFKAGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFS +SPFGGGRPGRVKRK   AA+K
Sbjct  126  RVLIRQRHIRVGRQVVNVPSFVVRLDSQKHIDFSSTSPFGGGRPGRVKRKRAAAASK  182



>ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|EGR49873.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|ETS03579.1| ribosomal protein S4, partial [Trichoderma reesei RUT C-30]
Length=191

 Score =   269 bits (687),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT + PRRP+E  RLDAELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAHSKTSRVPRRPFESARLDAELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV+RK  KAA
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGNGRPGRVRRKKAKAA  178



>ref|XP_011122298.1| hypothetical protein AOL_s00079g121 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX48900.1| hypothetical protein AOL_s00079g121 [Arthrobotrys oligospora 
ATCC 24927]
Length=192

 Score =   268 bits (686),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVMLTLSKIRRAARQLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRAGILDDSRMKLDYVLALKIEDFLERRLQTQVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKA  604
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGR GR KRK  KA
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFGGGRAGRTKRKRSKA  179



>ref|XP_011180539.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera cucurbitae]
 ref|XP_011208927.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera dorsalis]
Length=195

 Score =   269 bits (687),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMK  180



>ref|XP_004518997.1| PREDICTED: 40S ribosomal protein S9-like [Ceratitis capitata]
Length=195

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMK  180



>emb|CDO74409.1| hypothetical protein BN946_scf184867.g7 [Trametes cinnabarina]
Length=193

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIGLILSKIRRAARELLKLDAK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLSLKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AAA
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRMAAAA  181



>ref|XP_008032443.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
 gb|EIW63864.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
Length=193

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIGLILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLSLKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AAA
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRVAAAA  181



>ref|XP_007360763.1| 40S ribosomal protein S9 [Dichomitus squalens LYAD-421 SS1]
 gb|EJF67372.1| 40S ribosomal protein S9 [Dichomitus squalens LYAD-421 SS1]
Length=193

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLD+ELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDSELKLAGEYGLRNKREIWRIGLILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLSLKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            RVLIRQ+HIRVG+Q+VNVPSF+VR++SQKHIDF+L+SP+GGGRPGRVKRK Q AAA
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLESQKHIDFALTSPYGGGRPGRVKRKRQAAAA  181



>gb|AET50489.1| hypothetical protein [Eimeria tenella]
 emb|CDJ43151.1| 40S ribosomal protein S9, putative [Eimeria tenella]
Length=188

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN  KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNQSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRVKRK+
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRVKRKS  176



>gb|AAX62465.1| ribosomal protein S9 [Lysiphlebus testaceipes]
 gb|AAX62466.1| ribosomal protein S9 variant 1 [Lysiphlebus testaceipes]
Length=194

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+    + + KT   PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNHRIPQVFSKTSVTPRRPYEKARLDQELKVIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKEPKRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMK  180

Query  602  AAA  610
               
Sbjct  181  KGT  183



>ref|XP_010274527.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=223

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 4/152 (3%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLA+TVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAVTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVV----NVPSF  505
            AKSIHHARVLIRQ+H+R G+ +V     VP++
Sbjct  121  AKSIHHARVLIRQRHVRRGQVLVVRRSGVPTY  152



>emb|CDJ32982.1| 40S ribosomal protein S9, putative [Eimeria mitis]
Length=188

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRVKRK
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRVKRK  175



>emb|CAH04322.1| S9e ribosomal protein [Meladema coriacea]
Length=193

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDPRR+FEG+ALLRR+ R G+LDE++ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPRRLFEGNALLRRLVRIGVLDENRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN +
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNSR  180



>emb|CDI78299.1| 40S ribosomal protein S9, putative [Eimeria acervulina]
 emb|CDI87489.1| 40S ribosomal protein S9, putative [Eimeria praecox]
 emb|CDJ56695.1| 40S ribosomal protein S9, putative [Eimeria maxima]
Length=188

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRVKRK
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRVKRK  175



>ref|XP_008544905.1| PREDICTED: 40S ribosomal protein S9 [Microplitis demolitor]
Length=193

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDES  KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDESHMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN +
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMR  180

Query  602  AAA  610
               
Sbjct  181  KGT  183



>gb|EMD42348.1| 40S ribosomal protein S9 [Ceriporiopsis subvermispora B]
Length=192

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIGLILSKIRRAARELLKLDPK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L VE+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLSLKVEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRVKRK   AAAK
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRVKRKRALAAAK  182



>ref|XP_001400515.1| 40S ribosomal protein S9 [Aspergillus niger CBS 513.88]
 emb|CAK37968.1| unnamed protein product [Aspergillus niger]
 gb|EHA23566.1| hypothetical protein ASPNIDRAFT_55644 [Aspergillus niger ATCC 
1015]
 dbj|GAA84261.1| 40S ribosomal protein S9 [Aspergillus kawachii IFO 4308]
Length=193

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV+RK
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRVQRK  175



>ref|XP_001263755.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
 gb|EAW21858.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
Length=193

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV+RK
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRVQRK  175



>ref|XP_001217311.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
 gb|EAU30857.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
Length=193

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV+RK
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRVQRK  175



>gb|EKC97706.1| 40S ribosomal protein S9-A [Trichosporon asahii var. asahii CBS 
8904]
Length=193

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R   KT+K P+RPYE  RLDAELKL GEYGLR KRE+WR+Q  LS+IR  AR LL LDEK
Sbjct  6    RKQSKTYKVPKRPYEAARLDAELKLAGEYGLRNKREIWRIQLTLSKIRRAARDLLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LD+++ +LDYVLAL  E+FLERRLQT VFK G+AKS+HHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDDTRMRLDYVLALKTEDFLERRLQTQVFKLGLAKSVHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAA  607
            RVLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDFSL SP+GGGRPGRVKRK  KAA
Sbjct  126  RVLIRQRHIRVGKQVVNVPSFVVRLDSQKHIDFSLKSPYGGGRPGRVKRKRAKAA  180



>ref|XP_008623589.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
 gb|KEG03665.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
Length=189

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK---NQKAAA  610
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRVKRK   NQK  A
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRVKRKTLRNQKEKA  184

Query  611  K  613
            +
Sbjct  185  E  185



>ref|XP_011497696.1| PREDICTED: 40S ribosomal protein S9 [Ceratosolen solmsi marchali]
Length=193

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD EL+++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKN  178



>ref|XP_001984182.1| GH15146 [Drosophila grimshawi]
 gb|EDV96530.1| GH15146 [Drosophila grimshawi]
Length=195

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMK  180



>gb|ETB62408.1| 40S ribosomal protein S9 [Plasmodium yoelii 17X]
 gb|ETB62409.1| 40S ribosomal protein S9, variant 1 [Plasmodium yoelii 17X]
 gb|ETB62410.1| 40S ribosomal protein S9, variant 2 [Plasmodium yoelii 17X]
 gb|EUD72327.1| 40S ribosomal protein [Plasmodium vinckei petteri]
 emb|CDR14909.1| 40S ribosomal protein S9, putative [Plasmodium chabaudi chabaudi]
 emb|CDU19544.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
 emb|CDZ13848.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
Length=189

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK---NQKAAA  610
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRVKRK   NQK  A
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRVKRKTLRNQKEKA  184

Query  611  K  613
            +
Sbjct  185  E  185



>emb|CCA67900.1| probable 40S ribosomal protein S9 [Piriformospora indica DSM 
11827]
Length=192

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD ELKL GEYGLR KRE+WR+   LS+IR  AR LL L+ K
Sbjct  6    RTYSKTYKVPRRPFESARLDMELKLAGEYGLRNKREIWRISLILSKIRRAARELLKLEAK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFKAG+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDETRMRLDYVLALKLEDFLERRLQTQVFKAGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAAK  613
            RVLIRQ+HIRVGRQ+VNVPSF+VR+DSQKHIDF+L+SPFGGGRPGRVKRK   AA K
Sbjct  126  RVLIRQRHIRVGRQIVNVPSFVVRLDSQKHIDFALTSPFGGGRPGRVKRKRAAAANK  182



>gb|ABX26127.1| ribosomal protein S9 [Haliotis discus discus]
Length=191

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  95   KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRR  274
            KT+  PRRP+EKERLD ELKL+GEYGLR KRE+WRV+Y L+RIR +AR LLTLDEK+PRR
Sbjct  10   KTYTTPRRPFEKERLDQELKLIGEYGLRNKREVWRVKYTLARIRKSARELLTLDEKEPRR  69

Query  275  IFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLI  454
            +FEG+ALLRR+ R G+LDE + KLDYVL L +E+FLERRLQT VFK G+AKSIHHARVLI
Sbjct  70   LFEGNALLRRLVRIGVLDEGKMKLDYVLGLRLEDFLERRLQTQVFKLGLAKSIHHARVLI  129

Query  455  RQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQKAAA  610
            RQ+HIRV +QVVN+PS++VR+DSQKHIDFSL SP+GGGRPGRVKRKN K   
Sbjct  130  RQRHIRVRKQVVNIPSYVVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGT  181



>emb|CAJ17220.1| ribosomal protein S9e [Sphaerius sp. APV-2005]
Length=193

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEKERLD ELK++GE+GLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKERLDNELKIIGEFGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+L E + KLDYVL LT+ +FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLGEGRMKLDYVLGLTITDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN +
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLR  180

Query  602  AAAK  613
              AK
Sbjct  181  KGAK  184



>gb|AAR09821.1| similar to Drosophila melanogaster RpS9, partial [Drosophila 
yakuba]
Length=191

 Score =   266 bits (681),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLK  180



>ref|XP_001956309.1| GF24655 [Drosophila ananassae]
 ref|XP_002062512.1| GK17575 [Drosophila willistoni]
 gb|EDV39115.1| GF24655 [Drosophila ananassae]
 gb|EDW73498.1| GK17575 [Drosophila willistoni]
Length=195

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLK  180



>ref|XP_001270715.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
 gb|EAW09289.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
Length=193

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRLKLDYVLALRIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV+RK
Sbjct  126  RVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRVQRK  175



>ref|XP_002047289.1| GJ13353 [Drosophila virilis]
 gb|EDW69631.1| GJ13353 [Drosophila virilis]
Length=195

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLK  180



>ref|NP_524004.2| ribosomal protein S9, isoform A [Drosophila melanogaster]
 ref|NP_729506.1| ribosomal protein S9, isoform D [Drosophila melanogaster]
 ref|NP_001287008.1| ribosomal protein S9, isoform E [Drosophila melanogaster]
 ref|XP_001972186.1| GG14025 [Drosophila erecta]
 ref|XP_002029892.1| GM24860 [Drosophila sechellia]
 ref|XP_002093291.1| RpS9 [Drosophila yakuba]
 ref|XP_002084280.1| GD12912 [Drosophila simulans]
 sp|P55935.2|RS9_DROME RecName: Full=40S ribosomal protein S9 [Drosophila melanogaster]
 pdb|3J38|J Chain J, Structure Of The D. Melanogaster 40s Ribosomal Proteins
 gb|AAF50249.1| ribosomal protein S9, isoform A [Drosophila melanogaster]
 gb|AAN11946.1| ribosomal protein S9, isoform D [Drosophila melanogaster]
 gb|EDV51212.1| GG14025 [Drosophila erecta]
 gb|EDW40878.1| GM24860 [Drosophila sechellia]
 gb|EDW93003.1| RpS9 [Drosophila yakuba]
 gb|EDX09865.1| GD12912 [Drosophila simulans]
 gb|ACT80127.1| LD13662p [Drosophila melanogaster]
 gb|AHN58033.1| ribosomal protein S9, isoform E [Drosophila melanogaster]
Length=195

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLK  180



>gb|ACO10247.1| 40S ribosomal protein S9 [Caligus rogercresseyi]
Length=190

 Score =   266 bits (680),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+     N  K F  PRRP+EK RLD ELKL+GEYGLR KRE+WRV++ L++IR  AR 
Sbjct  1    MVNGRIPTNRSKVFTTPRRPFEKTRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDPRR+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPRRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSL SPF GG+PGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLKSPFVGGKPGRVKRKNSK  180

Query  602  AAA  610
               
Sbjct  181  KGG  183



>ref|XP_001352621.1| GA28351 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002024847.1| GL17960 [Drosophila persimilis]
 ref|XP_002029028.1| GL20135 [Drosophila persimilis]
 ref|XP_002029552.1| GL21280 [Drosophila persimilis]
 gb|EAL30119.1| GA28351 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW25738.1| GL21280 [Drosophila persimilis]
 gb|EDW30320.1| GL17960 [Drosophila persimilis]
 gb|EDW39426.1| GL20135 [Drosophila persimilis]
Length=195

 Score =   266 bits (680),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLK  180



>emb|CCQ18585.1| 40S ribosomal protein S9 [Sycon ciliatum]
Length=194

 Score =   266 bits (680),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
             KTF  PRRP+EK RLD ELKL+GEYGLR KRE+WRV+YAL++IR  AR LLTLDEKDP+
Sbjct  6    SKTFVTPRRPFEKARLDQELKLIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDPK  65

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+ALLRR+ R G+LDE + KLD+VL L VE+FLERRLQT VFK G+AKSIHHARVL
Sbjct  66   RLFEGNALLRRLVRIGVLDEQRMKLDFVLGLKVEDFLERRLQTQVFKLGLAKSIHHARVL  125

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            IRQ+HIRV +QVVNVPSF+VR+DSQKHIDFS+ SPFGGGRPGR KRKN
Sbjct  126  IRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSMKSPFGGGRPGRCKRKN  173



>gb|ADT80642.1| ribosomal protein S9 [Euphydryas aurinia]
 gb|AEL28821.1| ribosomal protein S9 [Heliconius melpomene cythera]
Length=194

 Score =   266 bits (680),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKN  178



>gb|ADO95157.1| ribosomal protein S9 [Antheraea yamamai]
Length=194

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRVGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKN  178



>ref|NP_001037265.1| ribosomal protein S9 [Bombyx mori]
 gb|AAV34865.1| ribosomal protein S9 [Bombyx mori]
Length=194

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKN  178



>emb|CDJ50108.1| 40S ribosomal protein S9, putative [Eimeria brunetti]
Length=188

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQY L++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYVLAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRK  592
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRVKRK
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRVKRK  175



>ref|XP_005181976.1| PREDICTED: 40S ribosomal protein S9 [Musca domestica]
Length=194

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNMK  180



>ref|XP_007256932.1| PREDICTED: 40S ribosomal protein S9-like [Astyanax mexicanus]
Length=194

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
             KT+  PRRP+EK RLD ELKL+GEYGLR KRE+WRV++ L++IR  AR LLTLDEKDP+
Sbjct  10   SKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPK  69

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+ALLRR+ R G+LDES+ KLDY+L L VE+FLERRLQT VFK G+AKSIHHARVL
Sbjct  70   RLFEGNALLRRLVRIGVLDESKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVL  129

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            IRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SP+GGGRPGRVKRKN K
Sbjct  130  IRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAK  179



>dbj|BAM17690.1| ribosomal protein S9 [Papilio xuthus]
Length=194

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFVVRLDSGKHIDFSLKSPFGGGRPGRVKRKN  178



>emb|CDS49582.1| 40S ribosomal protein S9, putative [Plasmodium berghei ANKA]
Length=189

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKR---KNQKAAA  610
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRVKR   +NQK  A
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRVKRRTLRNQKEKA  184



>gb|EHJ71338.1| ribosomal protein S9 [Danaus plexippus]
Length=194

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKN  595
            AKSIHHAR+LIRQ+HIRV +Q+VN+PSF+VR+DS KHIDFSL SPFGGGRPGRVKRKN
Sbjct  121  AKSIHHARILIRQRHIRVRKQIVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKN  178



>ref|XP_001945527.1| PREDICTED: 40S ribosomal protein S9 [Acyrthosiphon pisum]
 gb|AFN37233.1| ribosomal protein s9 [Aphis glycines]
Length=197

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      Y KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVYSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKD +R+FEG+ALLRR+ R G+LDE + KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDQKRLFEGNALLRRLVRIGVLDEGRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRVKRKNQK  601
            AKSIHHARVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSL SPFGGGRPGRVKRKN +
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNVPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLR  180

Query  602  AA  607
             A
Sbjct  181  KA  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660