BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006E11 210 bp,:Filtered

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002489033.1|  hypothetical protein SORBIDRAFT_0351s002020      71.2    1e-14   Sorghum bicolor [broomcorn]
ref|XP_004154316.1|  PREDICTED: uncharacterized protein LOC101218508  71.2    4e-14   
gb|ABI52743.1|  10 kDa putative secreted protein                      67.4    1e-12   Argas monolakensis
gb|ETW38010.1|  hypothetical protein PFTANZ_01288                     64.3    1e-11   Plasmodium falciparum Tanzania (2000708)
gb|EWC78008.1|  hypothetical protein C923_01320                       63.5    1e-11   Plasmodium falciparum UGT5.1
ref|XP_724982.1|  hypothetical protein                                63.2    6e-11   Plasmodium yoelii yoelii 17XNL
gb|EZA46947.1|  hypothetical protein X777_00562                       60.1    3e-10   Cerapachys biroi
emb|CDW60996.1|  hypothetical protein TTRE_0000940601                 63.2    4e-10   Trichuris trichiura
emb|CDW60983.1|  hypothetical protein TTRE_0000939101                 63.5    5e-10   Trichuris trichiura
emb|CCD58743.1|  unnamed protein product                              60.1    6e-10   Schistosoma mansoni
gb|KFD59988.1|  LOW QUALITY PROTEIN: hypothetical protein M514_27836  63.5    8e-10   Trichuris suis
ref|WP_043914893.1|  hypothetical protein                             59.3    1e-09   Candidatus Regiella insecticola
ref|XP_009517221.1|  hypothetical protein PHYSODRAFT_469960           58.9    1e-09   Phytophthora sojae
ref|XP_008187637.1|  PREDICTED: uncharacterized protein LOC103310617  58.9    3e-09   
gb|KFD59990.1|  hypothetical protein M514_27838                       54.3    6e-08   Trichuris suis
ref|XP_003370102.1|  conserved hypothetical protein                   54.3    2e-07   Trichinella spiralis
gb|ETW43516.1|  hypothetical protein PFNF135_02053                    52.8    3e-07   Plasmodium falciparum NF135/5.C10
gb|ETW62206.1|  hypothetical protein PFMC_01898                       53.1    3e-07   Plasmodium falciparum CAMP/Malaysia
ref|XP_729764.1|  hypothetical protein                                52.8    6e-07   Plasmodium yoelii yoelii 17XNL
gb|ETW30933.1|  hypothetical protein PFFCH_01650                      51.6    6e-07   Plasmodium falciparum FCH/4
gb|ETW49989.1|  hypothetical protein PFMALIP_01957                    51.6    7e-07   Plasmodium falciparum MaliPS096_E11
gb|KGN53990.1|  hypothetical protein Csa_4G243140                     49.7    3e-06   Cucumis sativus [cucumbers]
ref|XP_002489041.1|  hypothetical protein SORBIDRAFT_0285s002020      48.9    4e-06   Sorghum bicolor [broomcorn]
gb|ETW52662.1|  hypothetical protein PFUGPA_05668                     50.8    2e-05   Plasmodium falciparum Palo Alto/Uganda
ref|XP_007324730.1|  hypothetical protein SERLADRAFT_353212           47.4    3e-05   Serpula lacrymans var. lacrymans S7.9
ref|XP_002488947.1|  hypothetical protein SORBIDRAFT_1368s002010      47.0    4e-05   Sorghum bicolor [broomcorn]
gb|KIM19403.1|  hypothetical protein M408DRAFT_83569                  46.6    4e-05   Serendipita vermifera MAFF 305830
gb|ADI72888.1|  hypothetical protein                                  46.6    4e-05   Ophiocordyceps unilateralis
ref|XP_006455550.1|  hypothetical protein AGABI2DRAFT_75975           46.6    4e-05   Agaricus bisporus var. bisporus H97
gb|EJU02319.1|  hypothetical protein DACRYDRAFT_51577                 46.6    4e-05   Dacryopinax primogenitus
gb|EMF07894.1|  hypothetical protein SEPMUDRAFT_55199                 46.6    5e-05   Sphaerulina musiva SO2202
gb|KIJ09673.1|  hypothetical protein PAXINDRAFT_177523                46.6    5e-05   Paxillus involutus ATCC 200175
ref|XP_006960893.1|  hypothetical protein WALSEDRAFT_4042             46.2    5e-05   Wallemia mellicola CBS 633.66
ref|XP_009550271.1|  hypothetical protein HETIRDRAFT_421044           46.6    5e-05   Heterobasidion irregulare TC 32-1
ref|XP_007402182.1|  hypothetical protein PHACADRAFT_167261           46.6    5e-05   Phanerochaete carnosa HHB-10118-sp
gb|AGV54793.1|  hypothetical protein                                  48.5    5e-05   Phaseolus vulgaris [French bean]
gb|KFM58614.1|  hypothetical protein X975_11578                       45.8    5e-05   Stegodyphus mimosarum
gb|KDQ49126.1|  hypothetical protein JAAARDRAFT_143876                46.6    5e-05   Jaapia argillacea MUCL 33604
ref|XP_007311851.1|  hypothetical protein STEHIDRAFT_23631            46.6    5e-05   Stereum hirsutum FP-91666 SS1
ref|XP_003851048.1|  hypothetical protein MYCGRDRAFT_74254            46.2    6e-05   Zymoseptoria tritici IPO323
gb|EMD91246.1|  hypothetical protein COCHEDRAFT_1103737               46.2    6e-05   Bipolaris maydis C5
gb|EME38015.1|  hypothetical protein DOTSEDRAFT_181978                46.2    6e-05   Dothistroma septosporum NZE10
ref|XP_008037273.1|  hypothetical protein TRAVEDRAFT_36643            46.6    6e-05   Trametes versicolor FP-101664 SS1
ref|XP_007929417.1|  hypothetical protein MYCFIDRAFT_141089           46.2    6e-05   Cercospora fijiensis CIRAD86
ref|XP_004389677.1|  PREDICTED: aryl hydrocarbon receptor nuclear...  49.3    6e-05   
gb|KIK74324.1|  hypothetical protein PAXRUDRAFT_176058                45.8    6e-05   Paxillus rubicundulus Ve08.2h10
ref|XP_007324734.1|  hypothetical protein SERLADRAFT_353240           43.1    9e-05   Serpula lacrymans var. lacrymans S7.9
ref|XP_001887546.1|  predicted protein                                45.8    1e-04   Laccaria bicolor S238N-H82
gb|EMD30512.1|  hypothetical protein CERSUDRAFT_61093                 45.8    1e-04   Gelatoporia subvermispora B
ref|XP_007324736.1|  hypothetical protein SERLADRAFT_353288           43.1    1e-04   Serpula lacrymans var. lacrymans S7.9
gb|EHK21458.1|  hypothetical protein TRIVIDRAFT_139669                45.1    1e-04   Trichoderma virens Gv29-8
ref|XP_001624697.1|  predicted protein                                45.1    1e-04   Nematostella vectensis
gb|EHK48570.1|  hypothetical protein TRIATDRAFT_55202                 45.1    1e-04   Trichoderma atroviride IMI 206040
ref|XP_001620119.1|  hypothetical protein NEMVEDRAFT_v1g149069        44.7    1e-04   Nematostella vectensis
ref|XP_003666597.1|  hypothetical protein MYCTH_2071504               45.1    2e-04   Myceliophthora thermophila ATCC 42464
ref|XP_001618625.1|  hypothetical protein NEMVEDRAFT_v1g69194         44.7    2e-04   Nematostella vectensis
emb|CBJ34222.1|  conserved unknown protein                            45.1    2e-04   Ectocarpus siliculosus
gb|KDR65247.1|  hypothetical protein GALMADRAFT_82099                 45.4    2e-04   Galerina marginata CBS 339.88
ref|XP_003654189.1|  hypothetical protein THITE_2049959               44.7    2e-04   Thielavia terrestris NRRL 8126
ref|XP_001617556.1|  hypothetical protein NEMVEDRAFT_v1g78756         44.3    2e-04   Nematostella vectensis
ref|XP_007049619.1|  Uncharacterized protein TCM_002697               44.7    2e-04   Theobroma cacao [chocolate]
gb|EGZ74234.1|  hypothetical protein NEUTE2DRAFT_76202                44.7    2e-04   Neurospora tetrasperma FGSC 2509
ref|XP_001624571.1|  predicted protein                                44.7    2e-04   Nematostella vectensis
gb|EJY65597.1|  hypothetical protein OXYTRI_14248                     47.8    2e-04   Oxytricha trifallax
gb|EJY66653.1|  hypothetical protein OXYTRI_13058                     47.8    3e-04   Oxytricha trifallax
gb|EMF07912.1|  hypothetical protein SEPMUDRAFT_55174                 43.9    4e-04   Sphaerulina musiva SO2202
ref|XP_009846274.1|  hypothetical protein H257_18840                  45.1    4e-04   Aphanomyces astaci
ref|XP_001618098.1|  hypothetical protein NEMVEDRAFT_v1g155763        42.7    0.001   Nematostella vectensis



>ref|XP_002489033.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor]
 gb|EES20475.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor]
Length=55

 Score = 71.2 bits (173),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARD  6
            +TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA ARD
Sbjct  8    KTAGRWSWKSKSAKECVTTHLPNQLAPKMDGAEARD  43



>ref|XP_004154316.1| PREDICTED: uncharacterized protein LOC101218508, partial [Cucumis 
sativus]
Length=108

 Score = 71.2 bits (173),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARDL  3
            +TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA A DL
Sbjct  9    KTAGRWSWKSKSAKECVTTHLPNQLAPKMDGAEACDL  45



>gb|ABI52743.1| 10 kDa putative secreted protein [Argas monolakensis]
Length=102

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  IRSERTIIL*RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARDL  3
            +RS     L RTAGRW WK +SAKECVTTHLP QLAPKMDGA A +L
Sbjct  1    MRSHEGCWLLRTAGRWPWKLESAKECVTTHLPKQLAPKMDGAIASNL  47



>gb|ETW38010.1| hypothetical protein PFTANZ_01288 [Plasmodium falciparum Tanzania 
(2000708)]
Length=83

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  143  IRSERTIIL*RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            +RS +      T GRWSWKSKSAKECVTTHLPN+LA KMDGA
Sbjct  17   MRSHKRCWFIMTVGRWSWKSKSAKECVTTHLPNELALKMDGA  58



>gb|EWC78008.1| hypothetical protein C923_01320 [Plasmodium falciparum UGT5.1]
Length=55

 Score = 63.5 bits (153),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            T GRWSWKSKSAKECVTTHLPN+LA KMDGA
Sbjct  2    TVGRWSWKSKSAKECVTTHLPNELALKMDGA  32



>ref|XP_724982.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA16547.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=124

 Score = 63.2 bits (152),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            T GRWSWKSKSAKECVTTHLPN+LA KMDGA
Sbjct  2    TVGRWSWKSKSAKECVTTHLPNELALKMDGA  32



>gb|EZA46947.1| hypothetical protein X777_00562 [Cerapachys biroi]
Length=70

 Score = 60.1 bits (144),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = -2

Query  134  ERTIIL*RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARDL  3
            ER  +L +TAGRW WKS+SAKECVTTHLP QLA KMDGA A  L
Sbjct  5    ERRWLL-KTAGRWPWKSESAKECVTTHLPKQLALKMDGAEASSL  47



>emb|CDW60996.1| hypothetical protein TTRE_0000940601 [Trichuris trichiura]
Length=350

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  111  DSRTVVMEVEIR*GVCNNSPAESTSPENGWRLSARPI  1
            DSRTV MEV IR GVCNNSPAESTSPENGWR SA P+
Sbjct  279  DSRTVAMEVGIRQGVCNNSPAESTSPENGWRSSAEPV  315



>emb|CDW60983.1| hypothetical protein TTRE_0000939101 [Trichuris trichiura]
Length=500

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    GRALKRHPFSGLVDSAGELLHTP*RISTSMTTVLLSV  115
            G AL+RHPFSGLVDSAGELLHTP RI TSM TVLLS+
Sbjct  414  GSALERHPFSGLVDSAGELLHTPWRIPTSMATVLLSI  450



>emb|CCD58743.1| unnamed protein product [Schistosoma mansoni]
Length=98

 Score = 60.1 bits (144),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  18   SAIHFRG*LIRQVSCYTLLSGFRLP*PPSCC  110
            SAIHF+G LIRQVSCYTLLSGFRLP PPSCC
Sbjct  18   SAIHFQGWLIRQVSCYTLLSGFRLPWPPSCC  48



>gb|KFD59988.1| LOW QUALITY PROTEIN: hypothetical protein M514_27836 [Trichuris 
suis]
Length=791

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    GRALKRHPFSGLVDSAGELLHTP*RISTSMTTVLLSV  115
            G AL+RHPFSGLVDSAGELLHTP RI TSM TVLLS+
Sbjct  274  GSALERHPFSGLVDSAGELLHTPWRIPTSMATVLLSI  310



>ref|WP_043914893.1| hypothetical protein [Candidatus Regiella insecticola]
Length=105

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            TAGRW WKS+SAKECVTTHLP QLA KMDGA
Sbjct  2    TAGRWPWKSESAKECVTTHLPKQLALKMDGA  32



>ref|XP_009517221.1| hypothetical protein PHYSODRAFT_469960, partial [Phytophthora 
sojae]
 gb|EGZ29946.1| hypothetical protein PHYSODRAFT_469960 [Phytophthora sojae]
Length=95

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDG  21
            TAGRW WKS+SAKECVTTHLPN+LA KMDG
Sbjct  1    TAGRWPWKSESAKECVTTHLPNELALKMDG  30



>ref|XP_008187637.1| PREDICTED: uncharacterized protein LOC103310617 [Acyrthosiphon 
pisum]
Length=159

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            TAGRW WKS+SAKECVTTHLP QLA KMDGA
Sbjct  2    TAGRWPWKSESAKECVTTHLPKQLALKMDGA  32



>gb|KFD59990.1| hypothetical protein M514_27838 [Trichuris suis]
Length=63

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  93  MEVEIR*GVCNNSPAESTSPENGWRLSARPI  1
           MEV IR GVCNNSPAESTSPENGWR SA P+
Sbjct  1   MEVGIRQGVCNNSPAESTSPENGWRSSAEPV  31



>ref|XP_003370102.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46916.1| conserved hypothetical protein [Trichinella spiralis]
Length=229

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    IGRALKRHPFSGLVDSAGELLHTP*RISTSMTT  100
            +G  LKR+PFSGLVDSAGELLHTP RI TSM T
Sbjct  172  MGLELKRYPFSGLVDSAGELLHTPWRIPTSMAT  204



>gb|ETW43516.1| hypothetical protein PFNF135_02053 [Plasmodium falciparum NF135/5.C10]
Length=84

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            T GR+SWK K AKECV THLP++LA  MDGA
Sbjct  3    TVGRYSWKLKFAKECVITHLPSELALIMDGA  33



>gb|ETW62206.1| hypothetical protein PFMC_01898 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR73344.1| hypothetical protein PFBG_01958 [Plasmodium falciparum 7G8]
 gb|EUT87562.1| hypothetical protein PFAG_01886 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC77296.1| hypothetical protein C923_02040 [Plasmodium falciparum UGT5.1]
Length=121

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            T GR+SWK K AKECV THLP++LA  MDGA
Sbjct  3    TVGRYSWKLKFAKECVITHLPSELALIMDGA  33



>ref|XP_729764.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21329.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=193

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  20   RHPFSGLVDSAGELLHTP*RISTSMTTVLL  109
            RHPFSGLV S GELLHTP RISTSM TVLL
Sbjct  57   RHPFSGLVHSVGELLHTPWRISTSMITVLL  86



>gb|ETW30933.1| hypothetical protein PFFCH_01650 [Plasmodium falciparum FCH/4]
Length=81

 Score = 51.6 bits (122),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARDL  3
            T GR+SWK K AKECV THLP++LA  MDGA   D+
Sbjct  3    TVGRYSWKLKFAKECVITHLPSELALIMDGAKLFDM  38



>gb|ETW49989.1| hypothetical protein PFMALIP_01957 [Plasmodium falciparum MaliPS096_E11]
Length=81

 Score = 51.6 bits (122),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA*ARDL  3
            T GR+SWK K AKECV THLP++LA  MDGA   D+
Sbjct  3    TVGRYSWKLKFAKECVITHLPSELALIMDGAKLFDM  38



>gb|KGN53990.1| hypothetical protein Csa_4G243140 [Cucumis sativus]
Length=86

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHTP  73
           IGRAL+RHPFSGLVDSAGELLHTP
Sbjct  63  IGRALQRHPFSGLVDSAGELLHTP  86



>ref|XP_002489041.1| hypothetical protein SORBIDRAFT_0285s002020 [Sorghum bicolor]
 gb|EES20451.1| hypothetical protein SORBIDRAFT_0285s002020 [Sorghum bicolor]
Length=67

 Score = 48.9 bits (115),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHTP  73
           +GRAL+RHPFSGLVDSAGELLHTP
Sbjct  44  VGRALQRHPFSGLVDSAGELLHTP  67



>gb|ETW52662.1| hypothetical protein PFUGPA_05668 [Plasmodium falciparum Palo 
Alto/Uganda]
Length=486

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  110  TAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            T GR+SWK K AKECV THLP++LA  MDGA
Sbjct  3    TVGRYSWKLKFAKECVITHLPSELALIMDGA  33



>ref|XP_007324730.1| hypothetical protein SERLADRAFT_353212 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007324739.1| hypothetical protein SERLADRAFT_353292, partial [Serpula lacrymans 
var. lacrymans S7.9]
 ref|XP_007324742.1| hypothetical protein SERLADRAFT_353306, partial [Serpula lacrymans 
var. lacrymans S7.9]
 ref|XP_007324746.1| hypothetical protein SERLADRAFT_353235, partial [Serpula lacrymans 
var. lacrymans S7.9]
 gb|EGN91347.1| hypothetical protein SERLA73DRAFT_67568 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGN91395.1| hypothetical protein SERLA73DRAFT_67493 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGN91491.1| hypothetical protein SERLA73DRAFT_67318 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO18703.1| hypothetical protein SERLADRAFT_353212 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18712.1| hypothetical protein SERLADRAFT_353292 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18715.1| hypothetical protein SERLADRAFT_353306 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18719.1| hypothetical protein SERLADRAFT_353235 [Serpula lacrymans var. 
lacrymans S7.9]
Length=93

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 7/38 (18%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC-------PLKDDCAL  134
             IRQVSCYTLLSGFRLP PPSCC        + D+CA 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDECAF  38



>ref|XP_002488947.1| hypothetical protein SORBIDRAFT_1368s002010 [Sorghum bicolor]
 gb|EES20264.1| hypothetical protein SORBIDRAFT_1368s002010 [Sorghum bicolor]
Length=85

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHT  70
           +GRAL+RHPFSGLVDSAGELLHT
Sbjct  63  VGRALQRHPFSGLVDSAGELLHT  85



>gb|KIM19403.1| hypothetical protein M408DRAFT_83569, partial [Serendipita vermifera 
MAFF 305830]
Length=71

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|ADI72888.1| hypothetical protein, partial [Ophiocordyceps unilateralis]
Length=72

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_006455550.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus 
var. bisporus H97]
 ref|XP_007335031.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 ref|XP_007335729.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM73631.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM74330.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKV44289.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus 
var. bisporus H97]
Length=93

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|EJU02319.1| hypothetical protein DACRYDRAFT_51577, partial [Dacryopinax sp. 
DJM-731 SS1]
Length=88

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|EMF07894.1| hypothetical protein SEPMUDRAFT_55199, partial [Sphaerulina musiva 
SO2202]
Length=72

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|KIJ09673.1| hypothetical protein PAXINDRAFT_177523 [Paxillus involutus ATCC 
200175]
Length=114

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  22   FIRQVSCYTLLSGFRLPWPPSCC  44



>ref|XP_006960893.1| hypothetical protein WALSEDRAFT_4042, partial [Wallemia sebi 
CBS 633.66]
 gb|EIM19060.1| hypothetical protein WALSEDRAFT_4042, partial [Wallemia sebi 
CBS 633.66]
Length=61

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_009550271.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare 
TC 32-1]
 gb|EMD31867.1| hypothetical protein CERSUDRAFT_109224 [Ceriporiopsis subvermispora 
B]
 gb|ETW78290.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare 
TC 32-1]
Length=103

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  11   FIRQVSCYTLLSGFRLPWPPSCC  33



>ref|XP_007402182.1| hypothetical protein PHACADRAFT_167261 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM49264.1| hypothetical protein PHACADRAFT_167261 [Phanerochaete carnosa 
HHB-10118-sp]
Length=90

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  11   FIRQVSCYTLLSGFRLPWPPSCC  33



>gb|AGV54793.1| hypothetical protein [Phaseolus vulgaris]
Length=294

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 29/41 (71%), Gaps = 9/41 (22%)
 Frame = -3

Query  109  QQDGGHGSRNPLRSV-----*QLTCRIN*PRKWMALKRATY  2
            QQDGGHGSRNPLRSV      + T R    RKWMALKRATY
Sbjct  246  QQDGGHGSRNPLRSVETTQPAESTSR----RKWMALKRATY  282



>gb|KFM58614.1| hypothetical protein X975_11578, partial [Stegodyphus mimosarum]
Length=47

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGFRLP PPSCC
Sbjct  1    LLRQVSCYTLLSGFRLPWPPSCC  23



>gb|KDQ49126.1| hypothetical protein JAAARDRAFT_143876, partial [Jaapia argillacea 
MUCL 33604]
 gb|KDQ49133.1| hypothetical protein JAAARDRAFT_114037, partial [Jaapia argillacea 
MUCL 33604]
Length=93

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_007311851.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum 
FP-91666 SS1]
 ref|XP_007311972.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum 
FP-91666 SS1]
 ref|XP_008045698.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EGZ76071.1| hypothetical protein NEUTE2DRAFT_76164, partial [Neurospora tetrasperma 
FGSC 2509]
 gb|EIM78931.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM79048.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum 
FP-91666 SS1]
 gb|EIW51411.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor 
FP-101664 SS1]
Length=93

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, partial [Zymoseptoria 
tritici IPO323]
 ref|XP_003851054.1| hypothetical protein MYCGRDRAFT_74248, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP86024.1| hypothetical protein MYCGRDRAFT_74254 [Zymoseptoria tritici IPO323]
 gb|EGP86030.1| hypothetical protein MYCGRDRAFT_74248 [Zymoseptoria tritici IPO323]
Length=88

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|EMD91246.1| hypothetical protein COCHEDRAFT_1103737, partial [Bipolaris maydis 
C5]
 gb|ENH98553.1| hypothetical protein COCC4DRAFT_155479, partial [Bipolaris maydis 
ATCC 48331]
Length=79

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>gb|EME38015.1| hypothetical protein DOTSEDRAFT_181978, partial [Dothistroma 
septosporum NZE10]
Length=88

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_008037273.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 
SS1]
 gb|EIW59146.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 
SS1]
Length=112

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  15   LSAIHFRG*LIRQVSCYTLLSGFRLP*PPSCC  110
            L A + R   IRQVSCYTLLSGFRLP PPSCC
Sbjct  11   LWAPYARYGFIRQVSCYTLLSGFRLPWPPSCC  42



>ref|XP_007929417.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME80502.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora 
fijiensis CIRAD86]
Length=88

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFRLP PPSCC
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_004389677.1| PREDICTED: aryl hydrocarbon receptor nuclear translocator [Trichechus 
manatus latirostris]
Length=826

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  143  IRSERTIIL*RTAGRWSWKSKSAKECVTTHLPNQLAPKMDGA  18
            IR ++   L +TAG W W S+SAKE VTTH PNQLA K DGA
Sbjct  5    IRPQKRCWLIQTAGWWPWTSESAKERVTTHQPNQLALKTDGA  46



>gb|KIK74324.1| hypothetical protein PAXRUDRAFT_176058, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=72

 Score = 45.8 bits (107),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYTLLSGFRLP PPSCC
Sbjct  2    IRQVSCYTLLSGFRLPWPPSCC  23



>ref|XP_007324734.1| hypothetical protein SERLADRAFT_353240 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18707.1| hypothetical protein SERLADRAFT_353240 [Serpula lacrymans var. 
lacrymans S7.9]
Length=91

 Score = 43.1 bits (100),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = +3

Query  30   FRG*LIRQVSCYTLLSGFRLP*PPSCC-------PLKDDCAL  134
            F G +   VSCYTLLSGFRLP PPSCC        + D+CA 
Sbjct  10   FSGLVHSAVSCYTLLSGFRLPWPPSCCLDELTPFVVSDECAF  51


 Score = 29.3 bits (64),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSA  52
           +G  L+RHPFSGLV SA
Sbjct  1   MGNTLERHPFSGLVHSA  17



>ref|XP_001887546.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR01733.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=93

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYTLLSGFR P PPSCC
Sbjct  1    FIRQVSCYTLLSGFRFPWPPSCC  23



>gb|EMD30512.1| hypothetical protein CERSUDRAFT_61093, partial [Ceriporiopsis 
subvermispora B]
Length=94

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_007324736.1| hypothetical protein SERLADRAFT_353288 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18709.1| hypothetical protein SERLADRAFT_353288 [Serpula lacrymans var. 
lacrymans S7.9]
Length=106

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = +3

Query  30   FRG*LIRQVSCYTLLSGFRLP*PPSCC-------PLKDDCAL  134
            F G +   VSCYTLLSGFRLP PPSCC        + D+CA 
Sbjct  10   FSGLVHSAVSCYTLLSGFRLPWPPSCCLDELTPFVVSDECAF  51


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSA  52
           +G  L+RHPFSGLV SA
Sbjct  1   MGNTLERHPFSGLVHSA  17



>gb|EHK21458.1| hypothetical protein TRIVIDRAFT_139669, partial [Trichoderma 
virens Gv29-8]
 gb|EHK21462.1| hypothetical protein TRIVIDRAFT_139677, partial [Trichoderma 
virens Gv29-8]
 gb|EHK21466.1| hypothetical protein TRIVIDRAFT_139674, partial [Trichoderma 
virens Gv29-8]
 gb|EHK21470.1| hypothetical protein TRIVIDRAFT_139672, partial [Trichoderma 
virens Gv29-8]
 gb|EHK21474.1| hypothetical protein TRIVIDRAFT_139673, partial [Trichoderma 
virens Gv29-8]
Length=60

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_001624697.1| predicted protein [Nematostella vectensis]
 gb|EDO32597.1| predicted protein, partial [Nematostella vectensis]
Length=70

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGF+LP PPSCC
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCC  23



>gb|EHK48570.1| hypothetical protein TRIATDRAFT_55202, partial [Trichoderma atroviride 
IMI 206040]
Length=85

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_001620119.1| hypothetical protein NEMVEDRAFT_v1g149069 [Nematostella vectensis]
 gb|EDO28019.1| predicted protein, partial [Nematostella vectensis]
Length=59

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGF+LP PPSCC
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCC  23



>ref|XP_003666597.1| hypothetical protein MYCTH_2071504, partial [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61352.1| hypothetical protein MYCTH_2071504, partial [Myceliophthora thermophila 
ATCC 42464]
Length=72

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_001618625.1| hypothetical protein NEMVEDRAFT_v1g69194 [Nematostella vectensis]
 ref|XP_001624556.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO26525.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32456.1| predicted protein, partial [Nematostella vectensis]
Length=63

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGF+LP PPSCC
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCC  23



>emb|CBJ34222.1| conserved unknown protein [Ectocarpus siliculosus]
 emb|CBJ33762.1| conserved unknown protein [Ectocarpus siliculosus]
Length=86

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHTP  73
           I R+L+RHPFSGLV SAGELLHTP
Sbjct  63  ISRSLQRHPFSGLVHSAGELLHTP  86



>gb|KDR65247.1| hypothetical protein GALMADRAFT_82099, partial [Galerina marginata 
CBS 339.88]
Length=147

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
             IRQVSCYT LSGFRLP PPSCC
Sbjct  55   FIRQVSCYTFLSGFRLPWPPSCC  77



>ref|XP_003654189.1| hypothetical protein THITE_2049959, partial [Thielavia terrestris 
NRRL 8126]
 ref|XP_003654192.1| hypothetical protein THITE_2050013, partial [Thielavia terrestris 
NRRL 8126]
 gb|AEO67853.1| hypothetical protein THITE_2049959, partial [Thielavia terrestris 
NRRL 8126]
 gb|AEO67856.1| hypothetical protein THITE_2050013, partial [Thielavia terrestris 
NRRL 8126]
Length=72

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_001617556.1| hypothetical protein NEMVEDRAFT_v1g78756 [Nematostella vectensis]
 gb|EDO25456.1| predicted protein, partial [Nematostella vectensis]
Length=53

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGF+LP PPSCC
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCC  23



>ref|XP_007049619.1| Uncharacterized protein TCM_002697 [Theobroma cacao]
 gb|EOX93776.1| Uncharacterized protein TCM_002697 [Theobroma cacao]
Length=86

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHTP  73
           IG AL+RHPFSGLVDSA ELLHTP
Sbjct  63  IGLALQRHPFSGLVDSASELLHTP  86



>gb|EGZ74234.1| hypothetical protein NEUTE2DRAFT_76202, partial [Neurospora tetrasperma 
FGSC 2509]
 gb|EGZ76055.1| hypothetical protein NEUTE2DRAFT_76187, partial [Neurospora tetrasperma 
FGSC 2509]
Length=72

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCC  23



>ref|XP_001624571.1| predicted protein [Nematostella vectensis]
 gb|EDO32471.1| predicted protein, partial [Nematostella vectensis]
Length=90

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  42   LIRQVSCYTLLSGFRLP*PPSCC  110
            L+RQVSCYTLLSGF+LP PPSCC
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCC  23



>gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax]
Length=1367

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IGRALKRHPFSGLVDSAGELLHTP*RISTSM  94
            IGR L+RHPFSGLV SAGELLHTP R   S+
Sbjct  637  IGRTLQRHPFSGLVHSAGELLHTPQRYLMSV  667



>gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax]
Length=1367

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IGRALKRHPFSGLVDSAGELLHTP*RISTSM  94
            IGR L+RHPFSGLV SAGELLHTP R   S+
Sbjct  637  IGRTLQRHPFSGLVHSAGELLHTPQRYLMSV  667



>gb|EMF07912.1| hypothetical protein SEPMUDRAFT_55174, partial [Sphaerulina musiva 
SO2202]
Length=86

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   RQVSCYTLLSGFRLP*PPSCC  110
            RQVSCYTLLSGFRLP PPSCC
Sbjct  1    RQVSCYTLLSGFRLPWPPSCC  21



>ref|XP_009846274.1| hypothetical protein H257_18840, partial [Aphanomyces astaci]
 gb|ETV64240.1| hypothetical protein H257_18840, partial [Aphanomyces astaci]
Length=201

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   IRQVSCYTLLSGFRLP*PPSCC  110
            IRQVSCYT+LSGFRLP PPSCC
Sbjct  39   IRQVSCYTVLSGFRLPWPPSCC  60



>ref|XP_001618098.1| hypothetical protein NEMVEDRAFT_v1g155763 [Nematostella vectensis]
 gb|EDO25998.1| predicted protein, partial [Nematostella vectensis]
Length=83

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  2   IGRALKRHPFSGLVDSAGELLHTP  73
           IG  L+RHPFSGLV SAGELLHTP
Sbjct  60  IGATLERHPFSGLVASAGELLHTP  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561945875400