BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006E07 594 bp,

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  197   2e-57   Sesamum indicum [beniseed]
emb|CBI19558.3|  unnamed protein product                                196   8e-57   Vitis vinifera
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  195   1e-56   Vitis vinifera
emb|CAN68798.1|  hypothetical protein VITISV_008805                     195   1e-56   Vitis vinifera
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  193   5e-56   Solanum lycopersicum
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  193   5e-56   Vitis vinifera
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  193   6e-56   Vitis vinifera
emb|CBI19560.3|  unnamed protein product                                195   6e-56   Vitis vinifera
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  193   7e-56   Vitis vinifera
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  193   7e-56   Vitis vinifera
emb|CBI19549.3|  unnamed protein product                                192   9e-56   Vitis vinifera
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  192   9e-56   Vitis vinifera
emb|CAN81920.1|  hypothetical protein VITISV_021802                     192   1e-55   Vitis vinifera
emb|CAN71271.1|  hypothetical protein VITISV_001907                     193   2e-55   Vitis vinifera
emb|CDP01337.1|  unnamed protein product                                190   1e-54   Coffea canephora [robusta coffee]
ref|XP_009617802.1|  PREDICTED: patatin-like protein 2 isoform X2       187   2e-54   Nicotiana tomentosiformis
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  189   2e-54   Nicotiana sylvestris
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  189   3e-54   Solanum tuberosum [potatoes]
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    196   5e-54   Vitis vinifera
emb|CBI19557.3|  unnamed protein product                                193   1e-53   Vitis vinifera
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  187   1e-53   Solanum tuberosum [potatoes]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       187   2e-53   Nicotiana tomentosiformis
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  186   3e-53   Glycine max [soybeans]
emb|CDP11077.1|  unnamed protein product                                186   3e-53   Coffea canephora [robusta coffee]
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      186   4e-53   Theobroma cacao [chocolate]
gb|KHN12766.1|  Patatin-3-Kuras 1                                       182   9e-53   Glycine soja [wild soybean]
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       184   9e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       184   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010064190.1|  PREDICTED: patatin-like protein 2                  182   1e-52   Eucalyptus grandis [rose gum]
gb|KCW66180.1|  hypothetical protein EUGRSUZ_F00017                     182   2e-52   Eucalyptus grandis [rose gum]
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  184   2e-52   
ref|XP_009629882.1|  PREDICTED: patatin-like protein 2                  179   2e-52   Nicotiana tomentosiformis
gb|KCW66469.1|  hypothetical protein EUGRSUZ_F002673                    179   3e-52   Eucalyptus grandis [rose gum]
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        183   4e-52   Nicotiana tabacum [American tobacco]
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  182   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  182   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  181   2e-51   Eucalyptus grandis [rose gum]
ref|XP_004979715.1|  PREDICTED: patatin-2-Kuras 1-like                  181   2e-51   Setaria italica
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  181   2e-51   Solanum tuberosum [potatoes]
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             181   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  181   3e-51   Populus euphratica
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       181   3e-51   Populus euphratica
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       181   3e-51   Populus euphratica
ref|XP_006374974.1|  hypothetical protein POPTR_0014s03260g             180   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       181   4e-51   Populus euphratica
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       181   4e-51   Populus euphratica
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  181   4e-51   Eucalyptus grandis [rose gum]
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             181   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       181   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  181   4e-51   Nicotiana sylvestris
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             181   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  180   7e-51   Eucalyptus grandis [rose gum]
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     180   7e-51   Eucalyptus grandis [rose gum]
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       180   7e-51   Populus euphratica
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       180   8e-51   Populus euphratica
ref|XP_010059971.1|  PREDICTED: patatin-like protein 2 isoform X2       177   1e-50   Eucalyptus grandis [rose gum]
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             180   1e-50   Populus trichocarpa [western balsam poplar]
gb|KCW66175.1|  hypothetical protein EUGRSUZ_F00011                     177   1e-50   Eucalyptus grandis [rose gum]
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             179   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g             179   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  179   2e-50   Setaria italica
ref|XP_003589237.1|  Patatin-like protein                               176   2e-50   Medicago truncatula
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       179   2e-50   Nicotiana sylvestris
emb|CDP04311.1|  unnamed protein product                                179   2e-50   Coffea canephora [robusta coffee]
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       178   2e-50   Nicotiana sylvestris
gb|EMT13605.1|  Patatin group A-3                                       178   2e-50   Aegilops tauschii
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  178   3e-50   Solanum lycopersicum
ref|XP_010098699.1|  Patatin group A-3                                  179   3e-50   Morus notabilis
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             178   3e-50   Phaseolus vulgaris [French bean]
gb|KHN12765.1|  Patatin group A-3                                       178   4e-50   Glycine soja [wild soybean]
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       178   4e-50   Glycine max [soybeans]
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1       177   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2       177   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       177   5e-50   Eucalyptus grandis [rose gum]
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  178   6e-50   Eucalyptus grandis [rose gum]
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  177   6e-50   Eucalyptus grandis [rose gum]
gb|EMT31709.1|  Patatin group A-3                                       176   6e-50   Aegilops tauschii
gb|KJB58443.1|  hypothetical protein B456_009G210300                    175   6e-50   Gossypium raimondii
gb|EMS66123.1|  Patatin group A-3                                       177   7e-50   Triticum urartu
gb|KHN04516.1|  Patatin group A-3                                       177   9e-50   Glycine soja [wild soybean]
ref|XP_008813725.1|  PREDICTED: patatin-like protein 2 isoform X2       175   1e-49   Phoenix dactylifera
gb|EPS59074.1|  hypothetical protein M569_15736                         176   1e-49   Genlisea aurea
gb|EMS45954.1|  Patatin group A-3                                       176   1e-49   Triticum urartu
ref|XP_006388384.1|  hypothetical protein POPTR_0202s00210g             175   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      177   1e-49   Theobroma cacao [chocolate]
ref|XP_010238243.1|  PREDICTED: patatin-like protein 2 isoform X3       174   1e-49   Brachypodium distachyon [annual false brome]
gb|KJB29508.1|  hypothetical protein B456_005G104200                    176   2e-49   Gossypium raimondii
gb|EMT30617.1|  Patatin group A-3                                       176   3e-49   Aegilops tauschii
ref|XP_003589238.1|  Patatin-like protein                               176   4e-49   Medicago truncatula
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       176   4e-49   Solanum lycopersicum
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       176   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       176   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  175   4e-49   
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  175   4e-49   Phoenix dactylifera
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          175   4e-49   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       175   4e-49   Phoenix dactylifera
gb|EMS52853.1|  Patatin group M-3                                       175   4e-49   Triticum urartu
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       175   4e-49   Solanum lycopersicum
ref|XP_003527713.1|  PREDICTED: patatin-like                            175   5e-49   Glycine max [soybeans]
ref|XP_003589236.1|  Patatin-like protein                               175   5e-49   Medicago truncatula
gb|AFK35290.1|  unknown                                                 175   5e-49   Medicago truncatula
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         175   6e-49   Solanum tuberosum [potatoes]
emb|CDP01332.1|  unnamed protein product                                175   6e-49   Coffea canephora [robusta coffee]
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             175   6e-49   Populus trichocarpa [western balsam poplar]
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  175   6e-49   Brachypodium distachyon [annual false brome]
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  175   6e-49   Glycine max [soybeans]
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       174   7e-49   Brachypodium distachyon [annual false brome]
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             174   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  174   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  174   1e-48   Solanum tuberosum [potatoes]
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  174   1e-48   Eucalyptus grandis [rose gum]
gb|EMT08201.1|  Patatin-T5                                              171   2e-48   Aegilops tauschii
emb|CDP07844.1|  unnamed protein product                                174   2e-48   Coffea canephora [robusta coffee]
gb|KJB58442.1|  hypothetical protein B456_009G210300                    174   2e-48   Gossypium raimondii
ref|XP_006388386.1|  hypothetical protein POPTR_0202s00230g             171   2e-48   Populus trichocarpa [western balsam poplar]
emb|CDP02483.1|  unnamed protein product                                174   2e-48   Coffea canephora [robusta coffee]
ref|XP_002510258.1|  Patatin T5 precursor, putative                     174   2e-48   
gb|KHN42072.1|  Patatin group A-3                                       174   2e-48   Glycine soja [wild soybean]
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       172   2e-48   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            174   2e-48   Theobroma cacao [chocolate]
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     173   2e-48   Eucalyptus grandis [rose gum]
ref|NP_001140826.1|  uncharacterized protein LOC100272901               174   3e-48   Zea mays [maize]
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  173   3e-48   Eucalyptus grandis [rose gum]
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  173   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58444.1|  hypothetical protein B456_009G210400                    173   3e-48   Gossypium raimondii
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  173   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          173   3e-48   Sorghum bicolor [broomcorn]
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  173   3e-48   Sesamum indicum [beniseed]
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     173   3e-48   Eucalyptus grandis [rose gum]
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  173   3e-48   Vitis vinifera
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             173   3e-48   Phaseolus vulgaris [French bean]
ref|XP_007017302.1|  Phospholipase A 2A, IIA,PLA2A, putative            172   4e-48   Theobroma cacao [chocolate]
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         173   4e-48   Jatropha curcas
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  173   4e-48   Eucalyptus grandis [rose gum]
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  172   4e-48   Phoenix dactylifera
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         172   4e-48   Solanum tuberosum [potatoes]
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  172   4e-48   Eucalyptus grandis [rose gum]
emb|CBI19544.3|  unnamed protein product                                174   5e-48   Vitis vinifera
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          172   5e-48   Amborella trichopoda
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       172   5e-48   Cicer arietinum [garbanzo]
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       172   5e-48   
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       172   6e-48   Cicer arietinum [garbanzo]
gb|KJB58445.1|  hypothetical protein B456_009G210500                    172   6e-48   Gossypium raimondii
ref|XP_006660709.1|  PREDICTED: patatin-2-Kuras 2-like isoform X1       171   6e-48   
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 172   7e-48   Theobroma cacao [chocolate]
gb|AEF30538.1|  patatin-like phospholipase 1                            172   7e-48   Capsicum annuum
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  172   9e-48   Nicotiana tomentosiformis
gb|AAX99411.1|  patatin-like protein                                    172   1e-47   Gossypium hirsutum [American cotton]
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  171   1e-47   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    171   1e-47   
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                  171   1e-47   Sesamum indicum [beniseed]
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            171   1e-47   Theobroma cacao [chocolate]
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            172   1e-47   Theobroma cacao [chocolate]
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             171   1e-47   Prunus persica
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             171   2e-47   Phaseolus vulgaris [French bean]
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  171   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      171   2e-47   Theobroma cacao [chocolate]
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  171   2e-47   Populus euphratica
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       171   2e-47   Vitis vinifera
gb|KGN62540.1|  hypothetical protein Csa_2G360570                       169   2e-47   Cucumis sativus [cucumbers]
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       170   2e-47   
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       171   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003603015.1|  Patatin-like protein                               171   2e-47   Medicago truncatula
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  171   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003603014.1|  Patatin-like protein                               170   3e-47   Medicago truncatula
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       170   3e-47   
tpg|DAA45677.1|  TPA: hypothetical protein ZEAMMB73_598493              170   4e-47   Zea mays [maize]
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       170   4e-47   Eucalyptus grandis [rose gum]
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  170   4e-47   Populus euphratica
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  170   4e-47   Eucalyptus grandis [rose gum]
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       169   4e-47   Eucalyptus grandis [rose gum]
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  170   5e-47   Prunus mume [ume]
emb|CAN76066.1|  hypothetical protein VITISV_001725                     170   5e-47   Vitis vinifera
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         169   5e-47   
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  169   6e-47   Nicotiana sylvestris
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       170   6e-47   Vitis vinifera
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       169   6e-47   Malus domestica [apple tree]
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                  170   6e-47   Zea mays [maize]
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       169   7e-47   Malus domestica [apple tree]
ref|XP_008671927.1|  PREDICTED: patatin-like protein 3                  167   7e-47   Zea mays [maize]
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  169   7e-47   Vitis vinifera
ref|XP_004980751.1|  PREDICTED: patatin group D-2-like                  167   7e-47   Setaria italica
ref|XP_002324124.2|  hypothetical protein POPTR_0017s02550g             167   7e-47   Populus trichocarpa [western balsam poplar]
ref|NP_001063402.2|  Os09g0462400                                       169   7e-47   
gb|KGN62058.1|  hypothetical protein Csa_2G293860                       166   7e-47   Cucumis sativus [cucumbers]
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    169   7e-47   Arabis alpina [alpine rockcress]
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       169   8e-47   Vitis vinifera
emb|CBI19552.3|  unnamed protein product                                171   8e-47   Vitis vinifera
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  169   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             169   9e-47   Prunus persica
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  169   1e-46   Nicotiana tomentosiformis
gb|EEC84713.1|  hypothetical protein OsI_31673                          169   1e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       169   1e-46   Eucalyptus grandis [rose gum]
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  169   1e-46   Nicotiana sylvestris
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  169   1e-46   Oryza brachyantha
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  169   1e-46   Malus domestica [apple tree]
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             169   1e-46   Populus trichocarpa [western balsam poplar]
gb|KCW66177.1|  hypothetical protein EUGRSUZ_F00013                     163   1e-46   Eucalyptus grandis [rose gum]
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  169   1e-46   Phoenix dactylifera
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   169   1e-46   Citrus sinensis [Valencia orange]
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             168   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  169   1e-46   Eucalyptus grandis [rose gum]
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       169   2e-46   Nicotiana sylvestris
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  169   2e-46   Cucumis sativus [cucumbers]
ref|XP_003611772.1|  Patatin-like protein                               168   2e-46   Medicago truncatula
tpg|DAA42304.1|  TPA: hypothetical protein ZEAMMB73_137328              167   2e-46   Zea mays [maize]
gb|KJB29505.1|  hypothetical protein B456_005G103900                    168   2e-46   Gossypium raimondii
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  169   2e-46   Nicotiana tomentosiformis
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  168   2e-46   Eucalyptus grandis [rose gum]
ref|XP_002301194.1|  patatin-like family protein                        168   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                  168   2e-46   Phoenix dactylifera
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          169   2e-46   Sorghum bicolor [broomcorn]
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  168   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006495361.1|  PREDICTED: patatin group M-3-like                  166   3e-46   Citrus sinensis [Valencia orange]
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  168   3e-46   Elaeis guineensis
ref|XP_008670872.1|  PREDICTED: patatin-like protein 1                  166   3e-46   Zea mays [maize]
ref|NP_001068268.1|  Os11g0614400                                       168   3e-46   
ref|XP_009409647.1|  PREDICTED: patatin-like protein 2                  166   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  167   4e-46   Elaeis guineensis
gb|EAY88437.1|  hypothetical protein OsI_09902                          167   4e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       167   4e-46   Prunus mume [ume]
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  167   5e-46   Malus domestica [apple tree]
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  167   5e-46   Fragaria vesca subsp. vesca
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  167   6e-46   Nicotiana sylvestris
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  167   6e-46   Eucalyptus grandis [rose gum]
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  167   6e-46   Pyrus x bretschneideri [bai li]
emb|CDM80597.1|  unnamed protein product                                167   6e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006466736.1|  PREDICTED: patatin-11-like                         166   6e-46   Citrus sinensis [Valencia orange]
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  171   7e-46   Solanum lycopersicum
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     166   7e-46   Eucalyptus grandis [rose gum]
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  167   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP11080.1|  unnamed protein product                                166   8e-46   Coffea canephora [robusta coffee]
gb|KGN62064.1|  hypothetical protein Csa_2G294910                       164   9e-46   Cucumis sativus [cucumbers]
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  166   1e-45   Setaria italica
gb|EMT07292.1|  Patatin-11                                              164   1e-45   Aegilops tauschii
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          167   1e-45   Sorghum bicolor [broomcorn]
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     166   1e-45   Eucalyptus grandis [rose gum]
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   166   1e-45   Zea mays [maize]
gb|KJB58441.1|  hypothetical protein B456_009G210000                    166   1e-45   Gossypium raimondii
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  166   1e-45   Vitis vinifera
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             166   1e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_003611771.1|  Patatin-like protein                               166   1e-45   Medicago truncatula
ref|XP_002463192.1|  hypothetical protein SORBIDRAFT_02g039470          166   1e-45   Sorghum bicolor [broomcorn]
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          166   1e-45   Amborella trichopoda
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818          165   1e-45   Sorghum bicolor [broomcorn]
tpg|DAA42306.1|  TPA: patatin T5                                        166   1e-45   Zea mays [maize]
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  166   1e-45   Cucumis sativus [cucumbers]
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2       165   1e-45   
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             166   2e-45   Prunus persica
ref|XP_010320535.1|  PREDICTED: patatin-like protein 2                  165   2e-45   Solanum lycopersicum
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  166   2e-45   Solanum lycopersicum
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2       165   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_002310732.1|  patatin family protein                             166   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       165   2e-45   Malus domestica [apple tree]
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        166   2e-45   Nicotiana tabacum [American tobacco]
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             166   2e-45   Phaseolus vulgaris [French bean]
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  165   2e-45   Vitis vinifera
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       165   2e-45   Pyrus x bretschneideri [bai li]
emb|CBI21444.3|  unnamed protein product                                166   2e-45   Vitis vinifera
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             165   2e-45   Prunus persica
tpg|DAA42302.1|  TPA: hypothetical protein ZEAMMB73_996038              166   3e-45   Zea mays [maize]
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                  166   3e-45   Camelina sativa [gold-of-pleasure]
gb|AFJ92643.2|  phospholipase A2                                        165   3e-45   Eschscholzia californica
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             165   3e-45   Prunus persica
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  165   3e-45   Nicotiana tomentosiformis
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  165   3e-45   Vitis vinifera
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  165   3e-45   Phoenix dactylifera
gb|KJB63808.1|  hypothetical protein B456_010G0176001                   160   3e-45   Gossypium raimondii
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  165   3e-45   Prunus mume [ume]
emb|CDM80622.1|  unnamed protein product                                162   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  165   3e-45   Solanum tuberosum [potatoes]
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  165   4e-45   Solanum tuberosum [potatoes]
ref|XP_004288058.1|  PREDICTED: patatin-like protein 2                  164   4e-45   Fragaria vesca subsp. vesca
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  165   4e-45   Solanum tuberosum [potatoes]
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             165   4e-45   Capsella rubella
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                  165   4e-45   Oryza brachyantha
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  165   4e-45   Prunus mume [ume]
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       165   4e-45   Solanum lycopersicum
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  164   5e-45   Populus euphratica
ref|XP_002510255.1|  Patatin precursor, putative                        164   5e-45   
ref|XP_008777592.1|  PREDICTED: patatin-like protein 2                  166   5e-45   
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  166   5e-45   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       164   5e-45   
gb|EYU21992.1|  hypothetical protein MIMGU_mgv1a024079mg                158   5e-45   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  164   6e-45   
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  164   7e-45   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             164   7e-45   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    165   7e-45   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                  164   8e-45   
gb|AAM20447.1|  patatin-like protein                                    162   9e-45   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  164   9e-45   
emb|CBI19553.3|  unnamed protein product                                164   9e-45   
emb|CAA73328.1|  patatin-like protein                                   164   1e-44   
gb|EMS63453.1|  Patatin-3-Kuras 1                                       162   1e-44   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  164   1e-44   
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  164   1e-44   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          164   1e-44   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  163   1e-44   
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       163   1e-44   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              166   2e-44   
dbj|BAJ99822.1|  predicted protein                                      162   2e-44   
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  163   2e-44   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  163   2e-44   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         163   2e-44   
ref|XP_006663045.1|  PREDICTED: patatin-2-Kuras 1-like                  163   2e-44   
ref|XP_008777593.1|  PREDICTED: patatin-like protein 3                  157   2e-44   
emb|CDX72620.1|  BnaC07g46420D                                          163   2e-44   
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  162   2e-44   
ref|XP_002510257.1|  Patatin T5 precursor, putative                     162   2e-44   
gb|EMS54202.1|  Patatin group A-3                                       165   3e-44   
ref|NP_001151996.1|  patatin T5                                         162   3e-44   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  162   3e-44   
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  163   3e-44   
ref|XP_010101001.1|  Patatin group A-3                                  162   3e-44   
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  162   3e-44   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  162   3e-44   
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                  163   3e-44   
emb|CDY42720.1|  BnaA03g53730D                                          162   3e-44   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  162   3e-44   
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  162   3e-44   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  162   4e-44   
ref|XP_006285080.1|  hypothetical protein CARUB_v10006413mg             162   4e-44   
gb|KJB40252.1|  hypothetical protein B456_007G053800                    162   4e-44   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             162   4e-44   
ref|XP_010028265.1|  PREDICTED: patatin-like protein 3                  161   4e-44   
ref|NP_195422.3|  PATATIN-like protein 4                                162   4e-44   
dbj|BAK06341.1|  predicted protein                                      162   4e-44   
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     162   5e-44   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  162   5e-44   
ref|XP_010446707.1|  PREDICTED: patatin-like protein 3                  162   5e-44   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  162   5e-44   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          162   6e-44   
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  161   6e-44   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       162   6e-44   
emb|CAN71554.1|  hypothetical protein VITISV_034739                     164   7e-44   
ref|XP_009590385.1|  PREDICTED: patatin-like protein 2                  159   7e-44   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       162   7e-44   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    161   7e-44   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          161   7e-44   
gb|KJB71085.1|  hypothetical protein B456_011G105000                    160   8e-44   
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       161   8e-44   
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       161   9e-44   
ref|NP_001078506.1|  patatin-related phospholipase A                    160   1e-43   
emb|CAA05628.1|  patatin-like protein                                   161   1e-43   
ref|NP_568015.1|  patatin-related phospholipase A                       160   1e-43   
ref|NP_849511.1|  patatin-related phospholipase A                       161   1e-43   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       161   1e-43   
gb|AAD22169.1|AF061282_23  patatin-like protein                         161   1e-43   
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  161   1e-43   
gb|AAM64566.1|  patatin-like protein                                    160   1e-43   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    163   1e-43   
ref|XP_006434812.1|  hypothetical protein CICLE_v10001337mg             158   1e-43   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  161   1e-43   
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         160   1e-43   
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       160   1e-43   
ref|XP_006294513.1|  hypothetical protein CARUB_v10023546mg             159   1e-43   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  161   1e-43   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     161   2e-43   
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  160   2e-43   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          160   2e-43   
emb|CBI25858.3|  unnamed protein product                                160   2e-43   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  161   2e-43   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  162   2e-43   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    160   2e-43   
emb|CDP02475.1|  unnamed protein product                                160   2e-43   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  160   2e-43   
emb|CDP01331.1|  unnamed protein product                                160   2e-43   
gb|KHG27256.1|  Patatin group M-3                                       160   2e-43   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  160   2e-43   
ref|NP_001062043.1|  Os08g0477100                                       160   2e-43   
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                  160   3e-43   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  160   3e-43   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg                161   3e-43   
ref|XP_002262942.1|  PREDICTED: patatin-like protein 2                  159   3e-43   
ref|XP_006411934.1|  hypothetical protein EUTSA_v10025319mg             160   3e-43   
emb|CAN62059.1|  hypothetical protein VITISV_024099                     159   3e-43   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  160   4e-43   
ref|XP_006434814.1|  hypothetical protein CICLE_v10001337mg             157   4e-43   
emb|CDP01335.1|  unnamed protein product                                160   4e-43   
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                  159   4e-43   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         159   4e-43   
dbj|BAJ98020.1|  predicted protein                                      160   4e-43   
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                  159   4e-43   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  159   5e-43   
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             159   5e-43   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  159   5e-43   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             159   6e-43   
gb|AAK18751.1|  patatin-like protein                                    159   6e-43   
ref|XP_008790455.1|  PREDICTED: patatin-like protein 3                  155   6e-43   
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         159   6e-43   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             159   6e-43   
ref|XP_002523555.1|  Patatin precursor, putative                        159   7e-43   
ref|NP_001050287.1|  Os03g0393900                                       159   7e-43   
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  159   7e-43   
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                  161   7e-43   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1            159   8e-43   
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  158   8e-43   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  158   9e-43   
ref|XP_004291130.1|  PREDICTED: patatin-like protein 2                  159   9e-43   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  157   1e-42   
ref|XP_009392030.1|  PREDICTED: patatin-like protein 2                  158   1e-42   
gb|ACN36732.1|  unknown                                                 156   1e-42   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             158   1e-42   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  157   2e-42   
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  158   2e-42   
gb|EAZ07346.1|  hypothetical protein OsI_29595                          158   2e-42   
ref|XP_004288059.1|  PREDICTED: patatin-like protein 1                  157   2e-42   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          158   2e-42   
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  158   2e-42   
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    157   2e-42   
gb|EAY83441.1|  hypothetical protein OsI_38653                          158   2e-42   
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       158   2e-42   
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  157   2e-42   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                  157   2e-42   
gb|AAD22149.1|AF061282_2  patatin-like protein                          158   2e-42   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  157   2e-42   
ref|XP_002523558.1|  Patatin precursor, putative                        157   2e-42   
gb|KGN62063.1|  hypothetical protein Csa_2G294900                       155   2e-42   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             157   2e-42   
emb|CDX75621.1|  BnaA01g00810D                                          157   3e-42   
ref|XP_010101004.1|  Patatin group A-3                                  157   3e-42   
ref|XP_010432095.1|  PREDICTED: patatin-like protein 3                  157   3e-42   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  157   4e-42   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  157   4e-42   
ref|XP_008357456.1|  PREDICTED: patatin-like protein 2                  153   4e-42   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  157   4e-42   
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  157   4e-42   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             157   4e-42   
ref|XP_008360668.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    153   4e-42   
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  157   4e-42   
gb|EMT06575.1|  Patatin-15                                              157   4e-42   
ref|XP_009366776.1|  PREDICTED: patatin-like protein 2                  156   5e-42   
gb|ABK24853.1|  unknown                                                 156   5e-42   
gb|ACN25198.1|  unknown                                                 156   5e-42   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             156   5e-42   
ref|XP_002510259.1|  Patatin T5 precursor, putative                     156   6e-42   
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             155   6e-42   
gb|ACG31156.1|  patatin T5 precursor                                    156   7e-42   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  156   7e-42   
ref|XP_002869007.1|  PLA IVA/PLP1                                       156   7e-42   
ref|XP_009139453.1|  PREDICTED: patatin-like protein 1 isoform X3       155   8e-42   
gb|EMT18762.1|  Patatin group A-3                                       156   8e-42   
ref|XP_010089434.1|  Patatin group A-3                                  155   8e-42   
ref|NP_001151190.1|  LOC100284823                                       156   8e-42   
gb|EYU39404.1|  hypothetical protein MIMGU_mgv1a024220mg                155   8e-42   
emb|CDP01333.1|  unnamed protein product                                155   9e-42   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  155   9e-42   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       155   9e-42   
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  155   1e-41   
emb|CDX69271.1|  BnaC01g01820D                                          155   1e-41   
emb|CDX72619.1|  BnaC07g46410D                                          155   1e-41   
ref|XP_010939457.1|  PREDICTED: patatin-like protein 2 isoform X2       155   1e-41   
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             155   1e-41   
gb|KGN62539.1|  hypothetical protein Csa_2G360560                       154   2e-41   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             154   2e-41   
gb|EMT06740.1|  Patatin group A-3                                       155   2e-41   
ref|XP_002510260.1|  Patatin T5 precursor, putative                     155   2e-41   
ref|XP_010028281.1|  PREDICTED: patatin-like protein 2                  155   2e-41   
ref|XP_004233945.1|  PREDICTED: patatin-like protein 2                  155   2e-41   
gb|EMS46263.1|  Patatin group A-3                                       155   2e-41   
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         155   2e-41   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       155   2e-41   
ref|XP_009139399.1|  PREDICTED: patatin-like protein 1 isoform X2       154   2e-41   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             154   2e-41   
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       154   3e-41   
ref|NP_001062042.1|  Os08g0476900                                       155   3e-41   
emb|CDX69269.1|  BnaC01g01840D                                          154   3e-41   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    154   3e-41   
ref|XP_010109903.1|  Patatin group A-3                                  154   3e-41   
ref|XP_010446710.1|  PREDICTED: patatin-like protein 1 isoform X3       154   3e-41   
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         154   3e-41   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    155   3e-41   
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  154   3e-41   
ref|XP_004148463.1|  PREDICTED: patatin group A-3-like                  154   3e-41   
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       154   4e-41   
ref|XP_004165470.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    154   4e-41   
gb|KCW54997.1|  hypothetical protein EUGRSUZ_I00973                     151   4e-41   
ref|XP_010446709.1|  PREDICTED: patatin-like protein 1 isoform X2       154   4e-41   
ref|XP_010446708.1|  PREDICTED: patatin-like protein 1 isoform X1       154   4e-41   
ref|XP_003577353.1|  PREDICTED: patatin-like protein 1                  154   4e-41   
ref|XP_009139287.1|  PREDICTED: patatin-like protein 1                  154   4e-41   
gb|EMT15946.1|  Patatin-3-Kuras 1                                       152   5e-41   
gb|KGN62071.1|  hypothetical protein Csa_2G295960                       151   5e-41   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  154   5e-41   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  154   6e-41   
emb|CDX75619.1|  BnaA01g00830D                                          154   6e-41   
ref|XP_003577354.1|  PREDICTED: patatin-like protein 1                  154   6e-41   
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  154   6e-41   
gb|EEE53387.1|  hypothetical protein OsJ_36433                          159   6e-41   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    154   6e-41   
ref|XP_008457870.1|  PREDICTED: patatin-like protein 2 isoform X2       152   6e-41   
gb|ABK94710.1|  unknown                                                 149   7e-41   
emb|CDY21469.1|  BnaC03g27280D                                          153   7e-41   
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  153   7e-41   
gb|EMT28251.1|  Patatin group A-3                                       154   7e-41   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                  153   8e-41   
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             153   9e-41   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     152   1e-40   
gb|ABA99523.1|  Patatin-like phospholipase family protein, expressed    152   1e-40   
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  153   1e-40   



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   DA G   ++NLIDGGVAANNPTL+AIS VT++++  DP +        + +  +R 
Sbjct  198  FTNPDASGKSWDFNLIDGGVAANNPTLVAISEVTKQVLRNDPDFFPI-----QPMDYNRL  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KYTA+ AA WG+ GWL QG+  P++DVF+ AS DMVDY +  IFQ+
Sbjct  253  LVISLGTGSAKQERKYTAEMAAKWGLFGWLIQGNNTPILDVFNQASKDMVDYFLCVIFQS  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ ASVDVTTK+NL  L ++G+ LL  P+ ++NLLTG +EP+P 
Sbjct  313  LHSEDNYLRIQDDSLTGANASVDVTTKQNLSELAKIGENLLKGPISRVNLLTGNSEPIPN  372

Query  541  AGTNKDALKRL  573
             GTN+DALK+ 
Sbjct  373  GGTNEDALKKF  383



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGVAANNP L+AI+ VT+++  K+P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDKNPDFFPI-----KPMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGVAANNP L+AIS VT+++  K+P +        + +   RF
Sbjct  203  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFFPI-----KPMDFGRF  257

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  258  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  317

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDV T+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  318  LHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  377

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  378  GGTNEEALKRF  388



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGVAANNP L+AIS VT+++  K+P +        + +   RF
Sbjct  192  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFFPI-----KPMDFGRF  246

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  247  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  306

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDV T+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  307  LHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  366

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  367  GGTNEEALKRF  377



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIAIS V++ +   +P +        + +   RF
Sbjct  198  FKVEDTKGNFKEHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFYPI-----KPMEYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +KY  KY +  AA WG+L WL     NPLI+VF+ +SADMVDYH + +FQA
Sbjct  253  LVISLGTGAAKYEQKYNSSMAAKWGILEWLLNKGSNPLIEVFTQSSADMVDYHNSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ D+YLRIQED+L G+ ASVDV TKENL+ L E+G+ LL KP+ ++NL TG +EP+PK
Sbjct  313  LRSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KYMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E NLIDGGVAANNP L+AIS VT+++  K+P +L       + +   RF
Sbjct  199  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFLPI-----KPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WGVLGWL  G   PL+DVF+ ASADMVD+HI+ +FQA
Sbjct  254  LVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ ASVDVTTKENL  L ++G++LL KPV ++NL TG + PV  
Sbjct  314  LHSEDNYLRIQDDTLHGTDASVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVEN  373

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  374  CGTNEEALKRF  384



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGVAANNP L+AIS VT+++  K+P +        + +   RF
Sbjct  229  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFFPI-----KPMDFGRF  283

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  284  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  343

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDV T+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  344  LHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  403

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  404  GGTNEEALKRF  414



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KPMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KPMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E NLIDGGVAANNP L+AIS VT+++  K+P +L       + +   RF
Sbjct  198  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFLPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WGVLGWL  G   PL+DVF+ ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ A+VDVTTKENL  L ++G++LL KPV ++NL TG + PV  
Sbjct  313  LHSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  CGTNEEALKRF  383



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E NLIDGGVAANNP L+AIS VT+++  K+P +L       + +   RF
Sbjct  199  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFLPI-----KPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WGVLGWL  G   PL+DVF+ ASADMVD+HI+ +FQA
Sbjct  254  LVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ A+VDVTTKENL  L ++G++LL KPV ++NL TG + PV  
Sbjct  314  LHSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVEN  373

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  374  CGTNEEALKRF  384



>emb|CAN81920.1| hypothetical protein VITISV_021802 [Vitis vinifera]
Length=407

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  199  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KPMDFGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  254  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  314  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  373

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  374  GGTNEEALKRF  384



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  238  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KYMDFGRF  292

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  293  LVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  352

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  353  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  412

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  413  GGTNEEALKRF  423



>emb|CDP01337.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 139/191 (73%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNP L+A++ VT+ +   +P +   S  S+E     RF
Sbjct  198  FETEDSDGSVKEFNLIDGGVAANNPALVAMNHVTKEVSQGNPDFF--SIRSQE---YSRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K   KY A+QAA WG+LGWL  G   PL+DVFS AS+DMVD+H++T+FQ 
Sbjct  253  LVLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDVFSQASSDMVDFHLSTVFQT  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ +NYLRIQ+D L G  ASVDV T+ENL  L +VG+ LL KPV ++NL TG  EP+ K
Sbjct  313  LQSEENYLRIQDDTLTGDLASVDVATEENLQNLVKVGENLLKKPVSRINLETGVFEPLNK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKRL
Sbjct  373  -GTNEEALKRL  382



>ref|XP_009617802.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=343

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIAIS V++ ++  +P +        + +   RF
Sbjct  127  FKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEILKDNPDFFPI-----KPMDYGRF  181

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K+  KY A  AA WG++ WL      PLI+VF  +SAD+VDYH + +FQA
Sbjct  182  LVISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQA  241

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQED+L G+ ASVD+ TKENL+ L E+G+ LL KP+ ++NL TG  EP+PK
Sbjct  242  LHSDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPK  301

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  302  GGTNEEALIRF  312



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIA+S V++ ++  +P +        + +   RF
Sbjct  198  FKVEDGKGNVKEHHLIDGGVAANNPALIAVSEVSKEILKDNPDFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K+  KY A   A WG++ WL      PLI+VF+ +SAD+VDYH + +FQA
Sbjct  253  LVISIGTGSAKWEHKYNASMTAKWGIVDWLFHKGSTPLIEVFTQSSADLVDYHNSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L+  DNYLRIQED+L G+ ASVD+ TKENL+ L E+G+ LL KP+ ++NL TG  EP+PK
Sbjct  313  LRCDDNYLRIQEDELNGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLAEPIPK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D K    E++LIDGGV ANNP LIAIS V++ +   +P +        + +   RF
Sbjct  197  FKVEDGKNNVREHHLIDGGVVANNPGLIAISEVSKEIFKNNPDFYPI-----KPMEYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +KY  KY +  AA WG++ WL     NPLI+VF+ +SADMVDYH + +FQA
Sbjct  252  LVISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ D+YLRIQED+L G+ ASVDV TKENL+ L E+G+ LL KP+ ++NL TG +EP+PK
Sbjct  312  LRSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPK  371

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  372  GGTNEEALKRF  382



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGVAANNP L+AI+ VT+++  K+P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDKNPDFFPI-----KPMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ VT+++  ++P +        + +   RF
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPI-----KPMDFGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WGVLGWL  G   PL+DVF  ASADMVD+HI+ +FQA
Sbjct  253  LVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++G++LL KPV ++NL TG +EPV  
Sbjct  313  LHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVEN  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D K    E++LIDGGVAANNP LIAIS V++ +   +P +        + +   RF
Sbjct  197  FKVEDGKDNVREHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFYPI-----KPMEYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +KY  KY +  AA WG++ WL     NPLI+VF+ +SADMVDYH + +FQA
Sbjct  252  LVISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ D+YLRIQED+L G+ ASVDV TKENL+ L E+G+ LL KP+ ++NL TG  EP+PK
Sbjct  312  LRSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRINLETGLTEPIPK  371

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  372  GGTNEEALTRF  382



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIAIS V++ ++  +P +        + +   RF
Sbjct  204  FKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEILKDNPDFFPI-----KPMDYGRF  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K+  KY A  AA WG++ WL      PLI+VF  +SAD+VDYH + +FQA
Sbjct  259  LVISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQED+L G+ ASVD+ TKENL+ L E+G+ LL KP+ ++NL TG  EP+PK
Sbjct  319  LHSDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPK  378

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  379  GGTNEEALIRF  389



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D+KG   E+NLIDGGV ANNPTL+A++ VT++++ ++P +        + +   RF
Sbjct  201  FNNQDSKGNVHEFNLIDGGVCANNPTLVAMNEVTKQIIMQNPDFFPI-----KPMEYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+SIGTG +K  +K+ AQ AA WG+L WL Q   NPLIDVFS +S+DMVD+H++ + QA
Sbjct  256  LIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSNPLIDVFSQSSSDMVDFHLSAVTQA  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD+ TKENL+ L  VG+KLL KPV ++NL  G  EP+  
Sbjct  316  LHSEDNYLRIQDDTLTGTDSSVDIATKENLEKLCHVGEKLLKKPVSRINLENGLFEPLKN  375

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  376  RETNEDALKRF  386



>emb|CDP11077.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 138/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNP L+A++ VT+ +   +  +   S  S+E     RF
Sbjct  185  FETEDSDGSVKEFNLIDGGVAANNPALVAMNHVTKEVSQGNSDFF--SIRSQE---YSRF  239

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            ++LS+GTG +K   KY A+QAA WG+LGWL  G   PL+DVFS AS+DMVD+H++TIFQ 
Sbjct  240  IVLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDVFSQASSDMVDFHLSTIFQT  299

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ +NYLRIQ+D L G  ASVDV T+ENL  L +VG+ LL KPV ++NL TG  EP+ K
Sbjct  300  LQSEENYLRIQDDTLTGDLASVDVATEENLQNLVKVGENLLKKPVSRINLQTGVFEPLNK  359

Query  541  AGTNKDALKRL  573
             GTN++ALKRL
Sbjct  360  -GTNEEALKRL  369



>ref|XP_007017305.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14530.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E++LIDGGVAANNPTL+A++ VT+ +  K+  +        EA     F
Sbjct  210  FETKDSTGNVKEFHLIDGGVAANNPTLVAMNEVTKEITRKNSDFFPI-----EANDFSHF  264

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG+ K  +KY A  AA WG+LGWL      PL+DVF  AS+DMVD+HIAT+FQA
Sbjct  265  LVLSLGTGSQKCEEKYPAHMAAKWGLLGWLTSEHSTPLMDVFMQASSDMVDFHIATVFQA  324

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ D YLRIQ+D L G+ +SVD+ TKENL+ L +VG++LL KPV ++NL  GK EP+  
Sbjct  325  LQSEDRYLRIQDDTLCGTISSVDIATKENLENLVQVGEELLKKPVSRVNLDNGKFEPIKN  384

Query  541  AGTNKDALKRL  573
              TN+DAL RL
Sbjct  385  QDTNEDALIRL  395



>gb|KHN12766.1| Patatin-3-Kuras 1 [Glycine soja]
Length=315

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D+KG   E+NLIDGGV ANNPTL+A++ VT++++ ++  +        + +   RF
Sbjct  121  FNNHDSKGNVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNSDFF-----PIKPMEYGRF  175

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+SIGTG SK  +K+ AQ AA WG+L WL Q   NPLIDVFS +SADMVD+H++ + QA
Sbjct  176  LIISIGTGTSKTEEKFNAQMAAKWGLLDWLTQSGSNPLIDVFSQSSADMVDFHLSAVTQA  235

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD+ TKENL+ L ++G+ LL KPV ++NL  G  +P+  
Sbjct  236  LNSQDNYLRIQDDTLTGTDSSVDIATKENLEKLYQIGENLLKKPVSRVNLENGLFQPLKN  295

Query  541  AGTNKDALKRL  573
              TN+ ALKRL
Sbjct  296  GETNEHALKRL  306



>ref|XP_010269043.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=381

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+A+  VT+ +    P +        + +   RF
Sbjct  197  FQTQDPDGKVREFNLIDGGVAANNPTLVAMREVTKEITKGSPDFF-----PIKPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K A+KY+A QAA WGV+GWL +G   PL+DVF+ AS DMVD HI+ +FQA
Sbjct  252  LVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVFTHASGDMVDLHISVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ DNYLRIQ+D L  + +SVDV TKENLD L +VG+ LL  PV ++NL TG  EP   
Sbjct  312  LRSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKVGEALLKNPVSRVNLDTGIYEPSKT  371

Query  541  AGTNKDALKR  570
             GTN++ L+R
Sbjct  372  KGTNEEELRR  381



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+A+  VT+ +    P +        + +   RF
Sbjct  197  FQTQDPDGKVREFNLIDGGVAANNPTLVAMREVTKEITKGSPDFFPI-----KPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K A+KY+A QAA WGV+GWL +G   PL+DVF+ AS DMVD HI+ +FQA
Sbjct  252  LVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVFTHASGDMVDLHISVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ DNYLRIQ+D L  + +SVDV TKENLD L +VG+ LL  PV ++NL TG  EP   
Sbjct  312  LRSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKVGEALLKNPVSRVNLDTGIYEPSKT  371

Query  541  AGTNKDALKRL  573
             GTN++ L+R 
Sbjct  372  KGTNEEELRRF  382



>ref|XP_010064190.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=328

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D      E+NLIDGGVAANNPTL+A+  VT+ ++  +  +        + +   RF
Sbjct  120  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF-----PIKPMDYRRF  174

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+HI+ +FQA
Sbjct  175  LVISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQA  233

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL TG  EP P 
Sbjct  234  LHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPN  293

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  294  QETNEEALRRF  304



>gb|KCW66180.1| hypothetical protein EUGRSUZ_F00017 [Eucalyptus grandis]
Length=334

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D      E+NLIDGGVAANNPTL+A+  VT+ ++  +  +        + +   RF
Sbjct  126  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFFPI-----KPMDYRRF  180

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+HI+ +FQA
Sbjct  181  LVISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQA  239

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL TG  EP P 
Sbjct  240  LHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPN  299

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  300  QETNEEALRRF  310



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D+KG   E++LIDGGVAANNP LIAIS V++ +   +P +        + +   RF
Sbjct  198  FKVEDSKGNVREHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFYPI-----KPMEYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K   KY +   A WG++ WL      PL++VF+ +SADMVDYH + +FQA
Sbjct  253  LVISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEVFTQSSADMVDYHNSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ D+YLRIQED+L G+ ASVDV TKENL+ L E+G+KLL KP+ ++NL TG  EP+PK
Sbjct  313  LRSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGEKLLKKPLSRVNLETGLTEPIPK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_009629882.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=232

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NL+DGGVAANNP L+A S VT +++  +P +        + +   RF
Sbjct  24   FQTQDKDGNFHEFNLVDGGVAANNPALVATSEVTHQIMTGNPDFF-----PIKPINYERF  78

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS D+VD HI+ +FQA
Sbjct  79   LVISIGTGSAKVEQKYNAKIASNWGILGWLLNGGSTPIVDVFTQASGDLVDLHISVVFQA  138

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ +NYLRIQ D L G+ +SVD+ TKEN+D L ++GK LL KPV ++NL TG +E    
Sbjct  139  LQSEENYLRIQNDTLIGTDSSVDIATKENMDKLVKIGKTLLKKPVSRVNLQTGLSEQCEN  198

Query  541  AGTNKDALKRL  573
             GTN++ LKR 
Sbjct  199  GGTNEETLKRF  209



>gb|KCW66469.1| hypothetical protein EUGRSUZ_F002673, partial [Eucalyptus grandis]
Length=249

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 130/189 (69%), Gaps = 6/189 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D      E+NLIDGGVAANNPTL+A+  VT+ ++  +  +        + +   RF
Sbjct  67   FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF-----PIKPMDYRRF  121

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+HI+ +FQA
Sbjct  122  LVISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQA  180

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL TG  EP P 
Sbjct  181  LHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPN  240

Query  541  AGTNKDALK  567
              TN++AL+
Sbjct  241  QETNEEALR  249



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIAIS V++ ++  +  +        + +   RF
Sbjct  204  FKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEILKDNSDFFPI-----KPMDYGRF  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K+  KY A  AA WG++ WL      PLI+VF  +SAD+VDYH + +FQA
Sbjct  259  LVISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQED+L G+ ASVD+ TKENL+ L E+G+ LL KP+ ++NL TG  EP+PK
Sbjct  319  LHSDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPK  378

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  379  GGTNEEALIRF  389



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D      E+NLIDGGVAANNPTL+A+  VT+ ++  +  +        + +   RF
Sbjct  212  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF-----PIKPMDYRRF  266

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+HI+ +FQA
Sbjct  267  LVISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQA  325

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL TG  EP P 
Sbjct  326  LHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPN  385

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  386  QETNEEALRRF  396



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            E+NLIDGGVAANNP LIAI  +T+R+  ++P +       K    C RFL++S+GTG+ K
Sbjct  213  EFNLIDGGVAANNPALIAIRELTKRVFGENPDFF----PIKPMDYC-RFLVISLGTGSPK  267

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
               KY+A+ AA WGV+GWL  G   PL+DVF+ A ADMVD+HIA +FQAL++  NYLRIQ
Sbjct  268  KEMKYSAKMAAKWGVMGWLLNGSSTPLVDVFTQAGADMVDFHIAVVFQALKSESNYLRIQ  327

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDALKRL  573
            +D L G+ ASVD+ TK+NL+ L +VG++LL KPV ++NL TG +EPV   G N++ALK+ 
Sbjct  328  DDTLTGAVASVDIATKKNLENLVKVGEELLKKPVSRINLETGLSEPVANGGINEEALKKF  387



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 127/191 (66%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ +V     +     +        RF
Sbjct  198  FETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFFPIKPTDYR-----RF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G PLIDVF+ ASADMVDYH+  +FQA
Sbjct  253  LVISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLFAVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ  DNYLRIQ+D L G  +SVDV TK+NL  L + G+ LL KPV ++NL TG  EP P 
Sbjct  312  LQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVCEPTPN  371

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  372  QETNEEALMRF  382



>ref|XP_004979715.1| PREDICTED: patatin-2-Kuras 1-like [Setaria italica]
Length=410

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T+D KGG  EY+L++GGVAANNPT+ A+S +T+ ++  +P +     S         +
Sbjct  207  FTTSDGKGGSREYHLVNGGVAANNPTMAAMSMLTKEVLRHNPDFNPGKPSDYR-----HY  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+SIGTG++K  +KYTA Q A WG+L WL  G   P+ID+FS AS+DMVD H A +F+A
Sbjct  262  LIISIGTGSAKQEEKYTAPQCAKWGLLQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFEA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G T+SVD+TTKEN++AL  +G +LL KPV ++N+ TG  EPV  
Sbjct  322  LHCEKNYLRIQDDSLTGDTSSVDITTKENMEALIRIGHELLKKPVSRVNIDTGMYEPVNG  381

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  382  EGTNEEALARF  392



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E+NLIDGGVAANNP LIAIS V++ +   +P +        + +   RF
Sbjct  198  FKVEDGKGNVKEHNLIDGGVAANNPGLIAISEVSKEIFKNNPDFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K   KY +   A WG++ WL      PL++VF+ +SADMVDYH + +FQA
Sbjct  253  LVISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEVFTQSSADMVDYHNSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ ++YLRIQED+L G+ ASVDV TK+NL+ L E+G+KLL KP+ ++NL TG  EP+PK
Sbjct  313  LRSENSYLRIQEDELIGTEASVDVATKKNLERLVEIGEKLLKKPLSRVNLETGLTEPIPK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_006374978.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
 gb|ERP52775.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
Length=417

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPTA-----PMDYGRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DMVD HI+T+FQA
Sbjct  262  LVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  322  LHSEENYLRIQDDTLSGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDK  381

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  382  M-TNEEALIKM  391



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  200  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINREGP-----DSYHMNPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WGVLGWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  255  LVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  +SVDV TKENL+ L +VG +LL KPV ++NL TG  EP+ K
Sbjct  315  LSSEENYLRIQDDTLTGKLSSVDVATKENLENLVKVGVELLKKPVSRVNLATGVFEPINK  374

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  375  M-TNEEALRKL  384



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AIS V+Q +  + P      +     +   RF
Sbjct  201  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINREGP-----DSYHMNPMEYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WGVLGWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  256  LVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV T ENL+ L +VG++LL KPV ++NL TG  EP+ K
Sbjct  316  LNSEENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPINK  375

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  376  M-TNEEALRKL  385



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AIS V+Q +  + P      +     +   RF
Sbjct  200  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINREGP-----DSYHMNPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WGVLGWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  255  LVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV T ENL+ L +VG++LL KPV ++NL TG  EP+ K
Sbjct  315  LNSEENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPINK  374

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  375  M-TNEEALRKL  384



>ref|XP_006374974.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
 gb|ERP52771.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
Length=392

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  182  FETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFFPTA-----PMDYGRF  236

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DM+D HI+T+FQA
Sbjct  237  LVLSLGTGTAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQA  296

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  297  LHCEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVDK  356

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  357  M-TNEEALIKM  366



>ref|XP_011030324.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=417

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  209  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPTA-----PMDYGRF  263

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WG+LGWL   +  PL+DVF+ AS DMVD HI+T+FQA
Sbjct  264  LVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQA  323

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  324  LHSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDK  383

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  384  M-TNEEALIKM  393



>ref|XP_011030334.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=415

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPTA-----PMDYGRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WG+LGWL   +  PL+DVF+ AS DMVD HI+T+FQA
Sbjct  262  LVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  322  LHSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDK  381

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  382  M-TNEEALIKM  391



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 127/191 (66%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ +V     +        + +   RF
Sbjct  198  FETEDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFF-----PIKPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G PLIDVF+ ASADMVDYH++ +FQA
Sbjct  253  LVISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLSAVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ  DNYLRIQ+D L G  +SVDV TK+NL  L + G+ LL KP  ++NL  G  EP P 
Sbjct  312  LQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPASRVNLENGVCEPTPN  371

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  372  QETNEEALIRF  382



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 138/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   ++NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  200  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP-----DSYRMNPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WG+LGWL      PL+DVF+ ASADMVD+HI+T+FQA
Sbjct  255  LVLSLGTGTAKSEEKYDAEEAAKWGLLGWLTSDHSTPLVDVFTQASADMVDFHISTVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG++LL KPV ++NL TG  EP+ K
Sbjct  315  LNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINK  374

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  375  M-TNEEALRKL  384



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G + E+NLIDGGV ANNP L+AIS VT+++  ++P +        + +   RF
Sbjct  199  FKTQDQDGNEREFNLIDGGVTANNPALVAISEVTKQITKENPDFF-----PIKPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG +K   KY A  A  WG++ WL  G   PL+DVF+ AS DMVDYH A +FQA
Sbjct  254  LVISIGTGTAKMEQKYNANMATKWGIIQWLVNGGSTPLVDVFTQASGDMVDYHNAVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++G +YLRIQ+D L G  +SVD+ TKENLD L + G+ LL KPV  +NL TG  EP+  
Sbjct  314  LKSGSSYLRIQDDTLVGEISSVDIATKENLDNLVKAGEALLKKPVSGVNLQTGIFEPITN  373

Query  541  AGTNKDALKRL  573
             GTN++ALK+ 
Sbjct  374  GGTNEEALKKF  384



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NL+DGGVAANNP L+A S VTQ+++  +P +        + +   RF
Sbjct  204  FQTQDKDGNFHEFNLVDGGVAANNPALVATSQVTQQIMTGNPDFFPI-----KPIDYGRF  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD HI+ +FQA
Sbjct  259  LVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVD+ TKEN++ L E+GK LL KPV ++NL TG +E    
Sbjct  319  LHSEENYLRIQDDTLTGTNSSVDIATKENMNKLVEIGKTLLKKPVSRVNLQTGLSEQCKN  378

Query  541  AGTNKDALKRL  573
             GTN++ LKR 
Sbjct  379  GGTNEETLKRF  389



>ref|XP_006374981.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
 gb|ERP52778.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
Length=417

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  209  FETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFFPTA-----PMDYGRF  263

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DMVD H++T+FQA
Sbjct  264  LVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQA  323

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  324  LHSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVARVDLGTGIFTPVDK  383

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  384  M-TNEEALIKM  393



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNPTL+A+  VT+ +V     +        + +   RF
Sbjct  198  FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSSDFF-----PIKPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K   KYTA +AA WGVL WL  G G+PLIDVFS ASADMVDYH++ +FQA
Sbjct  253  LMISLGTGTTKAEGKYTAPEAAKWGVLRWLTSG-GSPLIDVFSHASADMVDYHLSAVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ  DNYLRIQ+D L G  +SVDV TK+NL+ L ++G+ LL KPV ++NL T  +EP   
Sbjct  312  LQLHDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSS  371

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  372  QETNEEALRRF  382



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNPTL+A+  VT+ +V     +        + +   RF
Sbjct  195  FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSSDFF-----PIKPMDYRRF  249

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K   KYTA +AA WGVL WL  G G+PLIDVFS ASADMVDYH++ +FQA
Sbjct  250  LMISLGTGTTKAEGKYTAPEAAKWGVLRWLTSG-GSPLIDVFSHASADMVDYHLSAVFQA  308

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ  DNYLRIQ+D L G  +SVDV TK+NL+ L ++G+ LL KPV ++NL T  +EP   
Sbjct  309  LQLHDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSS  368

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  369  QETNEEALRRF  379



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   ++NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  200  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP-----DSYHMNPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WGVLGWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  255  LVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG++LL KPV ++NL TG  EP+ K
Sbjct  315  LSSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINK  374

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  375  M-TNEEALRKL  384



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   ++NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  201  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP-----DSYHMNPMEYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WGVLGWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  256  LVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG++LL KPV ++NL TG  EP+ K
Sbjct  316  LSSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINK  375

Query  541  AGTNKDALKRL  573
              TN++AL++L
Sbjct  376  M-TNEEALRKL  385



>ref|XP_010059971.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
 gb|KCW66465.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=334

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ ++     +      + + +   RF
Sbjct  126  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF-----AIKPMDYRRF  180

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG SK   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+H++ +FQA
Sbjct  181  LVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQA  239

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL +G  +P   
Sbjct  240  LNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSN  299

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  300  QETNEEALKRF  310



>ref|XP_006374976.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52773.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPAA-----PMDYGRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DMVD HI+T+FQA
Sbjct  262  LVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   +NY+RIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  322  LHCEENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDK  381

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  382  M-TNEEALIKM  391



>gb|KCW66175.1| hypothetical protein EUGRSUZ_F00011 [Eucalyptus grandis]
Length=334

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ ++     +      + + +   RF
Sbjct  126  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF-----AIKPMDYRRF  180

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG SK   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+H++ +FQA
Sbjct  181  LVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQA  239

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL +G  +P   
Sbjct  240  LNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSN  299

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  300  QETNEEALKRF  310



>ref|XP_006374977.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52774.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPAA-----PMDYGRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DMVD HI+T+FQA
Sbjct  262  LVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   +NY+RIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  322  LHCEENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDK  381

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  382  M-TNEEALIKM  391



>ref|XP_006374973.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
 gb|ERP52770.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
Length=414

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  206  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFFPTA-----PMDYGRF  260

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG++K  +KY A +AA WGVLGWL   +  PL+DVF+ AS DM+D HI+T+FQA
Sbjct  261  LVLSLGTGSAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQA  320

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   +NY+RIQ+D L G+ +SVD+ TKENL+ L +VG+KLL KPV +++L TG   PV K
Sbjct  321  LHCEENYIRIQDDTLTGTLSSVDIATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVDK  380

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  381  M-TNEEALIKM  390



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D KGG  EY+L+DGGVAANNPT+IA+S +T+ ++ ++P +     +  +      +
Sbjct  205  FTTDDGKGGSREYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDF-----NPGKPTEYRNY  259

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG++ WL +G   P+ID+FS ASADMVD H A +F++
Sbjct  260  LIISVGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFES  319

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G  +SVD+ TKEN++AL  +GK+LL KPV ++N+ TG  E V  
Sbjct  320  LHCQKNYLRIQDDSLTGDASSVDIATKENMEALIGIGKELLRKPVARVNIDTGMYEAVAG  379

Query  541  AGTNKDALKRL  573
             GTN+DAL R 
Sbjct  380  EGTNEDALARF  390



>ref|XP_003589237.1| Patatin-like protein [Medicago truncatula]
 gb|AES59488.1| patatin-like phospholipase [Medicago truncatula]
Length=298

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +1

Query  13   DAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            D  G + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RFLI+S
Sbjct  88   DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFFPI-----KPLEYGRFLIIS  142

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            IGTG +K  +K+TAQ AA WG+L WL Q   NPLIDVF+ +S DMVD+H++ + QAL + 
Sbjct  143  IGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSA  202

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
            DNYLRIQ+D L G  +SVD+ T+ENL  L ++G+ LL KPV ++NL  G  EP+    TN
Sbjct  203  DNYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETN  262

Query  553  KDALKRL  573
            ++ALKRL
Sbjct  263  EEALKRL  269



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NL+DGGVAANNP L+A S VT++++  +P +        + +   RF
Sbjct  202  FRTQDKDGNFHEFNLVDGGVAANNPALVATSQVTRQIMTGNPDFFPI-----KPIDYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD HI+ +FQA
Sbjct  257  LVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVD++TKEN+D L E+GK LL KPV ++NL TG +E    
Sbjct  317  LHSEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKN  376

Query  541  AGTNKDALKRL  573
             GTN++ LKR 
Sbjct  377  DGTNEETLKRF  387



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T ++ G K E+NL+DGGVAANNPTL+A++ VT R ++K      S  S  + +   RF
Sbjct  198  FETKNSDGSKREFNLVDGGVAANNPTLVAMNQVT-REISKG----NSDFSPMKPLEFDRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K   KY A  AA WG+L WL  G  +PL+DVF+ AS+DMVD+H+ATIFQ 
Sbjct  253  LVLSLGTGTAKIEQKYDADNAAKWGILAWLVNGGSSPLVDVFTEASSDMVDFHLATIFQT  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ   NYLRIQ+D L G  +SVD+ TK NL+ L +VG+KLL KPV ++NL +G  EP+  
Sbjct  313  LQCEANYLRIQDDTLTGDLSSVDIATKTNLENLVQVGEKLLKKPVSRVNLQSGVFEPL-N  371

Query  541  AGTNKDALKRL  573
             GTN+DALK+ 
Sbjct  372  QGTNEDALKKF  382



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NL+DGGVAANNP L+A S VT++++  +P +        + +   RF
Sbjct  202  FRTQDKDGNFHEFNLVDGGVAANNPALVATSQVTRQIMTGNPDFF-----PIKPIDYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD HI+ +FQA
Sbjct  257  LVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVD++TKEN+D L E+GK LL KPV ++NL TG +E    
Sbjct  317  LHSEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKN  376

Query  541  AGTNKDALKR  570
             GTN++ LKR
Sbjct  377  DGTNEETLKR  386



>gb|EMT13605.1| Patatin group A-3 [Aegilops tauschii]
Length=397

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            EY+L+DGGVAANNPT++A+S +TQ ++ ++P +    T  K A   + +LI+SIGTG +K
Sbjct  206  EYHLVDGGVAANNPTMVAMSMITQEVMRRNPDF----THGKPAEYSN-YLIISIGTGTAK  260

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
             A+KYTA   A WGVL WL  G   PL+D+FS ASADMVD H A +FQ+L+   NYLRIQ
Sbjct  261  QAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHAAVLFQSLRVEKNYLRIQ  320

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDALKRL  573
            +D L G T+SVD++TKEN+ AL E+G KLL   V ++N+ TG  EPV   GTN++AL R 
Sbjct  321  DDSLTGHTSSVDISTKENMQALIEIGNKLLKMSVARVNIDTGMYEPVDGEGTNEEALARF  380



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   E++LIDGGVAANNP LIAIS V++ +   +P +        + +   RF
Sbjct  198  FKVEDGKGNVKEHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K   KY +   A WG++ WL      PL++VF+ +SADMVDYH + +FQA
Sbjct  253  LVISLGTGAAKCEQKYNSLMGAKWGIVDWLIHKGSTPLVEVFTQSSADMVDYHNSIVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ ++YLRIQED+L G+ ASVDV TK+NL+ L E+G++LL KP+ ++NL TG +EP PK
Sbjct  313  LRSENSYLRIQEDELIGTEASVDVATKKNLERLVEIGEQLLKKPLSRVNLETGLSEPTPK  372

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  373  GGTNEEALKRF  383



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   DA G   E++L+DGGVAANNPTLIAIS VT+++  ++  +     S  + +   RF
Sbjct  229  FTNQDANGNVREFDLVDGGVAANNPTLIAISEVTKQIYKQNRDF-----SPLKPMDYSRF  283

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KYTA  AA WG++ WL      P++DV+S AS+DMVD H++ IFQA
Sbjct  284  LVISIGTGSAKIEQKYTASMAAEWGIIKWLFNNGDVPIVDVYSQASSDMVDLHMSVIFQA  343

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D+L G  + VD+ TKENLD L ++G++LL KP+ ++NL TG +EP+  
Sbjct  344  LHSQDRYLRIQDDELAGEESLVDIATKENLDKLVQIGEQLLKKPLARVNLETGLSEPLEN  403

Query  541  AGTNKDALKRL  573
              TNKDALKR 
Sbjct  404  GVTNKDALKRF  414



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F   D +G  V E+NLIDGGVAANNPTL+AI  VT++++ K P  ++SS      +   R
Sbjct  200  FTKQDEQGNVVREFNLIDGGVAANNPTLVAIREVTKQIIRK-PNEISSS-----PLNYDR  253

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL+LS+GTG++K   KY A+  + WG+L W+ +    P+ID FS AS+DMVDYH   +F+
Sbjct  254  FLVLSLGTGSNKNEHKYDAKMVSKWGILTWVFRSGLTPIIDCFSEASSDMVDYHNCVVFR  313

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            ALQ+ DNYLRIQ+D LKG  ASV + T ENL+ L  VGK+LL K V ++NL TG  EPVP
Sbjct  314  ALQSEDNYLRIQDDTLKGDLASVHIATTENLNNLVNVGKQLLKKRVTRVNLDTGLYEPVP  373

Query  538  KAGTNKDALKRL  573
              GTN++ALKR 
Sbjct  374  DKGTNEEALKRF  385



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D+ G   E+NLIDGGV ANNPTL+A++ VT++++ ++     S     + +   RF
Sbjct  202  FNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQN-----SDLFPIKPLEYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+SIGTG +K  +K+ AQ AA WG+L WL Q    PLIDVF+ +SADMVD+H++ + QA
Sbjct  257  LIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSSADMVDFHLSAVTQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD+ TKENL+ L ++G+KLL KPV ++NL  G  EP+  
Sbjct  317  LHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKN  376

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  377  RETNEDALKRF  387



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D+ G   E+NLIDGGV ANNPTL+A++ VT++++ ++     S     + +   RF
Sbjct  202  FNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQN-----SDLFPIKPLEYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+SIGTG +K  +K+ AQ AA WG+L WL Q    PLIDVF+ +SADMVD+H++ + QA
Sbjct  257  LIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSSADMVDFHLSAVTQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD+ TKENL+ L ++G+KLL KPV ++NL  G  EP+  
Sbjct  317  LHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKN  376

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  377  RETNEDALKRF  387



>ref|XP_010269013.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=404

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 134/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   E+NLIDGGVAANNP L+AI  V++ ++ K+P      + S + +   RF
Sbjct  197  FETKDEEGKVREFNLIDGGVAANNPALVAIGEVSKDII-KNP-----DSFSIKPMEFGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K   KY A+QA+ WGVLGWL     +PL+DVF+ AS DMVDYH++ +FQA
Sbjct  251  LVLSLGTGAPKSEHKYGAKQASKWGVLGWLHSDGSSPLVDVFTQASGDMVDYHVSAVFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD  +KENLD L +VG+ LL KPV ++NL TG  EP  +
Sbjct  311  LSSKDNYLRIQDDTLGGTVSSVDFASKENLDNLVKVGEALLKKPVSRVNLDTGIYEPCKE  370

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  371  QITNEEALRRF  381



>ref|XP_010269022.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=380

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   E+NLIDGGVAANNP L+AI  V++ ++ K+P      + S + +   RF
Sbjct  197  FETKDEEGKVREFNLIDGGVAANNPALVAIGEVSKDII-KNP-----DSFSIKPMEFGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K   KY A+QA+ WGVLGWL     +PL+DVF+ AS DMVDYH++ +FQA
Sbjct  251  LVLSLGTGAPKSEHKYGAKQASKWGVLGWLHSDGSSPLVDVFTQASGDMVDYHVSAVFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD  +KENLD L +VG+ LL KPV ++NL TG  EP  +
Sbjct  311  LSSKDNYLRIQDDTLGGTVSSVDFASKENLDNLVKVGEALLKKPVSRVNLDTGIYEPCKE  370

Query  541  AGTNKDALKR  570
              TN++AL+R
Sbjct  371  QITNEEALRR  380



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ ++     +      + + +   RF
Sbjct  198  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF-----AIKPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG SK   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+H++ +FQA
Sbjct  253  LVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL +G  +P   
Sbjct  312  LNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSN  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  QETNEEALKRF  382



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ ++     +      + + +   RF
Sbjct  220  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF-----AIKPMDYRRF  274

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG SK   KYTA +AA WGVLGWL  G G+PLIDVFS ASADMVD+H++ +FQA
Sbjct  275  LVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQA  333

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G  +SVDV TK+NL+ L + G+ LL KPV ++NL +G  +P   
Sbjct  334  LNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSN  393

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  394  QETNEEALKRF  404



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 127/191 (66%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A+  VT+ ++     +        + +   RF
Sbjct  198  FETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF-----PIKPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   KYTA +AA WGVLGWL  G G PLIDVF+ ASADMVDYH+  +FQA
Sbjct  253  LVISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLCAVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ  DNYLRIQ+D L G  +SVDV TK+NL  L + G+ LL KPV ++NL TG  EP   
Sbjct  312  LQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVGEPTTN  371

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  372  QETNEEALIRF  382



>gb|EMT31709.1| Patatin group A-3 [Aegilops tauschii]
Length=366

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E+NLIDGGVAANNP L+AI  V++++  +DP +        + +   RF
Sbjct  180  FKTEDSHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKQDPDFFPI-----KPMDYGRF  234

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK+ +KY AQ+A +WGVL WL      PL+D+F+ ASADMVD HIA++F+A
Sbjct  235  LVISLGTGSSKFEEKYDAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIASVFKA  294

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ +SVDV TK+NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  295  LHSEQNYLRIQDDKLRGTLSSVDVATKDNLEKLVNVGEMLLKKPVSRANLETGQMVPACS  354

Query  541  --AGTNKDALKR  570
                TN++ALKR
Sbjct  355  DTEETNEEALKR  366



>gb|KJB58443.1| hypothetical protein B456_009G210300 [Gossypium raimondii]
Length=322

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E+NLIDGGVAANNPTL+A++ VT+ ++  +P++     +        RF
Sbjct  102  FQTQDSTGKTKEFNLIDGGVAANNPTLVAMNEVTKEILRGNPEFFPIKPTDYA-----RF  156

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A  AA WGVLGWL      PL+D+F  AS+DMVD+HIAT+FQA
Sbjct  157  LVVSLGTGSPKSEGKYHANMAAKWGVLGWLTSEHSTPLVDIFMQASSDMVDFHIATVFQA  216

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ ++YLRIQ+D L    +SVD+ TKENL+ L +VG++LL K V ++NL  G+ EP  K
Sbjct  217  LQSENSYLRIQDDTLSQQISSVDIATKENLENLVKVGEELLNKSVSRVNLENGQFEPAGK  276

Query  541  AGTNKDALKRL  573
              TN +AL RL
Sbjct  277  V-TNGEALIRL  286



>gb|EMS66123.1| Patatin group A-3 [Triticum urartu]
Length=405

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 134/192 (70%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E+NLIDGGVAANNP L+AI  V++++  +DP +        + +   RF
Sbjct  219  FKTEDSHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKQDPDFFPI-----KPMDYGRF  273

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK+ +KY AQ+A +WGVL WL      PL+D+F+ ASADMVD HIA++F+A
Sbjct  274  LVISLGTGSSKFEEKYDAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIASVFKA  333

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D+L+G+ +SVDV TK+NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  334  LHSEQNYLRIQDDNLRGTLSSVDVATKDNLEKLVNVGEMLLKKPVSRANLETGQMVPACS  393

Query  541  --AGTNKDALKR  570
                TN++ALKR
Sbjct  394  DIEETNEEALKR  405



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D++G   ++NLIDGGV ANNPTL+A++ VT++++  +P +      S + +   RF
Sbjct  200  FNNKDSEGNMHQFNLIDGGVCANNPTLVAMNQVTKQILNDNPDFF-----SIKPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ AQ AA WG+L WL      PLIDVF+ +SADMVD+H+AT+ QA
Sbjct  255  LIISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+  SVD+ TKENL+ L ++G++LL KPV ++NL  G  EPV  
Sbjct  315  LHSENNYLRIQDDTLTGTDYSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFEPVGN  374

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  375  GETNEDALKRF  385



>ref|XP_008813725.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008813726.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
Length=336

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DAKG   E++LIDGGVAANNP LIAI  VT+ +   +P Y          +   + 
Sbjct  126  FETKDAKGNVREFHLIDGGVAANNPALIAIREVTKEVHKGNPDYFPY-----RPMDYRKL  180

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++YTA++A+ WGVLGWL  G   PL+DVF  +SADMVD HI+ +FQA
Sbjct  181  LLISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSADMVDIHISVVFQA  240

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI++D L G+ +SVDV+TK+NL  L + G++LL KPV ++NL TG  E V  
Sbjct  241  LRSESNYLRIEDDTLNGTVSSVDVSTKDNLQDLVKRGEQLLKKPVSRVNLETGVFETVGN  300

Query  541  A-GTNKDALKRL  573
              GTNKDAL+R 
Sbjct  301  GEGTNKDALRRF  312



>gb|EPS59074.1| hypothetical protein M569_15736, partial [Genlisea aurea]
Length=355

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 128/192 (67%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGG-KVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F  A A GG   ++NLIDGGVAANNP L AI  VT ++  +D      S S  + +   +
Sbjct  156  FTNAAASGGDSWDFNLIDGGVAANNPALAAIREVTNQLYKQD-----RSFSHYQTLDYTK  210

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG+ K   KYTA++AA W VLGWL  G+  P+I+VFS AS DMVDY ++ +FQ
Sbjct  211  FLVISLGTGSDKQEQKYTAKEAAQWSVLGWLIHGNSVPIIEVFSQASVDMVDYFLSVVFQ  270

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            A  + DNYLRIQ+D L G  +S DV TK+N+D L  +G+ LL K V + +L TG  E +P
Sbjct  271  AFHSQDNYLRIQDDALPGDNSSSDVATKKNMDDLVGIGEDLLKKSVSRFDLQTGNYEAIP  330

Query  538  KAGTNKDALKRL  573
            K GTN+DALKR 
Sbjct  331  KGGTNEDALKRF  342



>gb|EMS45954.1| Patatin group A-3 [Triticum urartu]
Length=398

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            EY+L+DGGVAANNPT++A+S +TQ ++ ++P +    T  K A   + +LI+SIGTG +K
Sbjct  206  EYHLVDGGVAANNPTMVAMSMITQEVMRRNPDF----THGKPAEYSN-YLIISIGTGTAK  260

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
             A+KYTA   A WGVL WL  G   PL+D+FS ASADMVD H A +FQ+L+   NYLRIQ
Sbjct  261  QAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHAAVLFQSLRVEKNYLRIQ  320

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDALKRL  573
            +D L G T+SVD++TKEN++AL  +G KLL   V ++N+ TG  EPV   GTN++AL R 
Sbjct  321  DDSLTGHTSSVDISTKENMEALIGIGNKLLKMSVARVNIDTGMYEPVDDEGTNEEALARF  380



>ref|XP_006388384.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
 gb|ERP47298.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
Length=332

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AIS V++ +  + P     +      +   RF
Sbjct  122  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINRESPDSFRMN-----PMEYGRF  176

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K   KY A +AA WG+ GWL     +PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  177  LVLSLGTGTAKSEGKYDADEAAKWGIFGWLTGDHSSPLVDVFTQASGDMVDFHISTVFQA  236

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV ++NL TG  EP+ K
Sbjct  237  LNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLQKPVSRVNLATGVFEPINK  296

Query  541  AGTNKDALKRL  573
              TN++AL + 
Sbjct  297  M-TNEEALTKF  306



>ref|XP_007017306.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14531.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T ++ G   E++LIDGGVAANNPTL+A++ VT+ +  K+     S +   +A    RF
Sbjct  210  FETKNSNGEVKEFHLIDGGVAANNPTLVAMNEVTKEITRKN-----SDSFPTKANDFARF  264

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG+ K  +KY A  AA WG+L WL      PL+DVF  AS+DMVD+HIAT+FQA
Sbjct  265  LVLSLGTGSQKCEEKYPAPMAAKWGLLEWLTFQHSTPLMDVFMQASSDMVDFHIATVFQA  324

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ + YLRIQ+D L G+ +SVD+ TKENL+ L +VG++LL KPV ++NL  GK EP+  
Sbjct  325  LQSEEKYLRIQDDTLCGTVSSVDIATKENLENLVKVGEELLKKPVSRVNLDNGKFEPINN  384

Query  541  AGTNKDALKRL  573
              TN++AL RL
Sbjct  385  EDTNENALIRL  395



>ref|XP_010238243.1| PREDICTED: patatin-like protein 2 isoform X3 [Brachypodium distachyon]
Length=331

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 131/195 (67%), Gaps = 11/195 (6%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  VT+++  ++P +        + +   RF
Sbjct  127  FKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFFPI-----KPMDYGRF  181

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK+ +KY AQ+A +WGVL WL      PL+D+F+ ASADMVD HIA +F+A
Sbjct  182  LVISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKA  241

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ +SVDV TK+NL+ L  VG+ LL K V + NL TG+   VP 
Sbjct  242  LHSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQM--VPT  299

Query  541  AG----TNKDALKRL  573
             G    TN+ AL+R 
Sbjct  300  CGDSEMTNEKALERF  314



>gb|KJB29508.1| hypothetical protein B456_005G104200 [Gossypium raimondii]
Length=401

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   ++NLIDGGVAANNP LIA+  VT+++      +    +  K A   +RF
Sbjct  198  FETEDTDGKVKKFNLIDGGVAANNPALIAMGEVTKQIHKGHSDF----SCIKAANHYNRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG+ K A+KYTA+QAA WGVLGWL  G+  PLI+ FS  SADMVD+HI+ IF++
Sbjct  254  LVLSVGTGSEKLAEKYTAKQAAQWGVLGWLTSGNSTPLINAFSEGSADMVDFHISVIFKS  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D LKG  +SVDV+T+EN+  L +V + LL KPV ++N  TG  EP   
Sbjct  314  LNSEQNYLRIQDDKLKGEVSSVDVSTEENMKILAKVAENLLNKPVSRVNFETGNYEPSGD  373

Query  541  AGTNKDALKR  570
              TN  AL R
Sbjct  374  LETNAQALIR  383



>gb|EMT30617.1| Patatin group A-3 [Aegilops tauschii]
Length=408

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = +1

Query  1    FDTADAKG--GKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCH  174
            F T D  G     EY+LIDGGVAANNPT+ A+S +T+ ++ ++P +    T  K A   H
Sbjct  201  FTTRDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPA-EYH  255

Query  175  RFLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIF  354
            R+LI+SIGTG +K A+KYTA   A WGVL WL  G   PLID+FS ASADMVD H A +F
Sbjct  256  RYLIISIGTGTAKQAEKYTAPNCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAILF  315

Query  355  QALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV  534
            QAL    NYLRIQ+D L G T+SVD++TK N++AL  +G  LL K V ++N+ TG  EPV
Sbjct  316  QALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGIGNMLLKKKVARVNIDTGVYEPV  375

Query  535  PKAGTNKDALKRL  573
               GTN++AL   
Sbjct  376  DDEGTNEEALAHF  388



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +1

Query  13   DAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            D  G + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RFLI+S
Sbjct  205  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFFPI-----KPLEYGRFLIIS  259

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            IGTG +K  +K+TAQ AA WG+L WL Q   NPLIDVF+ +S DMVD+H++ + QAL + 
Sbjct  260  IGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSA  319

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
            DNYLRIQ+D L G  +SVD+ T+ENL  L ++G+ LL KPV ++NL  G  EP+    TN
Sbjct  320  DNYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETN  379

Query  553  KDALKRL  573
            ++ALKRL
Sbjct  380  EEALKRL  386



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D      E+NL+DGGVAANNP L+A S VT++++A +P +        + +   RF
Sbjct  204  FKTQDRDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDFFPI-----KPIDYGRF  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD+HI+ +FQA
Sbjct  259  LVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLR+Q+D L G+ +SVD++TKEN++ L E+G  LL KPV ++NL TG  E   K
Sbjct  319  LHSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEECKK  378

Query  541  AGTNKDALKRL  573
              TN++ LKR 
Sbjct  379  DDTNEETLKRF  389



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G K  +NL+DGGVAANNPTL A++ V++ ++  +P +      S + V   RF
Sbjct  207  FETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFF-----SYQPVEYDRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K  +K+TAQ++A WGVLGWL      PLID+F+ ASADMVD H + +FQA
Sbjct  262  LVISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVLFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L  G NYLRI++D L G T+SVDV+TK+NL  L ++G  LL KPV ++N+ TG +E V  
Sbjct  322  LNKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEAVDG  381

Query  541  AGTNKDAL  564
             GTN+ AL
Sbjct  382  EGTNEAAL  389



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G K  +NL+DGGVAANNPTL A++ V++ ++  +P +      S + V   RF
Sbjct  211  FETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFF-----SYQPVEYDRF  265

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K  +K+TAQ++A WGVLGWL      PLID+F+ ASADMVD H + +FQA
Sbjct  266  LVISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVLFQA  325

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L  G NYLRI++D L G T+SVDV+TK+NL  L ++G  LL KPV ++N+ TG +E V  
Sbjct  326  LNKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEAVDG  385

Query  541  AGTNKDAL  564
             GTN+ AL
Sbjct  386  EGTNEAAL  393



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D      E+NL+DGGVAANNP L+A S VT++++A +P +        + +   RF
Sbjct  200  FKTQDKDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDFFPI-----KPIDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD+HI+ +FQA
Sbjct  255  LVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVD++TKEN++ L E+G  LL KPV ++NL TG  E   K
Sbjct  315  LHSEENYLRIQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEQSKK  374

Query  541  AGTNKDALKR  570
              TN++ LKR
Sbjct  375  DDTNEETLKR  384



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G K  +NL+DGGVAANNPTL A+S + + +  ++  +      S + V   +F
Sbjct  199  FETKDAQGNKQSFNLVDGGVAANNPTLAAMSQIAKEVCVENKDF-----HSIKPVDYSKF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  +K+TAQ+A+ WGVLGWL      PLI+ F+ ASADMVD H+  +FQA
Sbjct  254  LVISLGTGSAKLEEKFTAQEASKWGVLGWLYDSGDTPLINAFTQASADMVDIHLCAMFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   +NYLRIQ+D+L GST+SVDV+TKENL  L ++G  LL K V ++NL TG  E V  
Sbjct  314  LACRENYLRIQDDNLIGSTSSVDVSTKENLLKLVQIGSDLLKKHVSRVNLETGLFEEVKG  373

Query  541  AGTNKDALKRL  573
              TN++AL RL
Sbjct  374  DVTNEEALTRL  384



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 129/184 (70%), Gaps = 6/184 (3%)
 Frame = +1

Query  25   GKVE-YNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGT  201
            GK++ ++LIDGG+AANNPTL+A+  +T+ +  ++P +        + +   RFL++S+GT
Sbjct  205  GKIKSFHLIDGGIAANNPTLVAMGEITREVHKENPDFF-----PIKPMDYGRFLVISLGT  259

Query  202  GNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNY  381
            G++K  D YTA+ AA WGVLGWL    G PLID F  ASADMVD HI+ +FQAL +  +Y
Sbjct  260  GSAKSTDNYTAKDAAKWGVLGWLYNNGGTPLIDTFQQASADMVDIHISNVFQALHSEQSY  319

Query  382  LRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDA  561
            LRIQ+D L G T+SVD+ T++NL  L +VG +LL K V ++NL TGK EPVP  GTN+ A
Sbjct  320  LRIQDDTLTGDTSSVDIATEKNLKDLVKVGTELLQKQVSRVNLETGKFEPVPNEGTNEQA  379

Query  562  LKRL  573
            L R 
Sbjct  380  LIRF  383



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DAKG   E++LIDGGVAANNP LIAI  VT+ +   +P Y          +   + 
Sbjct  200  FETKDAKGNVREFHLIDGGVAANNPALIAIREVTKEVHKGNPDYF-----PYRPMDYRKL  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++YTA++A+ WGVLGWL  G   PL+DVF  +SADMVD HI+ +FQA
Sbjct  255  LLISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSADMVDIHISVVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI++D L G+ +SVDV+TK+NL  L + G++LL KPV ++NL TG  E V  
Sbjct  315  LRSESNYLRIEDDTLNGTVSSVDVSTKDNLQDLVKRGEQLLKKPVSRVNLETGVFETVGN  374

Query  541  A-GTNKDALKRL  573
              GTNKDAL+R 
Sbjct  375  GEGTNKDALRRF  386



>gb|EMS52853.1| Patatin group M-3 [Triticum urartu]
Length=411

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = +1

Query  1    FDTADAKG--GKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCH  174
            F T D  G     EY+LIDGGVAANNPT+ A+S +T+ ++ ++P +    T  K A   H
Sbjct  204  FTTHDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPA-EYH  258

Query  175  RFLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIF  354
            R+LI+SIGTG +K A+KYTA   A WGVL WL  G   PLID+FS ASADMVD H A +F
Sbjct  259  RYLIISIGTGTAKQAEKYTAPDCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAILF  318

Query  355  QALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV  534
            QAL    NYLRIQ+D L G T+SVD++TK N++AL  +G  LL K V ++N+ TG  EPV
Sbjct  319  QALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGIGNMLLKKKVARVNIDTGVYEPV  378

Query  535  PKAGTNKDALKRL  573
               GTN++AL   
Sbjct  379  DNEGTNEEALAHF  391



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D      E+NL+DGGVAANNP L+A S VT++++A +P +        + +   RF
Sbjct  204  FKTQDRDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDFFPI-----KPIDYGRF  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A+ A+ WG+LGWL  G   P++DVF+ AS DMVD+HI+ +FQA
Sbjct  259  LVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLR+Q+D L G+ +SVD++TKEN++ L E+G  LL KPV ++NL TG  E   K
Sbjct  319  LHSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEECKK  378

Query  541  AGTNKDALKR  570
              TN++ LKR
Sbjct  379  DDTNEETLKR  388



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D++G   E+NLIDGGV ANNPTL+A++ VT++++ ++P +      S + +   RF
Sbjct  200  FKNQDSQGNTHEFNLIDGGVCANNPTLVAMNQVTKQIINENPDFF-----SIKPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ AQ AA WG+L WL      PLIDVF+ +SADMVD+H+AT+ QA
Sbjct  255  LIISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVD+ TKENL+ L ++G++LL KPV ++NL  G  E V  
Sbjct  315  LHSENNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFESVGN  374

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  375  GETNENALKRF  385



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +1

Query  13   DAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            D  G + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RFLI+S
Sbjct  207  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFFPI-----KPLEYGRFLIIS  261

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            IGTG +K  +K+TAQ AA WG+L WL Q   NPLIDVF+ +S DMVD+H++ + QAL + 
Sbjct  262  IGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSA  321

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
            DNYLRIQ+D L G  +SVD+ T+ENL  L ++G+ LL KPV ++NL  G  EP+    TN
Sbjct  322  DNYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETN  381

Query  553  KDALKRL  573
            ++ALKRL
Sbjct  382  EEALKRL  388



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +1

Query  13   DAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            D  G + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RFLI+S
Sbjct  207  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFFPI-----KPLEYGRFLIIS  261

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            IGTG +K  +K+TAQ AA WG+L WL Q   NPLIDVF+ +S DMVD+H++ + QAL + 
Sbjct  262  IGTGAAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSA  321

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
            DNYLRIQ+D L G  +SVD+ T+ENL  L ++G+ LL KPV ++NL  G  EP+    TN
Sbjct  322  DNYLRIQDDTLTGIDSSVDIATEENLKKLYQIGENLLKKPVSRVNLENGHFEPLTNGETN  381

Query  553  KDALKRL  573
            ++ALKRL
Sbjct  382  EEALKRL  388



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T DA+  + E+NLIDGGVAANNPTLIAI  VT++++ K            + +   RF
Sbjct  200  FKTKDAQNNEHEFNLIDGGVAANNPTLIAIGEVTKQVLMKHEDLFPI-----KPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K   KY A+ AA WG+L WL   +  P+I+ F+ ASADMVDYH   +F+A
Sbjct  255  LVISLGTGNAKNEGKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNFVVFKA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ D YLRIQ+D L G+ ASVD+ TKENL+ L +VG++LL KP  K+NL  G  E V  
Sbjct  315  LQSDDQYLRIQDDTLTGNLASVDIATKENLEGLVKVGERLLDKPASKINLDKGVYEAVEN  374

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  375  GGTNKEALRRF  385



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGVAANNP L+AI  VT+++   +P +     +        RF
Sbjct  200  FQNHDELGNVQEFNLIDGGVAANNPALVAIGQVTKQIFRGNPDFFPIKPTD-----YGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K  ++Y A +AA WGV GWL  G   PL+DVF+ ASADMVD H++ +FQA
Sbjct  255  LVISIGTGSAKVEERYNAAKAAKWGVFGWLISGHSTPLVDVFTQASADMVDLHLSEVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SVD+ TK+NLD L   G +LL KPV ++N   G  E +  
Sbjct  315  LHSEDNYLRIQDDTLIGTVSSVDIATKKNLDNLVITGTQLLKKPVSRVNQQNGAVETIAN  374

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  375  GGTNEEALKRF  385



>ref|XP_002305891.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
 gb|EEE86402.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
Length=409

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+AIS V++ +   +P +        + +   RF
Sbjct  205  FQTKDPSGNVREFNLIDGGVAANNPTLVAISEVSKEINRDNPDFF-----PIKPMEYDRF  259

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K   KY A +AA WG+LGWL  G   PL+DVF+ AS DMVD+H+ T+FQA
Sbjct  260  LVLSLGTGTAKSEGKYDADEAAKWGILGWLTSGHSTPLVDVFTKASGDMVDFHLCTVFQA  319

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnll-TGKNEPVP  537
            L++ DNYLRIQ++ L G+ +SVDV TKENL  L +VG++LL K V ++N L TG  EP+ 
Sbjct  320  LKSEDNYLRIQDNTLTGTLSSVDVATKENLQNLVKVGEELLKKSVSRVNYLGTGVFEPIN  379

Query  538  KAGTNKDALKRL  573
            K  TN++AL  L
Sbjct  380  KM-TNEEALIEL  390



>ref|XP_003577355.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=413

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            EY+L+DGGVAANNPT+ A+S +T+ ++ K+P +   + +       + +LI+SIGTG++K
Sbjct  221  EYHLVDGGVAANNPTMAAMSMITKEVLRKNPDFTHGNPAEY-----NNYLIISIGTGSAK  275

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
             A+KYTA   A WGVL WL  G   PLID+FS ASADMVD H A +F+AL+  +NYLRIQ
Sbjct  276  MAEKYTAPACAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAVLFKALRVKENYLRIQ  335

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDALKRL  573
            +D L+G T+SVD+ TK+N++AL E+G  LL K V ++N+ TG  E V   GTN++ALKR 
Sbjct  336  DDSLEGDTSSVDIATKKNMEALIEIGNGLLQKKVARVNIDTGMYETVEGEGTNEEALKRF  395



>ref|XP_003538815.1| PREDICTED: patatin group D-2-like [Glycine max]
Length=403

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 126/192 (66%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F   D +G  + E+NLIDG VAANNPTL AI  VT++++ K      +   S   +   R
Sbjct  201  FTKQDEQGKVIKEFNLIDGSVAANNPTLCAIREVTKQLIRKG-----NGGISINPLEYSR  255

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL+LSIGTG++K   KY A+  + WG+L WL      P++D FS AS DMVDYH   +F 
Sbjct  256  FLVLSIGTGSNKSEHKYNAKMVSKWGILTWLFNSGSTPILDCFSEASFDMVDYHNCVVFS  315

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            ALQ+ DNYLRIQ++ LKG  ASVDV TKENLD L +VG++LL   V ++NL TG  EPVP
Sbjct  316  ALQSEDNYLRIQDNTLKGDLASVDVATKENLDNLVKVGQQLLKNTVTRVNLDTGLYEPVP  375

Query  538  KAGTNKDALKRL  573
              GTN +ALKR 
Sbjct  376  DKGTNVEALKRF  387



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 131/195 (67%), Gaps = 11/195 (6%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  VT+++  ++P +        + +   RF
Sbjct  200  FKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFFPI-----KPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK+ +KY AQ+A +WGVL WL      PL+D+F+ ASADMVD HIA +F+A
Sbjct  255  LVISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ +SVDV TK+NL+ L  VG+ LL K V + NL TG+   VP 
Sbjct  315  LHSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQM--VPT  372

Query  541  AG----TNKDALKRL  573
             G    TN+ AL+R 
Sbjct  373  CGDSEMTNEKALERF  387



>ref|XP_006374982.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
 gb|ERP52779.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
Length=417

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 135/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T    G   E+NLIDGGVAANNPTL+A+S V++ +  K+P +  ++      +   RF
Sbjct  209  FETKGPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFFPTA-----PMDYGRF  263

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WG+LGWL   +  PL+DVF+ AS DMVD H++T+FQA
Sbjct  264  LVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQA  323

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +S+DV TKENL+ L +VG+KLL KPV +++L TG   P  K
Sbjct  324  LHSEENYLRIQDDTLTGTLSSMDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPTDK  383

Query  541  AGTNKDALKRL  573
              TN++AL ++
Sbjct  384  M-TNEEALIKM  393



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D++G   E+NLIDGG+AANNP L+A+  +T+    ++P +        + +  HRF
Sbjct  199  FQTEDSQGNIREFNLIDGGLAANNPALVAMGEITKETFEENPDFFPI-----KPMDYHRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  ++Y+A  A  WGVLGWL      PL+D F  ASADMVD HI+  FQA
Sbjct  254  LVISLGTGSSK-EERYSANHAKRWGVLGWLLSNGSTPLVDAFMQASADMVDIHISEAFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +G NYLRI++D L G  ASVD +TKENL+ L +VG+ LL KPV ++NL TG  EPV +
Sbjct  313  LHSGKNYLRIEDDALSGILASVDTSTKENLENLVKVGEMLLKKPVSRVNLETGHVEPVSE  372

Query  541  A-GTNKDALKRL  573
              GTN++AL RL
Sbjct  373  GEGTNEEALIRL  384



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 2/191 (1%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T +  G   E+NLIDG +AANNPT IAIS VT+++  ++P +      +    G  +F
Sbjct  199  FQTQNEDGKFHEFNLIDGAIAANNPTFIAISEVTKQICEQNPYFKNFDEMTPTNYG--KF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   KY A+ A+ WG+ GWL  G  NP+ID F+ AS DMVDYHI+ +FQ+
Sbjct  257  LVISIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVDYHISVVFQS  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            + +   YLRIQ+D L G+ +SVD++TKEN+D L E+G  LL KPV ++NL TG  E +  
Sbjct  317  ISSQKQYLRIQDDTLSGADSSVDISTKENMDKLVEIGTNLLKKPVSRVNLKTGLFEQLDT  376

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  377  GGTNEEALKRF  387



>ref|XP_010068174.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88861.1| hypothetical protein EUGRSUZ_A01188 [Eucalyptus grandis]
Length=412

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+AIS VTQ ++   P +        E     RF
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTQEIIKGRPDFFPIKPMDYE-----RF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++Y A +AA WG++GWL  G   PL++V   A+ADMVD H++ +FQA
Sbjct  252  LVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVFQATADMVDLHLSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +G +YLRIQ+D L G T+S+DV TK+N++ L +VG+ LL KPV ++NL TG  EP+  
Sbjct  312  LHSGKSYLRIQDDKLSGLTSSMDVATKKNMNDLVKVGEGLLKKPVSRVNLDTGIFEPL-N  370

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  371  QETNEEALKRF  381



>gb|EMT08201.1| Patatin-T5 [Aegilops tauschii]
Length=292

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 7/193 (4%)
 Frame = +1

Query  1    FDTADAKGG--KVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCH  174
            F T D  G     EY+LIDGGVAANNPT+ A+S +T+ ++ ++P +    T  K A    
Sbjct  87   FTTRDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPA-EYG  141

Query  175  RFLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIF  354
             +LI+SIGTG++K A+KYTA   A WGVL WL  G   PLID+FS ASADMVD H A +F
Sbjct  142  NYLIISIGTGSAKMAEKYTAPDCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAVLF  201

Query  355  QALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV  534
            QAL+   NYLRIQ+D L G T+SVD+ TKEN++AL  +GK LL K V ++N+ TG  E V
Sbjct  202  QALRIEKNYLRIQDDSLTGHTSSVDIATKENMEALIGIGKNLLKKNVSRVNIDTGMYESV  261

Query  535  PKAGTNKDALKRL  573
               GTN++AL R 
Sbjct  262  EGEGTNEEALTRF  274



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG   ++NL DGGVAANNPT++A+S VT++M+  DP +     S  +     RF
Sbjct  200  FTNQDDKGNVWDFNLTDGGVAANNPTILAMSQVTKQMIKNDPDF-----SQMKPTDYARF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   K++A+    W  LGW+  G   PL+++F+ AS DMVDY I+ IFQA
Sbjct  255  LVISIGTGSAKIEKKFSAEMVNKWNPLGWVLNGTVPPLVEMFAQASGDMVDYQISVIFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G +ASVDV TKEN++ L E+G  LL KPV ++NLLTG  E V  
Sbjct  315  LHSEANYLRIQDDTLTGQSASVDVATKENMEKLGEIGSNLLKKPVSRVNLLTGAVEQVEN  374

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  375  GGTNEEALKRF  385



>gb|KJB58442.1| hypothetical protein B456_009G210300 [Gossypium raimondii]
Length=434

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E+NLIDGGVAANNPTL+A++ VT+ ++  +P++     +        RF
Sbjct  214  FQTQDSTGKTKEFNLIDGGVAANNPTLVAMNEVTKEILRGNPEFFPIKPTDYA-----RF  268

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A  AA WGVLGWL      PL+D+F  AS+DMVD+HIAT+FQA
Sbjct  269  LVVSLGTGSPKSEGKYHANMAAKWGVLGWLTSEHSTPLVDIFMQASSDMVDFHIATVFQA  328

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ ++YLRIQ+D L    +SVD+ TKENL+ L +VG++LL K V ++NL  G+ EP  K
Sbjct  329  LQSENSYLRIQDDTLSQQISSVDIATKENLENLVKVGEELLNKSVSRVNLENGQFEPAGK  388

Query  541  AGTNKDALKRL  573
              TN +AL RL
Sbjct  389  V-TNGEALIRL  398



>ref|XP_006388386.1| hypothetical protein POPTR_0202s00230g, partial [Populus trichocarpa]
 gb|ERP47300.1| hypothetical protein POPTR_0202s00230g, partial [Populus trichocarpa]
Length=309

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 112/157 (71%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  135  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINQEGP-----DSFRMNPMEYGRF  189

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A++AA WG+LGWL      PL+DVF+ ASADMVD+HI+T+FQA
Sbjct  190  LVLSLGTGTAKSEEKYDAEEAAKWGLLGWLTSDHSTPLVDVFTQASADMVDFHISTVFQA  249

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVG  471
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG
Sbjct  250  LNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVG  286



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F  +DA+G + E+NLIDGG+AANNPTL+A+S VT++++ K+P +        + +   RF
Sbjct  202  FKNSDAQGNEREFNLIDGGIAANNPTLVAVSEVTKQVMKKNPDFF-----PIKPMDYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K    Y A+ A+ WGV GWL      PLI   + ASADMVD+H + +FQA
Sbjct  257  LVISLGTGSDKNEHTYNAKMASKWGVFGWLYYKGSTPLIKAVNQASADMVDFHNSVVFQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G+ +SV   TK+NLD L +VG++LL KPVL++NL +G +EPV  
Sbjct  317  LHSDDNYLRIQDDALTGTLSSVATATKQNLDNLVKVGEELLKKPVLRVNLTSGDHEPVEN  376

Query  541  AGTNKDALKRL  573
             GTN DAL R 
Sbjct  377  GGTNMDALTRF  387



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 136/192 (71%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+T + + GKV E+NLIDGGVAANNP L+AI  VT+ ++  +  +        + +   R
Sbjct  201  FETKEKQTGKVREFNLIDGGVAANNPALVAIGEVTKEILGGNSDFFPI-----KPMDYGR  255

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++SIGTG+ K A KY A +A+ WGVLGWL  G   PL+DVF+ AS+DMVDYH++ +FQ
Sbjct  256  FLVISIGTGSPKAARKYNAIKASKWGVLGWLNSGGSTPLVDVFTQASSDMVDYHLSAVFQ  315

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL +  +YLRIQ+D L G  +SVD+ TK NL  L ++G++LL KPV ++NL TG+ EP+ 
Sbjct  316  ALHSEQHYLRIQDDTLNGKESSVDIATKSNLKNLVKIGERLLKKPVSRVNLETGRFEPID  375

Query  538  KAGTNKDALKRL  573
            + GTN++AL+R 
Sbjct  376  Q-GTNEEALERF  386



>gb|KHN42072.1| Patatin group A-3 [Glycine soja]
Length=434

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 126/191 (66%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F   D +G  + E+NLIDG VAANNPTL AI  VT++++ K      +   S   +   R
Sbjct  201  FTKQDEQGKVIKEFNLIDGSVAANNPTLCAIREVTKQLIRKG-----NGGISINPLEYSR  255

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL+LSIGTG++K   KY A+  + WG+L WL      P++D FS AS DMVDYH   +F 
Sbjct  256  FLVLSIGTGSNKSEHKYNAKMVSKWGILTWLFNSGSTPILDCFSEASFDMVDYHNCVVFS  315

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            ALQ+ DNYLRIQ++ LKG  ASVDV TKENLD L +VG++LL   V ++NL TG  EPVP
Sbjct  316  ALQSEDNYLRIQDNTLKGDLASVDVATKENLDNLVKVGQQLLKNTVTRVNLDTGLYEPVP  375

Query  538  KAGTNKDALKR  570
              GTN +ALKR
Sbjct  376  DKGTNVEALKR  386



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D    + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RF
Sbjct  156  FTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFFPI-----KPLEYGRF  210

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG +K  +K++A  AA WG+LGWL     NPLIDVF+ +S DMVD+H++ + QA
Sbjct  211  LIISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQA  270

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVD+ T+ENL+ L E+G KLL KPV ++NL  G  EPV  
Sbjct  271  LHSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVID  330

Query  541  AGTNKDALKRL  573
              TN+ ALKRL
Sbjct  331  GETNEQALKRL  341



>ref|XP_007017303.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14528.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=437

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 134/193 (69%), Gaps = 10/193 (5%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F + D+ G  +E+NLIDGGVAANNP L+AI+ V++ ++  +P++     +        RF
Sbjct  214  FQSQDSTGKPIEFNLIDGGVAANNPALVAINEVSKEILRGNPEFFPIKPTDYA-----RF  268

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  +KY A  AA WG+LGWL      PL+D+F  AS+DMVD+HIAT+FQA
Sbjct  269  LVVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQASSDMVDFHIATLFQA  328

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ D+YLRIQ+D L    +SVDV TKENL+ L + G++LL KPV ++NL  GK+EP   
Sbjct  329  LQSEDSYLRIQDDTLSQQMSSVDVATKENLENLVKAGEELLKKPVSRVNLEDGKSEP---  385

Query  541  AG--TNKDALKRL  573
            AG  TN+ AL RL
Sbjct  386  AGTVTNEKALIRL  398



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+A+S VT+ +  + P +        + +   RF
Sbjct  197  FKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFF-----PIKPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  + YTA +AA WG++GWL  G   PL++VF+ ASADMVD H++ +FQA
Sbjct  252  LVISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLHLSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + ++YLRIQ+D L G  +SVD+ TK+N++ L +VG++LL KPV  +NL TG  EP+ +
Sbjct  312  LHSRNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSSVNLDTGTLEPLNR  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  -DTNEEALKRF  381



>ref|NP_001140826.1| uncharacterized protein LOC100272901 [Zea mays]
 gb|ACF84735.1| unknown [Zea mays]
 tpg|DAA48469.1| TPA: hypothetical protein ZEAMMB73_502492 [Zea mays]
Length=435

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G    +NLIDGGVAANNPTL+A++ V+++++  +P +     +        RF
Sbjct  229  FQTTDKDGKARAFNLIDGGVAANNPTLLAMTDVSKQILLGNPDFFPIKPAD-----YGRF  283

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            ++LS+GTG++K  +K+ A Q+  WG+LGWL+  D  P+ID FS ASAD+VD H + +FQA
Sbjct  284  MVLSLGTGSAKAEEKFDAVQSGKWGLLGWLSSKDTTPIIDSFSQASADLVDIHASVLFQA  343

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +   YLRIQ+D+L G T+SVDV+T+ENL+ L +VG+ LL KP  K+N+ TGKNEP  K
Sbjct  344  LHSERQYLRIQDDELTGQTSSVDVSTEENLNRLVDVGRGLLKKPACKVNIETGKNEPDGK  403

Query  541  AGTNKDALKRL  573
             GTN+D L R 
Sbjct  404  RGTNEDELVRF  414



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+A+S VT+ +  + P +        + +   RF
Sbjct  197  FKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFF-----PIKPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  + YTA +AA WG++GWL  G   PL++VF+ ASADMVD H++ +FQA
Sbjct  252  LVISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLHLSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + ++YLRIQ+D L G  +SVD+ TK+N++ L +VG++LL KPV  +NL TG  EP+ +
Sbjct  312  LHSRNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSSVNLDTGTLEPLNR  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  -DTNEEALKRF  381



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T  +KG   E++L+DGGVAANNP L+++  VT+ +  K+P Y        + +   + 
Sbjct  200  FQTKCSKGSSREFHLVDGGVAANNPALVSVGEVTKELHKKNPDYFPY-----KPMDYRKI  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   K++A++A+ WGVLGWL     NPL DVF  +SADMVD H++ +FQA
Sbjct  255  LLISLGTGSAKVEGKFSAKRASKWGVLGWLLSSGSNPLFDVFMQSSADMVDIHLSVVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+  NYLRI++D L G+ +SVD++TKENL  L  VG++LL KPV ++NL TG  EPV  
Sbjct  315  LQSKSNYLRIEDDTLSGTVSSVDISTKENLADLVNVGEQLLKKPVSRVNLETGIYEPVGN  374

Query  541  A-GTNKDALKRL  573
              GTN+DALKR 
Sbjct  375  GEGTNEDALKRF  386



>gb|KJB58444.1| hypothetical protein B456_009G210400 [Gossypium raimondii]
Length=417

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E++LIDGGVAANNPTLIAI+ V++ +    P +     +        RF
Sbjct  209  FETKDSTGKVQEFHLIDGGVAANNPTLIAINEVSKAITRGSPDFFPIKPNDYA-----RF  263

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
             +LS+GTG+ K  +KYTA  AA WG+LGWL      PLIDVF  AS+DMVD+H AT+F+A
Sbjct  264  QVLSLGTGSQKCEEKYTAHMAAKWGLLGWLTCEHSTPLIDVFMQASSDMVDFHNATVFKA  323

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  +YLRIQ+D L G+ ASVD+ TKENL+ L +VG+ LL KPV K+NL  GK EP   
Sbjct  324  LKSEKSYLRIQDDTLSGTVASVDIATKENLENLVKVGESLLKKPVSKVNLENGKFEPS-N  382

Query  541  AGTNKDALKRL  573
             GTN++AL RL
Sbjct  383  QGTNEEALVRL  393



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   E+NLIDGGVAANNPTL A++ VT+ +  ++  +        + V   RF
Sbjct  200  FETKDDEGSTREFNLIDGGVAANNPTLTAMNQVTKEIFMENADFF-----PIKPVDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++++A+++  WG+LGWL      P+ID+FS ASADMVD H + +FQA
Sbjct  255  LVISLGTGSNKQEERFSAEESGKWGLLGWLYNKGTTPIIDIFSQASADMVDIHASVLFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQED L G TASVDV+T+ENL+ L EVG  LL KPV ++NL  G  EP   
Sbjct  315  LHSEQHYLRIQEDALVGDTASVDVSTRENLEKLMEVGGNLLKKPVSRVNLENGTFEPCDG  374

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  375  EGTNEEALTRF  385



>ref|XP_002449853.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
 gb|EES08841.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
Length=413

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 133/187 (71%), Gaps = 6/187 (3%)
 Frame = +1

Query  13   DAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            DA+  + EY+L+DGGVAANNPT+IA+S +T+ ++ ++P +     +  +      +L++S
Sbjct  215  DARPPR-EYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDF-----NPGKPTEYRNYLVIS  268

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            +GTG++K A+KYTA Q A WG++ WL +G   P+ID+FS ASADMVD H A +F+AL   
Sbjct  269  VGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFEALHCE  328

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
             NYLRIQ+D L G  +SVD+ TKEN++AL  +GKKLL KPV ++N+ TG  EPV   GTN
Sbjct  329  KNYLRIQDDSLTGHASSVDIATKENMEALIGIGKKLLKKPVARVNIDTGMYEPVAGEGTN  388

Query  553  KDALKRL  573
            +DAL R 
Sbjct  389  EDALARF  395



>ref|XP_011070718.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=428

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D KG   EYNLIDGGVAANNP LIAIS V ++M   + + L        AV   R 
Sbjct  199  FATKDEKGNVREYNLIDGGVAANNPALIAISEVMKQMFDSNMELL-----GMRAVELPRL  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG ++  +KY  + AA WG+L WL  G   PL+++F+ ASADMVD+H + +FQA
Sbjct  254  LIVSVGTGAARVDEKYNTKLAARWGILDWLLYGGTAPLLEIFTQASADMVDFHTSLLFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVDV T+ENLD L  +G++LL  PV +++  TG ++P+  
Sbjct  314  LFSEDNYLRIQDDTLCGIESSVDVATRENLDRLVTIGERLLKGPVSRVDFSTGLSQPLQN  373

Query  541  AGTNKDALKRL  573
             GTN+DA+ R 
Sbjct  374  GGTNEDAIIRF  384



>gb|KCW88897.1| hypothetical protein EUGRSUZ_A01223, partial [Eucalyptus grandis]
Length=404

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+AIS VT+ ++   P +        + +   RF
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEIIKGSPDFFPI-----KPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++Y A +AA WG++GWL  G   PL++V + A+ADMVD H++ +FQA
Sbjct  252  LVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +G +YLRIQ+D L G T+SVDV TK+N++ L +VG+ LL K V ++NL TG  EP+ +
Sbjct  312  LHSGKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLNQ  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  E-TNEEALKRF  381



>ref|XP_002284571.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=425

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNP L+AI  VTQ ++   P +        + +   RF
Sbjct  212  FETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIRGSPDFF-----PIKPMDYGRF  266

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A QAA WG+LGWL  G   PL+DVF+ AS DMVD H++ +FQA
Sbjct  267  LVISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQA  326

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  327  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEPS-N  385

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  386  HETNEEAL  393



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 127/192 (66%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F   DA+G  + E+NLIDGG+AANNPTL+AI  VT++ + K P   T S      +   R
Sbjct  199  FTKQDAEGKVIKEFNLIDGGLAANNPTLVAIREVTKQTIRK-PDETTIS-----PLDYDR  252

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL+LS+GTG++    KY A+  + WG+L WL      P+ID FS AS DMVDYH   +F 
Sbjct  253  FLVLSLGTGSNMSEHKYNAKMVSNWGILTWLFNSGSTPIIDCFSEASTDMVDYHNVVVFS  312

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +LQ+ DNYLRIQE+ LKG  ASVD+ T ENL+ L +VG+ LL K V ++NL TG  EP P
Sbjct  313  SLQSEDNYLRIQENTLKGDLASVDIATTENLNNLVKVGENLLKKTVTRVNLDTGLYEPAP  372

Query  538  KAGTNKDALKRL  573
              GTN++ALKR 
Sbjct  373  DKGTNEEALKRF  384



>ref|XP_007017302.1| Phospholipase A 2A, IIA,PLA2A, putative [Theobroma cacao]
 gb|EOY14527.1| Phospholipase A 2A, IIA,PLA2A, putative [Theobroma cacao]
Length=381

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 130/188 (69%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+KG   E+NLIDGGVAAN+P L+A+S +T+ +V + P++     +        RF
Sbjct  177  FKTQDSKGVVKEFNLIDGGVAANDPALVAVSEMTKEIVRRSPEFFPIKPTDYS-----RF  231

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +++S+GTG++K  +K+ A +AA WGVLGWL   +  PL+D+F+ AS+DM +YH+A +FQA
Sbjct  232  VVISLGTGSAKSVEKFDADEAAKWGVLGWLTSENSTPLVDIFTQASSDMTEYHLAAVFQA  291

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ + YLRIQ+D L G  ASVD+ TK+NL+ L  VG   L KP L++NL TGK EP   
Sbjct  292  LQSENCYLRIQDDTLTGPLASVDIATKQNLENLVNVGVDFLKKPALRVNLETGKMEPS-D  350

Query  541  AGTNKDAL  564
             GTN+ AL
Sbjct  351  LGTNEKAL  358



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 130/192 (68%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+T D K GKV E+NLIDGGVAANNPTL+A+  VT+ +      +L     + + +   R
Sbjct  199  FETKDEKTGKVREFNLIDGGVAANNPTLVAVGEVTKEITKGSQDFL-----AIKPMDYRR  253

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG  K  +KY A  AA WGV+GWL      PL+DVF+ ASADMVD+HI+ +FQ
Sbjct  254  FLVISLGTGAPKAEEKYHAHDAAKWGVIGWLTSNGSTPLVDVFTHASADMVDFHISVVFQ  313

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL+   NYLRIQ+D L  + +SVDV TKENLD L +VG+ LL KPV ++N  TG  E + 
Sbjct  314  ALRCESNYLRIQDDTLSKTVSSVDVATKENLDNLVKVGEGLLKKPVSRVNSETGIYESLT  373

Query  538  KAGTNKDALKRL  573
            K  TN++AL R 
Sbjct  374  KE-TNEEALIRF  384



>ref|XP_010068219.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNPTL+AIS VT+ ++   P +        + +   RF
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEIIKGSPDFFPI-----KPMDYGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++Y A +AA WG++GWL  G   PL++V + A+ADMVD H++ +FQA
Sbjct  252  LVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +G +YLRIQ+D L G T+SVDV TK+N++ L +VG+ LL K V ++NL TG  EP+ +
Sbjct  312  LHSGKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLNQ  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  E-TNEEALKRF  381



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   ++ G   E+NLIDGGVAANNP L+A+S VT+ +   +  +     +        RF
Sbjct  196  FKIKNSDGKVREFNLIDGGVAANNPALVAMSEVTKEIFRGNTDFFPIKPTD-----YGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +K  +K+ A++++ WGVLGWL  G  NPL+D F+ AS+DMVD HI+ +FQA
Sbjct  251  LVISLGTGTAKNEEKFDAKESSKWGVLGWLLSGGSNPLVDAFTQASSDMVDIHISVVFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +   YLRIQ+D LKG+ +SVDV TKENLD+L ++G++LL KP  ++NL TG  EPV K
Sbjct  311  LHSDSKYLRIQDDTLKGTVSSVDVATKENLDSLVKIGEELLKKPTSRINLETGVYEPVDK  370

Query  541  AGTNKDALKRL  573
              TN+ ALKR 
Sbjct  371  E-TNEQALKRF  380



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T DA+    E+NLIDGGVAANNPTLIAI  VT++ + K            + +   RF
Sbjct  203  FKTQDAQNKDREFNLIDGGVAANNPTLIAIGEVTKQTLMKH-----GDLFPIKPMDYGRF  257

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K  +KY A+ AA WG+L WL   +  P+I+ F+ ASADMVDYH   +F+A
Sbjct  258  LVISLGTGNAKNEEKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNFVVFKA  317

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G+ ASVD++TKENL+ L +VG++LL KP  K+NL  G  E V  
Sbjct  318  LHSDDKYLRIQDDTLTGNLASVDISTKENLEGLIKVGEELLDKPTSKINLDKGVYEAVEN  377

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  378  GGTNKEALRRF  388



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGG+AANNPTLIAIS VT++++ +DP +       K  +   R 
Sbjct  199  FKTEDKDGRVHEFNLIDGGLAANNPTLIAISEVTRQILKEDPDFF----DIKSPIDYTRL  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+     K+ A++A+ WG+  WL +   +PLID ++  SAD+VDYH +  F+ 
Sbjct  255  LVISLGTGSDTSELKFDAKKASKWGLFSWLYEDGSSPLIDAYTQGSADLVDYHNSVAFKT  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
             Q+ DNYLRI +D LKG+ +SVD +TK+NL+ L +VG+ LL K V ++NL TG  EP+P 
Sbjct  315  YQSEDNYLRINDDTLKGTLSSVDTSTKKNLEDLVKVGEDLLRKAVSRVNLDTGHYEPIPN  374

Query  541  AGTNKDALKRL  573
            AGTN++ALKR 
Sbjct  375  AGTNEEALKRF  385



>emb|CBI19544.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNP L+AI  VTQ ++   P +        + +   RF
Sbjct  247  FETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIRGSPDFF-----PIKPMDYGRF  301

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A QAA WG+LGWL  G   PL+DVF+ AS DMVD H++ +FQA
Sbjct  302  LVISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQA  361

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  362  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEPS-N  420

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  421  HETNEEAL  428



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T  + G    ++L+DGGVAANNPTL+A+  VT+ +  K+P +        + +   RF
Sbjct  200  FETMGSDGMVKNFHLVDGGVAANNPTLVAVGEVTREIFRKNPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  D Y+A+ AA WGVLGWL    G PLID F+ AS+DMVD+H++ +F+A
Sbjct  255  LVISLGTGSPKSTDNYSAKDAAKWGVLGWLYHNGGTPLIDTFTHASSDMVDFHLSVVFRA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ D L G  +SVD+ TKENL+ L  +G  LL KPV +LN+ TG  EPV  
Sbjct  315  LHSERNYLRIQGDTLTGHASSVDIATKENLENLVMIGSDLLKKPVSRLNMETGLFEPVEG  374

Query  541  AGTNKDALKRL  573
             GTN+ AL R 
Sbjct  375  EGTNEQALTRF  385



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGV ANNPTL+A++ VT++++ ++  +      S + +   RF
Sbjct  202  FKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNNDF-----DSIKPMEYSRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ ++ AA WG+L WL  G   PLID+FS +S DMVDY++AT+ QA
Sbjct  257  LIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGDMVDYNLATVTQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVD+ TKENLD L ++G++LL KP+  +NL TG  EP   
Sbjct  317  LNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNVNLETGVFEPTQN  376

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  377  RETNQDALKRF  387



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGV ANNPTL+A++ VT++++ ++  +      S + +   RF
Sbjct  195  FKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNNDF-----DSIKPMEYSRF  249

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ ++ AA WG+L WL  G   PLID+FS +S DMVDY++AT+ QA
Sbjct  250  LIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGDMVDYNLATVTQA  309

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVD+ TKENLD L ++G++LL KP+  +NL TG  EP   
Sbjct  310  LNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNVNLETGVFEPTQN  369

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  370  RETNQDALKRF  380



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D    + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RF
Sbjct  202  FTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF-----PIKPLEYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG +K  +K++A  AA WG+LGWL     NPLIDVF+ +S DMVD+H++ + QA
Sbjct  257  LIISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVD+ T+ENL+ L E+G KLL KPV ++NL  G  EPV  
Sbjct  317  LHSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVID  376

Query  541  AGTNKDALKRL  573
              TN+ ALKRL
Sbjct  377  GETNEQALKRL  387



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 137/191 (72%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E++LIDG VAAN+P L+A+S +T+ +V + PKY     +        +F
Sbjct  192  FKTEDSNGVAKEFHLIDGAVAANDPALVAVSEMTKEIVRRAPKYFPIKPTDYS-----KF  246

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +++S+GTG++K   K+ ++ +A WG+LGWL+  + +PL+DVF+ AS+DM +YH+A +FQA
Sbjct  247  VVISLGTGSAKSEGKFDSENSAKWGILGWLSSENSSPLVDVFTQASSDMAEYHLAAVFQA  306

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
             Q+ ++YLRIQ+D L+G  ASVD++TKENL+ L +VG+ LL KPV ++NL TGK EP   
Sbjct  307  FQSENSYLRIQDDTLEGPLASVDISTKENLENLVKVGEDLLKKPVSRVNLETGKFEPC-N  365

Query  541  AGTNKDALKRL  573
             GTN++AL R+
Sbjct  366  QGTNEEALIRM  376



>ref|XP_006660709.1| PREDICTED: patatin-2-Kuras 2-like isoform X1 [Oryza brachyantha]
Length=344

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 131/194 (68%), Gaps = 9/194 (5%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  V++++  ++P +        + +   RF
Sbjct  140  FRTEDCHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKQNPDFFPI-----KPMDYGRF  194

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY+A++A +WGVL WL  G   PL+D+F+ ASADMVD HIA +F+ 
Sbjct  195  LVISLGTGSPKIEAKYSAEKAKSWGVLDWLLVGGSTPLVDIFTQASADMVDIHIAAVFKV  254

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV--  534
            L +  NYLRIQ+D L+G+ ASVDV T++NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  255  LHSEQNYLRIQDDTLQGTVASVDVATRDNLEKLANVGEILLNKPVSRANLETGQMVPACD  314

Query  535  -PKAGTNKDALKRL  573
             P+  TN++ALKR 
Sbjct  315  DPEM-TNREALKRF  327



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 130/185 (70%), Gaps = 5/185 (3%)
 Frame = +1

Query  19   KGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIG  198
            K  + E+NLIDGG+AANNPTL+AI  VT++++ ++P +     S  + +   RFL++S+G
Sbjct  200  KNNEEEFNLIDGGIAANNPTLVAIREVTKQIMKENPNF-----SDMDPLDYTRFLVISLG  254

Query  199  TGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDN  378
             G+++   KY A++A+ WGV+ WL + +  P+ID +S AS DMVDYH + +F+AL + D 
Sbjct  255  GGSNRLEKKYNAKEASKWGVICWLFENNHTPIIDCYSEASKDMVDYHNSVVFEALHSEDK  314

Query  379  YLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKD  558
            YLRI +D L+G  ASVDV TKEN+D L +VG+ LL K V ++NL TG  EP+   GTN++
Sbjct  315  YLRIDDDTLRGELASVDVATKENMDNLVKVGEDLLKKTVTRINLDTGLYEPIENGGTNEE  374

Query  559  ALKRL  573
            AL+R 
Sbjct  375  ALRRF  379



>gb|AEF30538.1| patatin-like phospholipase 1 [Capsicum annuum]
Length=413

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G    +NL+DGGVAANNPTL+AI+ V+++++  + +Y        E V C + 
Sbjct  214  FETKDAQGKTRTFNLVDGGVAANNPTLMAITHVSKQIMRGNFQY-----EDMENVDCKKM  268

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K+ +KY A  A+ WG+LGW+      PLID+F  ASADMVD H++T+FQ 
Sbjct  269  LVLSLGTGIGKHEEKYNATVASRWGMLGWVFNNGATPLIDIFGDASADMVDIHVSTMFQT  328

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
              +  NY+RIQ+D+L G  AS+D+ T+EN++ L ++G  LL KP+ ++NL TG+ EPV  
Sbjct  329  FGSEKNYVRIQDDNLVGEAASMDIATRENMETLVQIGNGLLKKPISRVNLETGRYEPVVG  388

Query  541  AGTNKDALKRL  573
             GTN+ A+ R 
Sbjct  389  EGTNEAAMVRF  399



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 129/192 (67%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDG +AANNPTLIA S VT+++ A++P +     S        RF
Sbjct  205  FQTQDRDGNFHEFNLIDGAIAANNPTLIATSEVTKQIYAENPDFFPIKPSDHG-----RF  259

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   K+ A+ AA WG+LGWL  G  NP+IDVF+    DMVDY+I+  FQA
Sbjct  260  LVISIGTGSAKLEHKFNAKMAAKWGILGWLTNGGSNPIIDVFTQGGDDMVDYYISVAFQA  319

Query  361  LQAG-DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            L++  D+YLRIQ+D L G+ +SVD+ TKEN+  L E+G+ LL KPV ++NL  G  EP  
Sbjct  320  LRSDEDHYLRIQDDTLSGTDSSVDIATKENMAKLVEIGETLLKKPVSRINLKKGIFEPHE  379

Query  538  KAGTNKDALKRL  573
              GTN++ LKR 
Sbjct  380  IGGTNEETLKRF  391



>gb|AAX99411.1| patatin-like protein [Gossypium hirsutum]
Length=434

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+ G   E+NLIDGGVAANNPTL+A++ VT+ ++  +P++     +        RF
Sbjct  214  FQTQDSTGKTKEFNLIDGGVAANNPTLVAMNEVTKEILRGNPEFFPIKPTDYA-----RF  268

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A   A WGVLGWL      PL+D+F  AS+DMVD+HIAT+FQA
Sbjct  269  LVVSLGTGSPKSEGKYHANMTAKWGVLGWLTSEHSTPLVDIFMQASSDMVDFHIATVFQA  328

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ ++YLRIQ+D L    +SVD+ TKENL+ L +VG++LL KPV ++NL  G+ EP  K
Sbjct  329  LQSENSYLRIQDDTLSQQISSVDIATKENLENLVKVGEELLKKPVSRVNLENGQFEPAGK  388

Query  541  AGTNKDALKRL  573
              TN +AL RL
Sbjct  389  I-TNGEALIRL  398



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D +G   E+NLIDGG+AANNP+L+AIS VT+++V  +P +     + +E     R 
Sbjct  202  FENKDDQGNVKEFNLIDGGIAANNPSLVAISEVTKQIVKSNPNFFPIKATDRE-----RL  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K    Y A+ AA WG++ WL      PL+D F+ + ADMVD+H +  FQA
Sbjct  257  LVISLGTGSDKVEQLYNAKSAAKWGIISWLFDNGNTPLLDAFNQSKADMVDFHNSVAFQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
              + DNYLRIQ+D LKG +ASVDV T ENL  L  +GK LL KPV ++N  TG+ +P+P 
Sbjct  317  YGSLDNYLRIQDDTLKGVSASVDVATTENLANLVTIGKALLKKPVSRINFDTGRYQPIPN  376

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  377  GGTNEEALIRF  387



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D KG  +E+NLIDGGVAANNP LIAIS V++ ++ ++P +        + +   RF
Sbjct  198  FKVEDDKGNIIEHNLIDGGVAANNPCLIAISEVSKEILKENPDFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG  K   +Y +  AA WG++ WL      PL +VF+ +SADM+DYH + +FQA
Sbjct  253  LVISIGTGAPKLEQEYNSSMAAKWGIVDWLFHKGCTPLFEVFTQSSADMIDYHNSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D+YLRIQED L G+ A      KENL+ L E+G+KLL KP+ ++NL TG  EP+PK
Sbjct  313  LHSEDSYLRIQEDGLSGTEAQXGCGYKENLERLVEIGEKLLXKPLSRVNLETGL-EPIPK  371

Query  541  AGTNKDALKRL  573
             GTN++ALKR 
Sbjct  372  GGTNEEALKRF  382



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D++G   E+NLIDGGVAANNPTL+AI+ VT+ +     +        KE     RF
Sbjct  199  FENKDSEGRIREFNLIDGGVAANNPTLVAINQVTKEITRGSSEIF--PLKPKED---GRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG++K  +KY A+ AA WGVLGWL  G   PL DVF+ AS+DMVD+H  T FQA
Sbjct  254  LVLSLGTGSAKAEEKYDAEGAAKWGVLGWLLNGGSTPLFDVFNRASSDMVDFHTTTFFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L + G+KLL KPV ++N  TG  EP   
Sbjct  314  LHSQNNYLRIQDDTLTGAMSSVDVATKENLEDLVKAGEKLLKKPVSRVNWETGIYEP-SN  372

Query  541  AGTNKDALKRL  573
             GTN++AL RL
Sbjct  373  QGTNEEALIRL  383



>ref|XP_007017307.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14532.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=410

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 7/191 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D KG   EYNLIDGGVAANNPTL+A+  V++ ++  +  +        + +   RF
Sbjct  198  FKTEDQKGNVREYNLIDGGVAANNPTLVAMGEVSKEIIKGNADFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  +K++AQ+AA WG+LGWL  G   PL+DVF+ AS DMVD H++ +F+A
Sbjct  253  LVISLGTGSRKAEEKFSAQEAAKWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSVVFEA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G  +SVDV TKENL+ L +VG+ LL K V ++NL TG  EP  +
Sbjct  313  LHS-DKYLRIQDDTLSGVVSSVDVATKENLNELVKVGQALLKKQVSRVNLETGIFEPFSE  371

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  372  E-TNEEALKRF  381



>ref|XP_007017304.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
 gb|EOY14529.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
Length=438

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F + D+ G  +E+NLIDGGVAANNP L+AI+ V++ ++  +P++     +        RF
Sbjct  214  FQSQDSTGKPIEFNLIDGGVAANNPALVAINEVSKEILRGNPEFFPIKPTDYA-----RF  268

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K  +KY A  AA WG+LGWL      PL+D+F  AS+DMVD+HIAT+FQA
Sbjct  269  LVVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQASSDMVDFHIATLFQA  328

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ D+YLRIQ+D L    +SVDV TKENL+ L + G++LL KPV ++NL  GK+EP   
Sbjct  329  LQSEDSYLRIQDDTLSQQMSSVDVATKENLENLVKAGEELLKKPVSRVNLEDGKSEPAGT  388

Query  541  AGTNKDALKRL  573
                K  + RL
Sbjct  389  VTNEKALISRL  399



>ref|XP_007224534.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
 gb|EMJ25733.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
Length=399

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G    +NL+DGGVAANNPTLIAI  VT+ +  K+P +     S K A    R 
Sbjct  197  FETKDSAGKVENFNLVDGGVAANNPTLIAIGEVTKEIHRKNPDF----NSIKAADHYGRL  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG+ K  +KYTA +A+ WGV GWL      PL+D F+ ASAD+VD+H++ +F++
Sbjct  253  LVLSLGTGSPKVEEKYTANEASRWGVFGWLVSDHSTPLVDAFTQASADLVDFHMSVVFKS  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRIQ+D LKG+ +SVD +TKENL+ L ++G++LL KPV  +NL TG   P  K
Sbjct  313  LESEKNYLRIQDDTLKGTVSSVDNSTKENLENLAKIGEELLKKPVSNVNLETGSFGP-SK  371

Query  541  AGTNKDALKRL  573
              TN+ AL R 
Sbjct  372  CETNEQALTRF  382



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F  +D++G   E+NLIDGGV ANNP+L+AI+ VT++++  +P +      S + +   RF
Sbjct  200  FKNSDSEGTMHEFNLIDGGVCANNPSLVAINQVTKQIINDNPDFF-----SIKPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG  K   K+ A+ AA WG+  WL      PLIDV + +SADMVD+H+AT+ QA
Sbjct  255  LVISLGTGTPKNEHKFNAKMAAKWGLFDWLTNSGSTPLIDVLTHSSADMVDFHLATVTQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  AS+D+ TKEN++ L ++G +LL KPV ++NL TG  EP+  
Sbjct  315  LHSKNNYLRIQDDTLTGVDASLDIATKENMEKLSQIGDRLLKKPVSQINLETGLFEPMGD  374

Query  541  AGTNKDALKRL  573
              TN+DAL+R 
Sbjct  375  GETNEDALRRF  385



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G K E+NLIDGGV ANNPTL+A++ V+++++  +P        +   +G   F
Sbjct  192  FVNEDINGKKTEFNLIDGGVTANNPTLVAMTAVSKQIIMNNP-----DMGNMNPLGYDHF  246

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K  +KY A +++ WG+L WL +   +P+ID +S +S+DMV YHI+  FQA
Sbjct  247  LVVSIGTGSAKKEEKYNATKSSKWGILSWLYEDGSSPIIDCYSESSSDMVHYHISVAFQA  306

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRI +D L+G T+S+D++TK NL+ L ++G+K+L   V K+N+ TGK EPVP 
Sbjct  307  LDSQENYLRIDDDTLEGDTSSLDISTKANLENLVKIGEKMLKNRVEKMNIETGKYEPVPD  366

Query  541  AGTNKDALKRL  573
              TN+  LKR 
Sbjct  367  DITNEQELKRF  377



>ref|XP_007017310.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14535.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=404

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D++G   ++NLIDGG+AANNP L+AIS VT+++      +    +S K A    RF
Sbjct  197  FETKDSEGEVKKFNLIDGGMAANNPALVAISEVTKQINRGHCDF----SSIKGANHYSRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LSIGTG+ K A+KY A QAA WG++GWL  G   PL++ F+  SADMVD+HI+ IF+A
Sbjct  253  LVLSIGTGSEKLAEKYNASQAARWGLIGWLTSGHSTPLVNAFTEGSADMVDFHISVIFKA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ D L G  +S+DV+T++NL  L +V + LL KPV ++N  TG  EP  +
Sbjct  313  LGSEKNYLRIQNDKLVGEVSSIDVSTEDNLKNLVQVAENLLNKPVSRVNFETGNYEPSGE  372

Query  541  AGTNKDALKR  570
              TN  ALKR
Sbjct  373  LETNAQALKR  382



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   DA+G   E+NLIDGG+AANNPTL+AIS V+++M  K+P +     ++ E     R+
Sbjct  199  FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVSKQMSKKNPDFFPIKPTNYE-----RY  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG ++    Y+A+ A+ WGV+GWL      PLI  ++ AS+DMVDYH + +FQA
Sbjct  254  LVISIGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
              + + YLRI ED L+G   SVD+ TKENL+ L +VG+ LL  PV ++NL TG  EPV  
Sbjct  314  FHSENYYLRIDEDKLQGDLYSVDIATKENLENLVKVGEDLLKSPVSRINLDTGGYEPVED  373

Query  541  AGTNKDALKRL  573
             GTN++AL+R 
Sbjct  374  GGTNEEALQRF  384



>ref|XP_010664584.1| PREDICTED: patatin-like protein 2 isoform X2 [Vitis vinifera]
 emb|CBI19548.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ ++   P +        + +   RF
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WGVLGWL  G   PL+ VF+ AS DM+D H++ +FQA
Sbjct  255  LVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSELFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L+G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  315  LHSEKSYLRIQDDTLRGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  373

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  374  HETNEEAL  381



>gb|KGN62540.1| hypothetical protein Csa_2G360570 [Cucumis sativus]
Length=321

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            E+NLIDGGVAANNPTL+AI  VT+ ++ ++P +      + + +   RFL++S+GTG  K
Sbjct  112  EFNLIDGGVAANNPTLVAIGEVTKEVIKQNPDFF-----AIKPMDYRRFLVISLGTGAPK  166

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
               +YTA+ AA WG+L WL  G   P+IDVFS AS+DMVD+H++ IFQAL   DNYLRIQ
Sbjct  167  AEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDFHLSVIFQALHCEDNYLRIQ  226

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP-KAGTNKDALKR  570
            +D L G  +SVDV T++NL+ L +VG+ LL KPV ++NL TG  E  P  + TN  AL R
Sbjct  227  DDTLSGDLSSVDVATQKNLNDLVKVGESLLKKPVSRVNLQTGVFEDCPSNSETNDQALTR  286

Query  571  L  573
             
Sbjct  287  F  287



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D    + E+NLIDGGV ANNP L+A++ VT++++ + P +        + +   RF
Sbjct  202  FTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF-----PIKPLEYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG +K  +K++A  AA WG+LGWL     NPLIDVF+ +S DMVD+H++ + QA
Sbjct  257  LIISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + DNYLRIQ+D L G  +SVD+ T+ENL+ L E+G KLL KPV ++NL  G  EPV  
Sbjct  317  LHSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVID  376

Query  541  AGTNKDALKR  570
              TN+ ALKR
Sbjct  377  GETNEQALKR  386



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 132/192 (69%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+T  + G KV ++NLIDGGVAANNPT++AIS VT+ ++  +P +        + +   R
Sbjct  197  FETKGSHGTKVRKFNLIDGGVAANNPTIVAISEVTKEILKGNPDFFPI-----KPMDYGR  251

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG+ K  +KY+A+ AA WG+LGWL      PL+DVF+ AS DMVD+ I+ +FQ
Sbjct  252  FLVISLGTGSPKKDEKYSAKMAAKWGILGWLLSRGSTPLVDVFTQASGDMVDFQISVVFQ  311

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL +  NYLRIQ+D L  + ASVD+ TKENL+ L +VG+ LL KPV ++NL TG    + 
Sbjct  312  ALHSEINYLRIQDDTLNETLASVDIATKENLENLVKVGEALLKKPVSRVNLETGSCVHIE  371

Query  538  KAGTNKDALKRL  573
              GTN+ ALKR 
Sbjct  372  SEGTNEQALKRF  383



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGV ANNPTL+A++ VT +++ ++  +      + + +   RF
Sbjct  200  FKNQDTEGNTHEFNLIDGGVCANNPTLVAMNEVTNQIINQNNDFY-----AIKPMEYSRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ A+ AA WG+L WL  G   PLID+FS +SADMVD+H+A + +A
Sbjct  255  LIISLGTGTPKNEQKFNAKMAAKWGLLDWLTHGGSTPLIDMFSQSSADMVDFHLAAVTRA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G+ +SVD++T ENL+ L ++G KLL KPV K+NL  G  EP+ K
Sbjct  315  LNSQHNYLRIQDDTLTGTDSSVDISTTENLEKLCQIGDKLLKKPVSKVNLENGMFEPMEK  374

Query  541  AGTNKDALKRL  573
              TN+DALKR 
Sbjct  375  GETNEDALKRF  385



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G    YNLIDGGVAANNPTL+A+S + + M   +  +      S + +  H F
Sbjct  210  FETQDSNGNTRSYNLIDGGVAANNPTLVAMSQIKKEMFLMNQDF-----HSYKPIDYHNF  264

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +I+SIGTG +K   K++A  A+ WG+L WL  G   PLID FS ASAD+VD H++++FQ+
Sbjct  265  IIISIGTGAAKVEKKFSAHLASKWGILQWLYHGGSTPLIDSFSHASADIVDVHMSSVFQS  324

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ++ L G  +SVDV+TKENL  L ++G+ LL KPV ++NL TG  E V  
Sbjct  325  LHCEQNYLRIQDETLMGQASSVDVSTKENLLELVKIGESLLKKPVSRVNLETGDFEEVKG  384

Query  541  AGTNKDALKRL  573
             GTN +AL RL
Sbjct  385  EGTNAEALTRL  395



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E+NLIDGGV ANNP L+A++ VT +++ ++  +      + + +   RF
Sbjct  200  FKNQDTEGNVREFNLIDGGVCANNPALVAVNEVTTQIINENNDFY-----AIKPMEYSRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K   K+ ++ AA WG+L WL  G   PLID+FS +S DMVD+H+AT+ QA
Sbjct  255  LIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDIFSQSSGDMVDFHLATVTQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L G+ +SVD++TKENL+ L ++G +LL KPV K+NL  G  EP+  
Sbjct  315  LNCQDNYLRIQDDTLTGTDSSVDISTKENLEKLCQIGDRLLKKPVSKVNLENGMFEPIEN  374

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  375  GETNQEALKRF  385



>ref|XP_006660710.1| PREDICTED: patatin-2-Kuras 2-like isoform X2 [Oryza brachyantha]
Length=387

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 131/193 (68%), Gaps = 9/193 (5%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  V++++  ++P +        + +   RF
Sbjct  201  FRTEDCHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKQNPDFFPI-----KPMDYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY+A++A +WGVL WL  G   PL+D+F+ ASADMVD HIA +F+ 
Sbjct  256  LVISLGTGSPKIEAKYSAEKAKSWGVLDWLLVGGSTPLVDIFTQASADMVDIHIAAVFKV  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV--  534
            L +  NYLRIQ+D L+G+ ASVDV T++NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  316  LHSEQNYLRIQDDTLQGTVASVDVATRDNLEKLANVGEILLNKPVSRANLETGQMVPACD  375

Query  535  -PKAGTNKDALKR  570
             P+  TN++ALKR
Sbjct  376  DPEM-TNREALKR  387



>tpg|DAA45677.1| TPA: hypothetical protein ZEAMMB73_598493 [Zea mays]
Length=401

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T DA G + EYNLIDGGVAANNPT++A++ +T++M+A   K         +   C RF
Sbjct  182  FQTEDANGKEREYNLIDGGVAANNPTMVAMTQITKKMLASKDK--AEELYPVKPSNCRRF  239

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LSIGTG++     YTA+Q + WG+  WL      P+ID+F  AS+D+VD H+A +FQ+
Sbjct  240  LVLSIGTGSTSEQGLYTARQCSRWGICRWLRNNGMAPIIDIFMAASSDLVDIHVAAMFQS  299

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ++ L+G+ A+VD  T EN+  L  +G+++L + V ++N+ TG+ EPV  
Sbjct  300  LHSDGDYLRIQDNSLRGAAATVDAATPENMRTLVGIGERMLAQRVSRVNVETGRYEPVTG  359

Query  541  AGTNKDAL  564
             G+N DAL
Sbjct  360  EGSNADAL  367



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T+D+ G   +YNLIDGG+AANNPTLIAIS VT+ +  K P +     +S  A    RF
Sbjct  197  FQTSDSTGALRDYNLIDGGMAANNPTLIAISEVTREITRKSPAF-----NSINASEFGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  +KY A+  A WGV GWL   +  PLID F   SADMVD H++ +F+A
Sbjct  252  LVISVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAFMQGSADMVDIHLSVVFKA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G+ ++VD +TKENL+ L  VG+KLL KPV K+NL TG N    K
Sbjct  312  LNSESNYLRIQDDTLSGTVSTVDTSTKENLNNLVGVGEKLLKKPVSKVNLETG-NLEASK  370

Query  541  AGTNKDALKRL  573
              TN+ ALKR 
Sbjct  371  METNEQALKRF  381



>ref|XP_011017228.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011017229.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=405

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D++G    +NL+DGGVAANNPTL+AI  V++ +    P +        +     R+
Sbjct  197  FETKDSEGKVRAFNLVDGGVAANNPTLVAIGEVSKEINRDSPDFF-----PMKPTDYGRY  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS+DMVD H+AT+FQA
Sbjct  252  LVLSLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVFTQASSDMVDLHLATVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRIQ+D L G+ ASVD+ TKENL+ L +VG+ LL KPV  +NL TG  EP  +
Sbjct  312  LRSEKNYLRIQDDTLTGTLASVDIATKENLENLVKVGEGLLKKPVSSVNLDTGVFEPANR  371

Query  541  AGTNKDALKRL  573
              TN++AL + 
Sbjct  372  L-TNEEALIKF  381



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNPT +A+  VT+ ++     +        + +   RF
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFFPI-----KPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A++AA WGVLGWL+   G+PL+DVF  ASADMVD+H++ +FQA
Sbjct  253  LVISLGTGSQKVEGKYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L GS ASVD+ TK+NL+ L + G+ LL KPV K++L TG+ +   K
Sbjct  313  LHLEANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQYDAC-K  371

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  372  LETNEEALRRF  382



>ref|XP_010061771.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 6/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T+D+ G   +YNLIDGG+AANNPTLIAIS VT+ +  K P +     +S  A    RF
Sbjct  197  FQTSDSTGALRDYNLIDGGMAANNPTLIAISEVTREITRKSPAF-----NSINASEFGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  +KY A+  A WGV GWL   +  PLID F   SADMVD H++ +F+A
Sbjct  252  LVISVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAFMQGSADMVDIHLSVVFKA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G+ ++VD +TKENL+ L  VG+KLL KPV K+NL TG N    K
Sbjct  312  LNSESNYLRIQDDTLSGTVSTVDTSTKENLNNLVGVGEKLLKKPVSKVNLETG-NLEASK  370

Query  541  AGTNKDALKR  570
              TN+ ALKR
Sbjct  371  METNEQALKR  380



>ref|XP_008228776.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=428

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   E+NLIDGGVAANNPTL+AI  VT+ ++       +S     + +   RF
Sbjct  199  FETMDPEGNVREFNLIDGGVAANNPTLLAIGEVTKTIIKG-----SSDFFPIKPMDYTRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A  AA WG+L WL  G G P+IDVFS +SADMVDYH++ +FQA
Sbjct  254  LVISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADMVDYHLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ +NYLRIQ+D L G  +SVD+  K+NLD L  VG++LL KPV ++NL TG+ EP  K
Sbjct  314  LRSENNYLRIQDDTLTGHVSSVDIADKQNLDDLLLVGERLLKKPVSRVNLETGRVEPS-K  372

Query  541  AGTNKDALKRL  573
              +N++AL R 
Sbjct  373  HESNEEALTRF  383



>emb|CAN76066.1| hypothetical protein VITISV_001725 [Vitis vinifera]
Length=413

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ +    P +        + +   RF
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITRGSPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WGVLGWL  G   PL+ VF+ AS DM+D H++ IFQA
Sbjct  255  LVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSZIFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  315  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  373

Query  541  AGTNKDALKRL  573
              TN++AL  L
Sbjct  374  HETNEEALTSL  384



>ref|XP_004957049.1| PREDICTED: patatin-05-like [Setaria italica]
Length=384

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 128/192 (67%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E++LIDGGVAANNP L+AI  VT+++  ++P +        + +   RF
Sbjct  198  FKTEDCHGNTKEFHLIDGGVAANNPALVAIGEVTKQIFKENPDFF-----PIKPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG +KY   Y AQ A +WGVLGWL      PL+D+F+ ASADMVD HI+ +F+A
Sbjct  253  LVISLGTGTAKYEVNYNAQTAKSWGVLGWLLGSGSTPLVDIFTQASADMVDIHISAVFKA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ +SVD+ TK+N++ L  +G  LL KPV ++NL TG   P   
Sbjct  313  LHSEQNYLRIQDDTLQGTLSSVDIATKDNMEKLASIGDALLKKPVSRVNLETGHMVPAYH  372

Query  541  AG--TNKDALKR  570
            +   TNK+ALKR
Sbjct  373  SPEMTNKEALKR  384



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   DA+  + E+NLIDGGVAANNPTL+AI  VT++++ +            + +   RF
Sbjct  201  FKNKDAQDSEREFNLIDGGVAANNPTLVAIGEVTKQVLMQH-----GDLFPIKPMDYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K   K+ AQ AA WG+L WL   +  P+ID F+ ASADMVDYH   +F+A
Sbjct  256  LVISLGTGNAKNEHKFNAQMAAKWGLLSWLLNNNSTPIIDAFNQASADMVDYHNFVVFKA  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G+ ASVD+ TKENL +L +VG+ LL KPV K+NL  G  E V  
Sbjct  316  LHSDDKYLRIQDDTLTGNLASVDIATKENLQSLVKVGEHLLEKPVSKINLDKGVYEAVEN  375

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  376  GGTNKEALQRF  386



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ ++   P +        + +   RF
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WG+LGWL  G   PL+ VF+ ASADMVD H++  FQA
Sbjct  255  LVISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  315  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  373

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  374  HETNEEAL  381



>ref|XP_008393827.1| PREDICTED: patatin-like protein 2 isoform X1 [Malus domestica]
Length=407

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   ++NLIDGGVAANNPTL+AI  VT+ +++    +        + +   RF
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFFPI-----KPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A  AA WG+L WL  G G P+IDVFS +S+DMVDYH++ +FQA
Sbjct  254  LVISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  +SVD+  K+NLD L +VG+ LL KPV ++NL TG+ EP  K
Sbjct  314  LHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPS-K  372

Query  541  AGTNKDALKRL  573
              +N++AL R 
Sbjct  373  HESNEEALTRF  383



>ref|XP_008656522.1| PREDICTED: patatin-like protein 1 [Zea mays]
 tpg|DAA45678.1| TPA: hypothetical protein ZEAMMB73_598493 [Zea mays]
Length=428

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T DA G + EYNLIDGGVAANNPT++A++ +T++M+A   K         +   C RF
Sbjct  209  FQTEDANGKEREYNLIDGGVAANNPTMVAMTQITKKMLASKDK--AEELYPVKPSNCRRF  266

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LSIGTG++     YTA+Q + WG+  WL      P+ID+F  AS+D+VD H+A +FQ+
Sbjct  267  LVLSIGTGSTSEQGLYTARQCSRWGICRWLRNNGMAPIIDIFMAASSDLVDIHVAAMFQS  326

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ++ L+G+ A+VD  T EN+  L  +G+++L + V ++N+ TG+ EPV  
Sbjct  327  LHSDGDYLRIQDNSLRGAAATVDAATPENMRTLVGIGERMLAQRVSRVNVETGRYEPVTG  386

Query  541  AGTNKDAL  564
             G+N DAL
Sbjct  387  EGSNADAL  394



>ref|XP_008393828.1| PREDICTED: patatin-like protein 2 isoform X2 [Malus domestica]
Length=408

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 132/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   ++NLIDGGVAANNPTL+AI  VT+ +++    +        + +   RF
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFFPI-----KPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A  AA WG+L WL  G G P+IDVFS +S+DMVDYH++ +FQA
Sbjct  254  LVISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  +SVD+  K+NLD L +VG+ LL KPV ++NL TG+ EP  K
Sbjct  314  LHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPS-K  372

Query  541  AGTNKDALKRL  573
              +N++AL R 
Sbjct  373  HESNEEALTRF  383



>ref|XP_008671927.1| PREDICTED: patatin-like protein 3 [Zea mays]
Length=306

 Score =   167 bits (422),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T   +G   E++L+DGGVAANNPT++A+S +T+ ++ ++P +     ++        +
Sbjct  103  FKTEATEGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF-----NAGRPTEYTNY  157

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG+  WL  G   P+ID+FS AS+DMVD H A +FQA
Sbjct  158  LIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQA  217

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+T+SVD+ TKEN+++L  +G+ LL KPV ++N+ TG  EP   
Sbjct  218  LHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSG  277

Query  541  AGTNKDALKRL  573
             GTN +AL   
Sbjct  278  EGTNAEALAHF  288



>ref|XP_002282481.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=413

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ +    P +        + +   RF
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITRGSPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WGVLGWL  G   PL+ VF+ AS DM+D H++ IFQA
Sbjct  255  LVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  315  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  373

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  374  HETNEEAL  381



>ref|XP_004980751.1| PREDICTED: patatin group D-2-like [Setaria italica]
Length=311

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T    G   E++L+DGGVAANNPT++A+S +T+ ++  +P +  +   +        F
Sbjct  111  FRTEGPSGKSREFHLVDGGVAANNPTMVAMSMLTKEVLRHNPDFRPAEYGN--------F  162

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG  K A+ YTA + A WG+L WL  G   PLID+F  ASADMVD H   +F+A
Sbjct  163  LIISVGTGAPKQAEMYTAPKCAKWGLLRWLYDGGFTPLIDIFCHASADMVDIHAKVLFEA  222

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G T+SVD+ TKEN++AL  +G++LL KPV ++N+ TG  EPV  
Sbjct  223  LGCEKNYLRIQDDSLVGHTSSVDIATKENMEALIRIGRELLKKPVARVNIDTGMYEPVAG  282

Query  541  AGTNKDALKRL  573
             G N+ AL+R 
Sbjct  283  EGNNEQALERF  293



>ref|XP_002324124.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
 gb|EEF04257.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
Length=335

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 131/191 (69%), Gaps = 7/191 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNP + AIS V++ +  + P      +     +   RF
Sbjct  126  FETKDPSGKVREFNLIDGGVAANNP-VFAISEVSKAINRESP-----GSFRMNPMEYGRF  179

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K   KY A +AA WG+ GWL      PL+DVF+ AS DMVD+HI+T+FQA
Sbjct  180  LVLSLGTGTAKSEGKYDADEAAKWGIFGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQA  239

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG+KLL KPV ++NL TG  EP+ K
Sbjct  240  LNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLEKPVSRVNLATGVYEPINK  299

Query  541  AGTNKDALKRL  573
              TN++AL +L
Sbjct  300  M-TNEEALTKL  309



>ref|NP_001063402.2| Os09g0462400 [Oryza sativa Japonica Group]
 dbj|BAD38550.1| putative patatin homolog [Oryza sativa Japonica Group]
 gb|EAZ45016.1| hypothetical protein OsJ_29655 [Oryza sativa Japonica Group]
 dbj|BAF25316.2| Os09g0462400 [Oryza sativa Japonica Group]
Length=387

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 127/192 (66%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  V++++  K+P +        + +   RF
Sbjct  201  FRTEDCHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKKNPDFFPV-----KPMDYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY AQ+A +WGVL WL  G   PL+D+F+ ASADMVD HIA +F+ 
Sbjct  256  LVISLGTGSPKIEGKYNAQKAKSWGVLDWLLVGGSTPLVDIFTQASADMVDIHIAAVFKV  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ ASVDV T++NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  316  LHSEQNYLRIQDDTLEGTLASVDVATRDNLEKLANVGEILLNKPVSRANLETGQMMPACD  375

Query  541  AG--TNKDALKR  570
                TN +ALKR
Sbjct  376  DSEITNGEALKR  387



>gb|KGN62058.1| hypothetical protein Csa_2G293860 [Cucumis sativus]
Length=288

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRM-VAKDPKYLTSSTSSKEAVGCHR  177
            F+  D+KG K  ++++DG VAANNPTL A++ V + M + K+   L      K      R
Sbjct  86   FEIKDSKGNKRRFDMVDGAVAANNPTLAAMTHVRKEMSIWKEKSELMPI---KPMETSKR  142

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
             LILS+GTG  K  +KY+A  ++ WG+LGW+      P+ID+FS ASADMVDYHIA+IFQ
Sbjct  143  MLILSLGTGAPKNEEKYSAAVSSKWGILGWIYHSGSTPIIDIFSDASADMVDYHIASIFQ  202

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +     NYLRIQ+D L G  ASVDV T+ENL  L EVG+ LL K + ++NL +GK EP+ 
Sbjct  203  SEHHQKNYLRIQDDTLSGVVASVDVATEENLLKLIEVGEDLLKKQLSRVNLESGKFEPLD  262

Query  538  KAGTNKDAL  564
              GTN+DAL
Sbjct  263  GHGTNEDAL  271



>gb|KFK30329.1| hypothetical protein AALP_AA7G247700 [Arabis alpina]
Length=415

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G K E+NLIDGG+AANNPT+ AI+ VT++++ K+P     +      +   RF
Sbjct  210  FTNEDHEGNKHEFNLIDGGIAANNPTICAIAEVTKQIIKKNP-----AMGDISPLDYTRF  264

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +++S+GTG+ +  +KY A+ A+ WG+LGW+ +    P++D ++ A  DMVDY  + +FQA
Sbjct  265  VVISLGTGSIRNQEKYNAKMASKWGMLGWIFENGSTPILDCYNEAIHDMVDYQSSVVFQA  324

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI +D LKG   SVD++T+EN++ L EVG+ LL K V ++NL TG  EP+P 
Sbjct  325  LRSEKNYLRIDDDTLKGDLGSVDISTEENMEGLVEVGEALLKKRVSRVNLETGHYEPIPD  384

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  385  HVTNEEALKRF  395



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ ++   P +        + +   RF
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF-----PIKPMDYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WG+LGWL  G   PL+ VF+ ASADMVD H++  FQA
Sbjct  255  LVISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  315  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  373

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  374  HETNEEAL  381



>emb|CBI19552.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT+ +    P +        + +   RF
Sbjct  254  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITRGSPDFF-----PIKPMDYGRF  308

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK  +KY A +AA WGVLGWL  G   PL+ VF+ AS DM+D H++ IFQA
Sbjct  309  LVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQA  368

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K V ++NL TG  EP   
Sbjct  369  LHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEPS-N  427

Query  541  AGTNKDAL  564
              TN++AL
Sbjct  428  HETNEEAL  435



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   ++NLIDGGVAANNPTL+AI  VT+ +++    +        + +   RF
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFFPI-----KPMDYGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A  AA WG+L WL  G G P+IDVFS +S+DMVDYH++ +FQA
Sbjct  254  LVISLGTGSPKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  +SVD+  K+NLD L +VG+ LL KPV ++NL TG+ EP  K
Sbjct  314  LHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPS-K  372

Query  541  AGTNKDALKRL  573
              +N++AL R 
Sbjct  373  HESNEEALTRF  383



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D +G   E+NLIDGGVAANNPTL+AI  VT+ ++       +S     + +   RF
Sbjct  199  FETMDPEGNVREFNLIDGGVAANNPTLLAIGEVTKTIIKG-----SSDFFPIKPMDYARF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A  AA WG+L WL  G G P+IDVFS +SADMVDYH++ +FQA
Sbjct  254  LVISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADMVDYHLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L G  +SVD+  K+NLD L  VG+ LL KPV ++NL TG+ EP  K
Sbjct  314  LHSENNYLRIQDDTLTGHVSSVDIADKKNLDDLLIVGEGLLKKPVSRVNLETGRVEPS-K  372

Query  541  AGTNKDALKRL  573
              +N++AL R 
Sbjct  373  HESNEEALTRF  383



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   DA+  + E+NLIDGGVAANNPTL+AI  VT++++ +      +     + +   RF
Sbjct  202  FKNKDAQDNEREFNLIDGGVAANNPTLVAIGEVTKQVLMQH-----ADLFPIKPMDYGRF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K   KY AQ AA WG+L WL   +  P+ID F+ ASADMVD+H   +F+A
Sbjct  257  LVISLGTGNAKNEHKYNAQMAAKWGLLSWLFNDNSTPIIDAFNQASADMVDFHNFVVFKA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G+ ASVD+ TKENL  L +VG+ LL KPV K+NL  G  E V  
Sbjct  317  LHSDDKYLRIQDDTLTGNLASVDIATKENLQGLVKVGEHLLEKPVSKINLDKGVYEAVEN  376

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  377  GGTNKEALQRF  387



>gb|EEC84713.1| hypothetical protein OsI_31673 [Oryza sativa Indica Group]
Length=387

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDGGVAANNP L+AI  V++++  K+P +        + +   RF
Sbjct  201  FRTEDCHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKKNPDFFPV-----KPMDYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY AQ A +WGVL WL  G   PL+D+F+ ASADMVD HIA +F+ 
Sbjct  256  LVISLGTGSPKIEGKYNAQNAKSWGVLDWLLVGGSTPLVDIFTQASADMVDIHIAAVFKV  315

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G+ ASVDV T++NL+ L  VG+ LL KPV + NL TG+  P   
Sbjct  316  LHSEQNYLRIQDDTLEGTLASVDVATRDNLEKLANVGEILLNKPVSRANLETGQMMPACD  375

Query  541  AG--TNKDALKR  570
                TN +ALKR
Sbjct  376  DSEITNGEALKR  387



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLI GGVAANNPTL+A+  V + ++     +   +      +   RF
Sbjct  198  FETQDPTGKVREFNLIVGGVAANNPTLVAMGEVRKEIIGGSSDFFPIN-----PMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KY A +AA WGVL WL+   G+PLIDV   ASADMVD+H++ +FQA
Sbjct  253  LVISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMVDFHLSVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+ ASVD+  K+N++ L + G+ LL KPV ++NL TG+ EP P 
Sbjct  313  LLIEANYLRIQDDTLSGAVASVDIAMKKNMNDLVKTGEALLKKPVSRVNLETGRYEPTPN  372

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  373  QETNEEALRRF  383



>ref|XP_009780403.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=427

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G    ++LIDGGVAANNPTL+AIS +++ ++    +Y        E + C + 
Sbjct  211  FETKDAEGKIRTFDLIDGGVAANNPTLVAISHISKEIMLGKSQY-----EGMEPMDCKKM  265

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K   KY+A  A++WGVLGWL     +PL+DVF  ASAD+VD H++T+FQ+
Sbjct  266  LVLSLGTGIGKEEKKYSAAVASSWGVLGWLYNNGASPLLDVFGDASADIVDIHLSTMFQS  325

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ   NYLRIQ+D L G  AS+DV+T EN+  L ++G  LL KPV ++NL TG+ E V  
Sbjct  326  LQNEKNYLRIQDDSLTGEAASMDVSTTENMKTLVQIGNDLLKKPVSRVNLDTGRYEEVSG  385

Query  541  AGTNKDALKRL  573
             GTN++A  R 
Sbjct  386  EGTNEEAFIRF  396



>ref|XP_006659497.1| PREDICTED: patatin-3-Kuras 1-like [Oryza brachyantha]
Length=433

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 131/192 (68%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+A++ VT++++  +P +     +        +F
Sbjct  226  FETKDKDGKPREFNLIDGGVAANNPTLLAMTHVTKQILLGNPDFFPIKPAD-----YGKF  280

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLA-QGDGNPLIDVFSVASADMVDYHIATIFQ  357
            +ILS+GTG++K  +K+ A ++A WGVLGWL  +G   PLID FS ASAD+VD H + +FQ
Sbjct  281  MILSLGTGSAKVEEKFDAVESARWGVLGWLYNKGGATPLIDSFSQASADLVDIHASVLFQ  340

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL+    YLR+Q+D+L G  ASVDV+T ENL  L  VG+ LL +P  K+N+ TG+NEP  
Sbjct  341  ALRCERRYLRVQDDELTGDAASVDVSTPENLRRLVGVGRALLQRPACKVNVETGRNEPDM  400

Query  538  KAGTNKDALKRL  573
              GTN++ L+R 
Sbjct  401  DRGTNEEELERF  412



>ref|XP_008378197.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=412

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F + ++ G   E+NLIDGGVAANNP L+A+S VT+++  ++P ++    + K      RF
Sbjct  195  FKSTNSTGETREFNLIDGGVAANNPALVAMSEVTKQIHKRNPDFVPFGANCKL---YERF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGD-GNPLIDVFSVASADMVDYHIATIFQ  357
            L++S+GTG +   +KY A++A+ WG LGWL   D   PL+D+F+ AS+DMVD+H+AT+FQ
Sbjct  252  LVISLGTGTTS-EEKYDAKEASEWGALGWLIGPDFAAPLLDIFTQASSDMVDFHLATVFQ  310

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL++ DNYLRIQ+D L G+ ASVD+ T ENL+ L +VG+KLL KPV +++  TGK +PV 
Sbjct  311  ALESPDNYLRIQDDTLSGTLASVDIATSENLNDLIKVGEKLLKKPVSRVDFGTGKGKPVH  370

Query  538  KAGTNKDALKRL  573
               TN++ L R+
Sbjct  371  PDITNQEVLIRV  382



>ref|XP_002301195.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
 gb|EEE80468.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
Length=411

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+T D + G+V E+NLIDGGVAANNP LIAIS VT+ +V   P +        + +   R
Sbjct  202  FETKDEQTGEVREFNLIDGGVAANNPALIAISEVTKEIVKGSPDFFPI-----KPMDYGR  256

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG+ K  +KY A +AA WG+LGWL  G   P+ID FS ASADMVD HI+ + Q
Sbjct  257  FLLISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTPVIDAFSHASADMVDLHISVVLQ  316

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL + +NYLRIQ+D L     SVD+ TK NL+ L +VG++LL KPV ++NL +G +EP  
Sbjct  317  ALHSENNYLRIQDDTLSREECSVDIATKTNLEDLVKVGERLLKKPVSRVNLESGLSEPSV  376

Query  538  KAGTNKDALKRL  573
            K  TN++AL R 
Sbjct  377  KE-TNEEALARF  387



>gb|KCW66177.1| hypothetical protein EUGRSUZ_F00013 [Eucalyptus grandis]
Length=190

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = +1

Query  37   YNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSKY  216
            Y+LIDGGV ANNP L+AI+ V +      P +   +     A    RFL++SIGT + K 
Sbjct  8    YHLIDGGVTANNPALVAIAQVFKETANAIPDFFPLA-----ATNYGRFLVISIGTSSPKI  62

Query  217  ADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQE  396
              KY A+ A  WG + WL  G   PL+DVF+ ASADMVD+HI+  FQAL   DNYLRIQ+
Sbjct  63   ERKYNAKMAVKWGTVDWLLHGGSVPLVDVFTTASADMVDFHISATFQALPFEDNYLRIQD  122

Query  397  DDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDALKR  570
            D L G  +SVD+ TKENL+ L  +G++LL KPV ++NL TG +EP+ K  TN DALKR
Sbjct  123  DTLTGKDSSVDIATKENLENLLRIGERLLKKPVSRVNLETGLSEPIAKGTTNADALKR  180



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DAKG    +NL+DGGVAANNPTL+AIS V + ++ K+  +     S  + +   +F
Sbjct  199  FETKDAKGNTRSFNLVDGGVAANNPTLVAISEVMKEILKKNEDF-----SPFKPMDYGKF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++++AQ+A+ WGVLGWL      PLID+F  ASADMVD H + +FQA
Sbjct  254  LVISLGTGSAKNEERFSAQKASKWGVLGWLYNNGATPLIDIFKQASADMVDIHASVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D+L G  +SVD++T ENL  L ++GK LL K V ++NL TG +E V +
Sbjct  314  LHSTGNYLRIQDDNLTGKASSVDISTDENLLRLMQIGKDLLKKRVSRVNLETGLSEEVSE  373

Query  541  AGTNKDAL  564
              TN++ L
Sbjct  374  DETNEEEL  381



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 128/193 (66%), Gaps = 8/193 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGVAANNPTL+AIS +T+ ++ K+P +   +      +   RF
Sbjct  199  FKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDFCPIN-----PLDYTRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WG++ WL      PL+D +  A  DMVDYHI+ +FQA
Sbjct  253  LVISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ DNYLRI++D L+G   S+D+TTKEN + L   G+ LL KPV ++NL TG  EP+  
Sbjct  313  LQSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDTGLYEPIEN  372

Query  541  --AGTNKDALKRL  573
              AGTN++ALKR 
Sbjct  373  GSAGTNEEALKRF  385



>ref|XP_006372536.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
 gb|ERP50333.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
Length=368

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   ++NLIDGGVAANNPTL+AIS V++ +  + P      +     +   RF
Sbjct  200  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINLEGP-----DSYRMNPMEYGRF  254

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WG+LGWL      PL+DVF+ ASADMVD+HI+T+FQA
Sbjct  255  LVLSLGTGTAKSEEKYDAAEAAKWGLLGWLTSDHSTPLVDVFTQASADMVDFHISTVFQA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVG  471
            L + +NYLRIQ+D L G+ +SVDV TKENL+ L +VG
Sbjct  315  LNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVG  351



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNPT +A+  VT+ ++     +        + +   RF
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFFPI-----KPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K    Y A++AA WGVLGWL+   G+PL+DVF  ASADMVD+H++ +FQA
Sbjct  253  LVISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L GS ASVD+ TK+NL+ L + G+ LL KPV K++L TG++    K
Sbjct  313  LHLEANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNAC-K  371

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  372  LETNEEALRRF  382



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E+NLIDG +AANNPTLIA S VT+++ A++  +     S        RF
Sbjct  202  FQTQDKDGKVQEFNLIDGAIAANNPTLIATSEVTKQIYAENKDFFPIKPSDHG-----RF  256

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG++K   K+ A+ AA WG+LGWL +G  NP+IDVF+    DMVDY+ +  FQA
Sbjct  257  LVISIGTGSAKLEQKFNAKMAAKWGLLGWLTKGGSNPIIDVFTQGGDDMVDYYNSVAFQA  316

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++ D+YLRIQ+D L G  +SVD+ TKEN+  L E+G+ LL KPV ++NL  G  EP   
Sbjct  317  LRSQDHYLRIQDDTLSGIDSSVDIATKENMAKLVEIGENLLKKPVSRINLKKGIFEPHET  376

Query  541  AGTNKDALKRL  573
             GTN++ LKR 
Sbjct  377  GGTNEETLKRF  387



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            E+NLIDGGVAANNPTL+AI  VT+ ++ ++P +      + + +   RFL++S+GTG  K
Sbjct  207  EFNLIDGGVAANNPTLVAIGEVTKEVIKQNPDFF-----AIKPMDYRRFLVISLGTGAPK  261

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
               +YTA+ AA WG+L WL  G   P+IDVFS AS+DMVD+H++ IFQAL   DNYLRIQ
Sbjct  262  AEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDFHLSVIFQALHCEDNYLRIQ  321

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP-KAGTNKDALKR  570
            +D L G  +SVDV T++NL+ L +VG+ LL KPV ++NL TG  E  P  + TN  AL R
Sbjct  322  DDTLSGDLSSVDVATQKNLNDLVKVGESLLKKPVSRVNLQTGVFEDCPSNSETNDQALTR  381

Query  571  L  573
             
Sbjct  382  F  382



>ref|XP_003611772.1| Patatin-like protein [Medicago truncatula]
 gb|AES94730.1| patatin-like phospholipase [Medicago truncatula]
Length=396

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 126/192 (66%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+  D  G  + EYNLIDGGVAANNP+++AI  VT+ ++ K         S    +G  R
Sbjct  192  FEKKDEHGNVIKEYNLIDGGVAANNPSMVAIREVTKHIIRK------PDGSGDNGIGYDR  245

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            F+++S+GTG++K   KY A+  A WG L WL      P++D F+ AS DMVDYH A +F 
Sbjct  246  FIVISLGTGSNKSERKYNAKMVAKWGALTWLFNNGSTPILDCFNEASNDMVDYHNAVLFT  305

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            ALQ+ DNYLRIQ+D L+G  ASVD++TKENL+ L +VG++LL K   ++NL TG  E VP
Sbjct  306  ALQSQDNYLRIQDDTLQGELASVDISTKENLNNLVKVGEQLLKKKFTRVNLDTGIYEIVP  365

Query  538  KAGTNKDALKRL  573
              GT ++ LKR 
Sbjct  366  YKGTIEEELKRF  377



>tpg|DAA42304.1| TPA: hypothetical protein ZEAMMB73_137328 [Zea mays]
Length=333

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T   +G   E++L+DGGVAANNPT++A+S +T+ ++ ++P +     +         +
Sbjct  130  FKTEATEGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDFNAGRPTEYT-----NY  184

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG+  WL  G   P+ID+FS AS+DMVD H A +FQA
Sbjct  185  LIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQA  244

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+T+SVD+ TKEN+++L  +G+ LL KPV ++N+ TG  EP   
Sbjct  245  LHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSG  304

Query  541  AGTNKDALKRL  573
             GTN +AL   
Sbjct  305  EGTNAEALAHF  315



>gb|KJB29505.1| hypothetical protein B456_005G103900 [Gossypium raimondii]
Length=408

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 134/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  ++ G   E++LIDGGVAANNPTL+A+S V + +  +   +     +        RF
Sbjct  199  FEIKNSTGEVKEFHLIDGGVAANNPTLVAMSEVAKEINRESSDFFHIKPNDYA-----RF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
             +LS+GTG+    +KY+A +AA WGVLGWL     +PLIDVF  AS+DMVD+H+AT+F+A
Sbjct  254  QVLSLGTGSQNPEEKYSAHKAAKWGVLGWLTSEHSSPLIDVFMQASSDMVDFHLATVFRA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  +YLRIQ+D L G+  SVD++TKENL+ L ++G++LL KPV ++NL TGK EPV +
Sbjct  314  LHSEHSYLRIQDDTLSGAVTSVDISTKENLENLVKLGEELLKKPVSRVNLETGKFEPVDQ  373

Query  541  AGTNKDALKRL  573
             GTN++AL RL
Sbjct  374  -GTNEEALIRL  383



>ref|XP_009589750.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=427

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G    ++LIDGGVAANNPTL+AIS +++ ++    +Y        E + C + 
Sbjct  211  FETKDAQGKTRTFDLIDGGVAANNPTLVAISHISKEIMLGKSQY-----EGMEPMDCKKM  265

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            ++LS+GTG  K   KY+A  A++WGVLGWL     +PL+DVF  ASAD+VD H++T+FQ+
Sbjct  266  MVLSLGTGIGKEEKKYSAAVASSWGVLGWLYNNGASPLLDVFGDASADIVDIHLSTMFQS  325

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ   NYLRIQ+D L G  AS+D++T +N+  L ++G  LL KPV ++NL TG+ E V  
Sbjct  326  LQNEKNYLRIQDDSLTGEAASMDISTTKNMKTLVQIGNDLLKKPVSRVNLDTGRYEQVSG  385

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  386  EGTNEEALIRF  396



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDG VAANNP L+AI+ V++ +   +P +         A    RF
Sbjct  196  FKNQDDRGCTREFHLIDGSVAANNPVLVAIAQVSKEIANANPDFFPIG-----ATNYGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A  AA WG L WL  G   PL+DVF+ ASADMVD++I+  FQA
Sbjct  251  LVISIGTGSPKRERKYNATMAAKWGTLDWLLHGGSVPLVDVFTKASADMVDFYISAAFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRI +D L G  +SVD+ TKENL+ L  +G++LL KPV ++NL  G +EP+ K
Sbjct  311  LHFEDNYLRIHDDTLTGKDSSVDIATKENLENLVRIGERLLKKPVSRVNLEMGLSEPIAK  370

Query  541  AGTNKDALKRL  573
              TN DALKR 
Sbjct  371  GITNADALKRF  381



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D++G    +NL+DGGVAANNPTL+AI  V++ +    P +     +        RF
Sbjct  197  FETKDSEGKVRGFNLVDGGVAANNPTLVAIGEVSKEINRDSPDFFPVKPTD-----YGRF  251

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG +K  +KY A +AA WGVLGWL   +  PL+DVF+ AS+DMVD H+ T+FQA
Sbjct  252  LVLSLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVFTQASSDMVDLHLGTVFQA  311

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G+ ASVD+ TKENL+ L +VG+ LL KPV ++NL TG  EP  K
Sbjct  312  LLSEKNYLRIQDDTLTGTLASVDIATKENLENLVKVGEGLLKKPVSRVNLDTGVFEPANK  371

Query  541  AGTNKDALKRL  573
              TN++AL + 
Sbjct  372  L-TNEEALIKF  381



>ref|XP_008797306.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=409

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G   E++LIDGGVAANNP LIAI  VT+ +   +P Y        + +   + 
Sbjct  199  FETKDAEGNVREFHLIDGGVAANNPALIAIGEVTKEVHKGNPDYF-----PYKPMDYRKL  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  ++Y+A++A+ WGVLGW       PL+DVF  +SA+MVD HI+ +FQA
Sbjct  254  LLISLGTGSTKVEERYSAKRASKWGVLGWFLSSGSTPLVDVFMQSSANMVDIHISVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI++D L G+ +S DV+TK+NL+ L + G++LL +PV ++NL TG  EPV  
Sbjct  314  LRSESNYLRIEDDTLSGTISSADVSTKDNLEDLVKRGEQLLKRPVSRVNLETGVFEPVGN  373

Query  541  A-GTNKDALKRL  573
              GTN+DAL+R 
Sbjct  374  GEGTNEDALRRF  385



>ref|XP_002445639.1| hypothetical protein SORBIDRAFT_07g023210 [Sorghum bicolor]
 gb|EES15134.1| hypothetical protein SORBIDRAFT_07g023210 [Sorghum bicolor]
Length=435

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G    +NLIDGGVAANNPTL+A++ V+++++  +  +     +        +F
Sbjct  230  FETKDKDGKPRAFNLIDGGVAANNPTLLAMTDVSKQILLGNQDFFPIKPAD-----YGKF  284

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            ++LS+GTG +K  +K+ A Q++ WG+LGWL+  D  P+ID FS ASAD+VD H + +FQA
Sbjct  285  MVLSLGTGTAKAEEKFDAVQSSKWGLLGWLSNKDTTPIIDSFSQASADLVDIHASVLFQA  344

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +   YLRIQ+D+L G T+SVDV+T ENL+ L +VGK LL KP  K+N+ TGKNEP  K
Sbjct  345  LHSERQYLRIQDDELTGETSSVDVSTMENLNRLVDVGKGLLKKPACKVNIETGKNEPDVK  404

Query  541  AGTNKDALKRL  573
             GTN+D L R 
Sbjct  405  RGTNEDELIRF  415



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G    YNLIDGG+AANNPTL+A+S + + +   +  +     ++ +++  H+F
Sbjct  211  FETTDSDGKSHSYNLIDGGIAANNPTLVAMSQIKKEIALTNKNF-----ANFKSIDYHKF  265

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +I+SIGTG++K   K++A  A+ WGVL WL  G  NPLID F   SAD+VD H++++FQ+
Sbjct  266  IIISIGTGSAKVEQKFSAHLASKWGVLQWLYHGGSNPLIDSFFQGSADVVDIHMSSLFQS  325

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G  +SVDV+TKENL  L ++GK LL K V ++NL TG  + + +
Sbjct  326  LNCEKNYLRIQDDTLMGERSSVDVSTKENLLELVQIGKNLLNKKVSRVNLETGIFQEIDE  385

Query  541  AGTNKDALKRL  573
             GTN DAL +L
Sbjct  386  EGTNADALTQL  396



>ref|XP_006495361.1| PREDICTED: patatin group M-3-like, partial [Citrus sinensis]
Length=323

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 127/192 (66%), Gaps = 8/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGVAANNPTL+AIS +T+ ++ K+P +   +      +   RF
Sbjct  138  FKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDFCPIN-----PLDYTRF  191

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WG++ WL      PL+D +  A  DMVDYHI+ +FQA
Sbjct  192  LVISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQA  251

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ DNYLRI++D L+G   S+D+TTKEN + L   G+ LL KPV ++NL  G  EP+  
Sbjct  252  LQSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDAGLYEPIEN  311

Query  541  --AGTNKDALKR  570
              AGTN++ALKR
Sbjct  312  GSAGTNEEALKR  323



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA G    +NL+DGGVAANNPTL A+  +T+  + K+ K+L     +       +F
Sbjct  199  FETKDANGNIRSFNLVDGGVAANNPTLAAMGLITKE-ICKENKHLFPIKPTDYG----KF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  +K++AQ+A+ WG+LGWL      PLI+VF+ ASADMVD H + +FQA
Sbjct  254  LVISLGTGSAKIEEKFSAQEASKWGILGWLYDHGATPLINVFTQASADMVDIHTSAVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRIQ+D L GST+SVD++TKENL  L ++G  LL K V ++NL TG  E V  
Sbjct  314  LYSKENYLRIQDDTLIGSTSSVDISTKENLLKLVQIGNDLLKKHVSRVNLETGLFELVEG  373

Query  541  AGTNKDALKRL  573
             GTN++AL   
Sbjct  374  EGTNEEALTHF  384



>ref|XP_008670872.1| PREDICTED: patatin-like protein 1 [Zea mays]
Length=330

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T    G   E++L+DGGVAANNPT++A+S +T+ ++ ++P +     ++        +
Sbjct  127  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF-----NAGRPTEYTNY  181

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG+  WL  G   P+ID+FS AS+DMVD H A +FQA
Sbjct  182  LIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQA  241

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+T+SVD+ TKEN+++L  +G+ LL KPV ++N+ TG  EP   
Sbjct  242  LHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSG  301

Query  541  AGTNKDALKRL  573
             GTN +AL   
Sbjct  302  EGTNAEALAHF  312



>ref|NP_001068268.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|ABA94817.1| Patatin-like phospholipase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28631.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|EAZ18421.1| hypothetical protein OsJ_33950 [Oryza sativa Japonica Group]
 dbj|BAG86724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F T D   GK  E++LIDGGVAANNPT++A+S +++ ++ ++  +     +  +      
Sbjct  213  FKTTDVSSGKSREFHLIDGGVAANNPTMVAMSMISKEVLRENQDFKLGKPADYK-----H  267

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            +L++SIGTG +K A+KYTA   A WGVL WL  G   PLID+F+ ASADMVD H + +FQ
Sbjct  268  YLVISIGTGTAKMAEKYTAPACAKWGVLRWLYDGGFTPLIDIFTHASADMVDIHASVLFQ  327

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +L    +YLRIQ+D L+G T+SVD+ TKEN++AL ++GK LLTK V ++N+ TG  EPV 
Sbjct  328  SLCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKIGKDLLTKRVARVNIDTGVYEPVD  387

Query  538  KAGTNKDALKRL  573
              GTN++AL R 
Sbjct  388  GEGTNEEALARF  399



>ref|XP_009409647.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=327

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D +GG  E+NL+DGGVAANNPTL A+S VT+ ++ ++  +     +        RF
Sbjct  124  FQTEDHQGGTREFNLVDGGVAANNPTLTAMSQVTKEILMENADFFPIKPAD-----SGRF  178

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   K++AQ++A WG+L WL      P+ID+F  ASADMVD H+  +F+A
Sbjct  179  LVISLGTGSNKQEGKFSAQESAKWGLLEWLYNKGSTPIIDIFFQASADMVDIHVPVLFRA  238

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + ++YLRIQ+D L G  +SVD++T+ENL+ L E+G +LL KP  + NL  G  EP   
Sbjct  239  LHSEEHYLRIQDDTLVGDASSVDISTRENLEKLVEMGNELLKKPASRANLENGTFEPCEA  298

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  299  EETNEEALFRF  309



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D++G    +NL+DGGVAANNP LIA S +T+++   +  +     S  +     +F
Sbjct  199  FETKDSQGKTRSFNLVDGGVAANNPMLIATSQITKQIFWNNEDF-----SKFKPTDFAKF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   K+TA ++A WG+LGWL      P+ID+FS +SADMVD H + +FQA
Sbjct  254  LVVSLGTGSPKQEQKFTAPESAKWGLLGWLQNKGSTPIIDIFSQSSADMVDIHASILFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRIQ+D L+G TASVDV+T ENL  L +VG+ LL KPV ++NL TG +E    
Sbjct  314  LRSEKNYLRIQDDTLEGDTASVDVSTSENLRKLVQVGQDLLKKPVSRVNLETGVSEACDV  373

Query  541  AGTNKDALKRL  573
             GTN+DAL R 
Sbjct  374  EGTNEDALIRF  384



>gb|EAY88437.1| hypothetical protein OsI_09902 [Oryza sativa Indica Group]
Length=417

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F T D   GK  E++LIDGGVAANNPT++A+S +++ ++ ++  +     +  +      
Sbjct  213  FKTTDVSSGKSREFHLIDGGVAANNPTMVAMSMISKEVLRENQDFKLGKPADYK-----H  267

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            +L++SIGTG +K A+KYTA   A WGVL WL  G   PLID+F+ ASADMVD H + +FQ
Sbjct  268  YLVISIGTGTAKMAEKYTAPACAKWGVLRWLYDGGFTPLIDIFTHASADMVDIHASILFQ  327

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +L    +YLRIQ+D L+G T+SVD+ TKEN++AL ++GK LLTK V ++N+ TG  EPV 
Sbjct  328  SLCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKIGKDLLTKRVARVNIDTGVYEPVD  387

Query  538  KAGTNKDALKRL  573
              GTN++AL R 
Sbjct  388  GEGTNEEALARF  399



>ref|XP_008220196.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=403

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F + ++ G   E+NL DGGVAANNP L+A+S VT+++   +P +L     +++  G  RF
Sbjct  197  FKSTNSNGESREFNLTDGGVAANNPALVAMSEVTKQIHKGNPDFLPMG-ENEQLYG--RF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGN-PLIDVFSVASADMVDYHIATIFQ  357
            L++S+GTG +   +KY A++AA WG  GWL   D + PL+D+F+ A +DMVD+H+ATIFQ
Sbjct  254  LVISLGTGTTS-EEKYDAKEAAEWGAFGWLIGSDFSAPLVDIFTHAGSDMVDFHLATIFQ  312

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            ALQ+ DNYLRIQ+D L G+ AS D+ T++NL+ L +VG+ LL KPV +LN  TGK++PV 
Sbjct  313  ALQSHDNYLRIQDDTLSGTLASADIATEQNLNDLVKVGEALLKKPVSRLNFDTGKSKPVR  372

Query  538  KAGTNKDALKRL  573
               TN++AL R+
Sbjct  373  PEVTNEEALVRI  384



>ref|XP_008361010.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=401

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT++++   P +        + +   R+
Sbjct  199  FETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDFFPI-----KPMDYGRY  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK   KY+A  AA WG+L WL  G   P+IDVFS  SADMVD +++ +FQA
Sbjct  254  LVISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L G  +SVD+ T++NLD L +VG+ LL +PV ++NL TGK E V  
Sbjct  314  LHSEKNYLRIQDDKLHGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLETGKFE-VCN  372

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  373  HETNEEALIRF  383



>ref|XP_004291128.2| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=438

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F T D   G+  E++LIDGGVAANNP L+A+S VT+ +   +P +     +        R
Sbjct  202  FQTKDCSTGEAREFDLIDGGVAANNPALVALSEVTKEIHQGNPDFFPIKPNEYG-----R  256

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG++K  +KY A  A  WGVLGWL  G   PL+DVF+ AS+DMVDYH++T+FQ
Sbjct  257  FLVISLGTGSAKCEEKYEATNAGRWGVLGWLTGGGSCPLVDVFTQASSDMVDYHLSTVFQ  316

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL +  NYLRIQ+D L+ +  SVD+ T ENL+ L +VG++LL KPV ++N+ TG  EP  
Sbjct  317  ALHSEKNYLRIQDDTLEKTVCSVDIATHENLNNLVKVGEELLKKPVSRVNMETGMFEPAH  376

Query  538  KAGTNKDALKRL  573
            ++ TN++AL R+
Sbjct  377  QS-TNEEALVRV  387



>ref|XP_009781952.1| PREDICTED: patatin-like protein 3 [Nicotiana sylvestris]
Length=411

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+G    ++LIDGGVAANNPTL+AI+ ++++++  + +Y        E + C + 
Sbjct  212  FETKDAEGKIRTFDLIDGGVAANNPTLMAITHISKQIMTGNFQY-----EDMEKMDCKKM  266

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K+ +KY A  A+ WG+LGW+      PLIDV++ ASADMVD H++T+FQ 
Sbjct  267  LVLSLGTGTGKHEEKYNATIASRWGMLGWIYNNGATPLIDVYADASADMVDIHVSTMFQT  326

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NY+RIQ+D+L G  AS+D+ T EN++ L ++G  LL KPV ++NL TG+ EPV  
Sbjct  327  LGSEKNYIRIQDDNLTGEAASMDIATVENMERLVQIGNDLLKKPVSRVNLETGRYEPVVV  386

Query  541  AGTNKDAL  564
             GTN+ A+
Sbjct  387  EGTNEAAI  394



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ V +      P +   +      +   RF
Sbjct  196  FKNQDVQGCTREFHLIDGGVAANNPALVAIAQVFKETANASPDFFPFA-----EMNYGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WG + WL  G   PL+DVF+ ASADMVD HI+  FQA
Sbjct  251  LVISIGTGSPKIERKYNAKMAAKWGTVDWLLHGGSVPLVDVFTTASADMVDLHISATFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L    + VD+ TKENL+ L  +G++LL KPV ++NL TG +EP+ K
Sbjct  311  LHFEDNYLRIQDDTLTRKDSFVDIATKENLENLVWIGERLLKKPVSRVNLETGLSEPITK  370

Query  541  AGTNKDALKRL  573
              TN DALKR+
Sbjct  371  GTTNADALKRV  381



>ref|XP_009367377.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=401

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D  G   E+NLIDGGVAANNPTL+AI  VT++++   P +        + +   R+
Sbjct  199  FETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDFFPI-----KPMDYGRY  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+SK   KY+A  AA WG+L WL  G   P+IDVFS  SADMVD +++ +FQA
Sbjct  254  LVISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+G  +SVD+ T++NLD L +VG+ LL +PV ++NL TGK E    
Sbjct  314  LHSEKNYLRIQDDKLRGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLDTGKFEAC-N  372

Query  541  AGTNKDALKRL  573
              TN++AL R 
Sbjct  373  HETNEEALIRF  383



>emb|CDM80597.1| unnamed protein product [Triticum aestivum]
Length=434

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 126/188 (67%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T    G   E+NLIDGGVAANNPTL+A++ V+++++  +P +     +        +F
Sbjct  229  FRTEHEDGKVREFNLIDGGVAANNPTLLAMTDVSKQILMGNPDFFPIKPADY-----GKF  283

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            +ILS+GTG +K  +K+ A + + WG+LGWL      P+ID FS ASAD+VD H + +FQA
Sbjct  284  MILSLGTGTAKIEEKFDAAECSKWGLLGWLYNRGATPIIDSFSQASADLVDIHASVLFQA  343

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L     YLRIQ+D+LKG TASVDV+T+ENL+ L +VGK LL + V K+N  TGKNEP   
Sbjct  344  LHCEKRYLRIQDDELKGETASVDVSTQENLNRLIDVGKALLKRQVCKVNAETGKNEPDQN  403

Query  541  AGTNKDAL  564
             GTN++ L
Sbjct  404  RGTNEEEL  411



>ref|XP_006466736.1| PREDICTED: patatin-11-like [Citrus sinensis]
Length=391

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 127/193 (66%), Gaps = 8/193 (4%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D  G   E+NLIDGGVAANNPTL+AIS +T+ ++ K+P +   +      +   RF
Sbjct  188  FKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDFCPIN-----PLDYTRF  241

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ A+ WG++ WL      PL+D +  A  DMVDYHI+ +FQA
Sbjct  242  LVISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQA  301

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ DNYLRI++D L+G   S+D+TTKEN + L   G+ LL KPV ++NL  G  EP+  
Sbjct  302  LQSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDAGLYEPIEN  361

Query  541  --AGTNKDALKRL  573
              AGTN++ALKR 
Sbjct  362  GSAGTNEEALKRF  374



>ref|XP_004233636.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=816

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T DA+  + E+NLIDGGVAANNPTLIAI  VT++++ K            + +   RF
Sbjct  614  FKTKDAQNNENEFNLIDGGVAANNPTLIAIGEVTKQVLMKHEDLFPI-----KPLDYGRF  668

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K   KY A+ A+ WG+L WL   +  P+I+ F+ ASADMVD+H   +F+A
Sbjct  669  LVISLGTGNAKNEGKYNAKMASKWGLLSWLTHDNSTPIIEAFNQASADMVDFHNFVVFKA  728

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ D YLRIQ+D L G+ ASVD+ TKENL  L +VG+KLL KP  K+NL  G  E V  
Sbjct  729  LQSDDQYLRIQDDTLTGNLASVDIATKENLQGLVKVGEKLLDKPTSKINLDKGVYEAVEN  788

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  789  GGTNKEALRRF  799


 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T DA+    E+NLIDGGVAANNPTL+AI  VT++ + K            + +   RF
Sbjct  206  FNTKDAQNEDREFNLIDGGVAANNPTLVAIGEVTKQTLMKHEDLFPI-----KPMDYGRF  260

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTGN+K   KY A+ A+ WG+L WL   +  P+++ F+ ASADMVDYH   +F+A
Sbjct  261  LVISLGTGNAKNEGKYNAKMASKWGLLSWLTHDNSTPIVEAFNQASADMVDYHNFVVFKA  320

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G+ ASVD++TKENL  L +VG++LL KP  K+NL  G  E V  
Sbjct  321  LHSDDKYLRIQDDTLTGNLASVDISTKENLQGLIKVGEELLDKPTSKINLDKGVYEAVEN  380

Query  541  AGTNKDALKRL  573
             GTNK+AL+R 
Sbjct  381  GGTNKEALRRF  391



>gb|KCW66471.1| hypothetical protein EUGRSUZ_F00268 [Eucalyptus grandis]
Length=390

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D +G   E++LIDGGVAANNP L+AI+ V +      P +   +      +   RF
Sbjct  196  FKNQDVQGCTREFHLIDGGVAANNPALVAIAQVFKETANASPDFFPFA-----EMNYGRF  250

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K   KY A+ AA WG + WL  G   PL+DVF+ ASADMVD HI+  FQA
Sbjct  251  LVISIGTGSPKIERKYNAKMAAKWGTVDWLLHGGSVPLVDVFTTASADMVDLHISATFQA  310

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L   DNYLRIQ+D L    + VD+ TKENL+ L  +G++LL KPV ++NL TG +EP+ K
Sbjct  311  LHFEDNYLRIQDDTLTRKDSFVDIATKENLENLVWIGERLLKKPVSRVNLETGLSEPITK  370

Query  541  AGTNKDALKR  570
              TN DALKR
Sbjct  371  GTTNADALKR  380



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 135/193 (70%), Gaps = 7/193 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F+T D++G    E++LIDGG+AANNP L+A+  VT+ +  K+P +      ++EAV   +
Sbjct  198  FETKDSEGSSSREFHLIDGGIAANNPALVAVGEVTKEVHKKNPDHF-----NREAVDYRK  252

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL++S+GTG++K   KY A+ A+ WGV GWL  G   PL+DV   + AD+VD H++ +F+
Sbjct  253  FLLISLGTGSAKVEGKYRAKSASRWGVFGWLLGGGSTPLVDVLMQSCADIVDIHLSVVFK  312

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL++  NYLRI++D L G+ +S D++T+ENLD L  VG++LL KPV ++NL TG  EPV 
Sbjct  313  ALRSESNYLRIEDDTLTGAVSSADISTEENLDDLVSVGERLLKKPVSRVNLETGVFEPVG  372

Query  538  KA-GTNKDALKRL  573
               GTN+DAL+R 
Sbjct  373  NGEGTNEDALRRF  385



>emb|CDP11080.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 17/190 (9%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G    +NLIDGGVAANNP       V+Q           S   S  +    RF
Sbjct  196  FETEDSDGSVKVFNLIDGGVAANNP-------VSQG---------NSDFFSIRSQEYSRF  239

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            ++LS+GTG +K   KY A+QAA WG+LGWL  G   PL+DVFS AS+DMVD+H++TIFQ 
Sbjct  240  IVLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDVFSQASSDMVDFHLSTIFQT  299

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            LQ+ +NYLRIQ+D L G  ASVDV T+ENL  L +VG+ LL K V ++NL TG  EP+ K
Sbjct  300  LQSEENYLRIQDDTLTGDLASVDVATEENLQNLVKVGENLLKKAVSRINLQTGVFEPLNK  359

Query  541  AGTNKDALKR  570
             GTN++ALKR
Sbjct  360  -GTNEEALKR  368



>gb|KGN62064.1| hypothetical protein Csa_2G294910 [Cucumis sativus]
Length=301

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 125/188 (66%), Gaps = 3/188 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D+KG    Y ++DGGVAANNPTL A++ VT+ M     +   S     + +   R 
Sbjct  100  FQTKDSKGNIRNYEMVDGGVAANNPTLAAMTHVTKEMSILRHR---SELLKIKPMETERM  156

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LS+GTG  K  +KY+A +A+ WG+L W+  G G P++D+FS ASADMVDYHI++IFQ+
Sbjct  157  LVLSLGTGTPKNDEKYSAAKASKWGMLDWVYHGGGTPIVDIFSDASADMVDYHISSIFQS  216

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
                 NYLRIQ+D L G  +SVD+ T+ENL  L  VG+ LL KP+ ++NL +GK EP+  
Sbjct  217  DHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLIYVGENLLKKPLSRVNLESGKFEPLDA  276

Query  541  AGTNKDAL  564
             GTN+ AL
Sbjct  277  KGTNEQAL  284



>ref|XP_004958340.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=412

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 132/193 (68%), Gaps = 7/193 (4%)
 Frame = +1

Query  1    FDTADAKGGKV-EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F T D   GK  ++NLIDGGV+ANNPTL+ I+ +T++M+              +     +
Sbjct  198  FQTRDEATGKTRDFNLIDGGVSANNPTLLTINQITRKMIVDKQDLFPGGPKDYD-----K  252

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDG-NPLIDVFSVASADMVDYHIATIF  354
            FL++SIGTG++K A  YTA+ AA WG+L WL   DG  P++D+FS +SA +VDY+++ +F
Sbjct  253  FLVISIGTGSAKNAAVYTAKDAAGWGILSWLHSKDGYTPIVDMFSYSSAALVDYNVSILF  312

Query  355  QALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPV  534
            QAL++  NYLRIQED L G+ A+VDV T+EN++ L  +G+++L K V ++++ TGK+ PV
Sbjct  313  QALRSEKNYLRIQEDSLMGAAATVDVATRENMEELVRIGERMLAKTVSRVDMETGKHVPV  372

Query  535  PKAGTNKDALKRL  573
             + GTN DAL R 
Sbjct  373  LEEGTNADALARF  385



>gb|EMT07292.1| Patatin-11 [Aegilops tauschii]
Length=293

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = +1

Query  34   EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIGTGNSK  213
            ++NLIDGGVAANNPTL+A++ V+++++  +P +     +        +F+ILS+GTG +K
Sbjct  99   QFNLIDGGVAANNPTLLAMTDVSKQILMGNPDFFPIKPAD-----YGKFMILSLGTGTAK  153

Query  214  YADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQ  393
              +K+ A + + WG+LGWL      P+ID FS ASAD+VD H + +FQAL     YLRIQ
Sbjct  154  IEEKFDAAECSKWGLLGWLYNRGATPIIDSFSQASADLVDIHASVLFQALHCEKRYLRIQ  213

Query  394  EDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKDAL  564
            +D+LKG TASVDV+T ENL+ L ++GK LL + V K+N  TGKNEP    GTN++ L
Sbjct  214  DDELKGETASVDVSTPENLNRLVDIGKALLKRQVCKVNAETGKNEPDQNRGTNEEEL  270



>ref|XP_002467750.1| hypothetical protein SORBIDRAFT_01g033380 [Sorghum bicolor]
 gb|EER94748.1| hypothetical protein SORBIDRAFT_01g033380 [Sorghum bicolor]
Length=437

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 126/189 (67%), Gaps = 3/189 (2%)
 Frame = +1

Query  1    FDTADAKGGK-VEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHR  177
            F T DA  GK  EYNLIDGGVAANNPT++A++ +T++M+A   K         +   C +
Sbjct  211  FQTKDAGSGKEREYNLIDGGVAANNPTMVAMTQITKKMLASKEK--AEELYPVKPWNCRK  268

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
            FL+LSIGTG++     YTA+Q + WG+  W+      P+ID+F  AS+D+VD H+A +FQ
Sbjct  269  FLVLSIGTGSTSEQGLYTARQCSRWGICRWIRNNGMAPIIDIFMAASSDLVDIHVAAMFQ  328

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +L +  +YLRIQ++ L G+ A+VD  T EN+  L  +G+++L + V ++N+ TG+ EPVP
Sbjct  329  SLHSDGDYLRIQDNSLHGAAATVDAATPENMRTLVGIGERMLAQRVSRVNVETGRYEPVP  388

Query  538  KAGTNKDAL  564
              G+N DAL
Sbjct  389  GEGSNADAL  397



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T D+ G   E+NLIDGGVAANNPT +A+  VT+ ++     +        + +   RF
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFFPI-----KPMDYRRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K    Y A++AA WGVLGWL+   G+PL+DVF  ASADMVD+H++++FQA
Sbjct  253  LVISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSSVFQA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L  S ASVD+ TK+NL+ L + G+ LL KPV K++L TG++    K
Sbjct  313  LHLEANYLRIQDDTLSDSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNAC-K  371

Query  541  AGTNKDALKRL  573
              TN++AL+R 
Sbjct  372  LETNEEALRRF  382



>ref|XP_008668146.1| PREDICTED: patatin T5 isoform X1 [Zea mays]
Length=407

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T    G   E++L+DGGVAANNPT++A+S +T+ ++ ++P +     ++        +
Sbjct  204  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF-----NAGRPTEYTNY  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG+  WL  G   P+ID+FS AS+DMVD H A +FQA
Sbjct  259  LIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+T+SVD+ TKEN+++L  +G+ LL KPV ++N+ TG  EP   
Sbjct  319  LHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSG  378

Query  541  AGTNKDALKRL  573
             GTN +AL   
Sbjct  379  EGTNAEALAHF  389



>gb|KJB58441.1| hypothetical protein B456_009G210000 [Gossypium raimondii]
Length=412

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 127/191 (66%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D KG   +YNLIDGGVAANNPTL+A+  V++ ++  +  +        + V   RF
Sbjct  198  FKTQDNKGNLKDYNLIDGGVAANNPTLVAMGEVSKAIINGNSDFFPI-----KPVDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ K   KY A +AA WGVL WL      PL+DVF+ AS DMVD+H++ +F+A
Sbjct  253  LVISLGTGSPKAEKKYNAAEAAKWGVLSWLTSEGSTPLVDVFTQASGDMVDFHLSVVFKA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + D YLRIQ+D L G  +SVD+ TK+NLD L +VG+ LL K V ++NL TG  +P  +
Sbjct  313  LHSSDKYLRIQDDGLSGDASSVDIATKKNLDELVKVGEGLLKKRVCRVNLETGMFQPFAQ  372

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  373  E-TNEEALKRF  382



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 134/191 (70%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D +    E+NLIDGG+AANNP L+AIS VT+++  K+P +        + +   RF
Sbjct  201  FENQDDQENNEEFNLIDGGLAANNPCLVAISEVTKQVFNKNPDFFPI-----KPMDYGRF  255

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K   KYTA+ AA WGVLGWL   +G+ L+     ASADMVD+H   +F+A
Sbjct  256  LVISVGTGSAKEEYKYTAKMAAKWGVLGWLYD-NGSTLLSPRVSASADMVDFHNCVVFEA  314

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L + +NYLRI +D LKG+ ASV++ TK+NLD+L ++G++LL KPV ++NL TGK EP+  
Sbjct  315  LHSEENYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKN  374

Query  541  AGTNKDALKRL  573
             GTN++AL R 
Sbjct  375  GGTNEEALIRF  385



>ref|XP_002869006.1| hypothetical protein ARALYDRAFT_490916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45265.1| hypothetical protein ARALYDRAFT_490916 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F   D++G K E+NLIDGG+AANNPTL AI+ VT++++ K+P     +      +   RF
Sbjct  207  FTNEDSEGKKHEFNLIDGGIAANNPTLCAIAEVTKQIIKKNP-----AMGDISPLDFTRF  261

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++SIGTG+ K  +KY A+ A+ WG++ W+ +    P++D +S A  DMVDY  + +FQA
Sbjct  262  LVISIGTGSIKNQEKYNAKMASKWGLICWIIENGSTPILDCYSEAIHDMVDYQSSVVFQA  321

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI +D LKG   SVD++T++N++ L EVG+ LL K V ++NL TG  +P+ +
Sbjct  322  LRSEKNYLRIDDDSLKGDLGSVDISTEKNMEGLVEVGEALLKKRVSRVNLETGHYQPISE  381

Query  541  AGTNKDALKRL  573
              TN++ALKR 
Sbjct  382  NVTNEEALKRF  392



>ref|XP_003611771.1| Patatin-like protein [Medicago truncatula]
 gb|AES94729.1| patatin-like phospholipase [Medicago truncatula]
Length=399

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 121/187 (65%), Gaps = 10/187 (5%)
 Frame = +1

Query  19   KGGKV--EYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILS  192
            + GKV  EYNLIDGGV ANNPT++AI  VT+ M+            S   +G  RF+++S
Sbjct  202  ENGKVIKEYNLIDGGVCANNPTMVAIREVTKNMI--------RLGRSGNGIGYDRFIVIS  253

Query  193  IGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAG  372
            IGTG++K   KY A+  A WG L WL      P+ID F+ AS DMVDYH + +F ALQ+ 
Sbjct  254  IGTGSNKSEQKYNAKMVAKWGALTWLFNSGSTPIIDCFNEASTDMVDYHNSVLFTALQSQ  313

Query  373  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTN  552
            DNYLRIQ+D L+G  ASVDV+TK NL+ L +VG+ LL K   ++NL TG  E VP  GT 
Sbjct  314  DNYLRIQDDTLQGELASVDVSTKNNLNNLVKVGENLLKKKFTRVNLDTGIYETVPDKGTI  373

Query  553  KDALKRL  573
            ++ LKR 
Sbjct  374  EEELKRF  380



>ref|XP_002463192.1| hypothetical protein SORBIDRAFT_02g039470 [Sorghum bicolor]
 gb|EER99713.1| hypothetical protein SORBIDRAFT_02g039470 [Sorghum bicolor]
Length=403

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 131/192 (68%), Gaps = 6/192 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   ++NLIDGGVAANNPT++ I+ +T++M+    +      +  +     +F
Sbjct  190  FQTKDDAGNTRDFNLIDGGVAANNPTMVTINQITRKMIVDKQEIFPGGPTDYD-----KF  244

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDG-NPLIDVFSVASADMVDYHIATIFQ  357
            L++SIGTG+ K A  YTA+ AA WG+L WL   +G  P++D+FS +SA +VDY+++ +FQ
Sbjct  245  LVISIGTGSGKGAATYTAKDAAGWGILSWLHTKEGYTPIVDMFSYSSAALVDYNVSILFQ  304

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            AL++  NYLRIQ+D LKG+ A+VDV T+EN+  L E+G+++L   V ++++ TGK   VP
Sbjct  305  ALRSEKNYLRIQDDSLKGTEATVDVATEENMKKLIEIGERMLATTVSRVDMETGKPVAVP  364

Query  538  KAGTNKDALKRL  573
            + GTN +AL R 
Sbjct  365  EEGTNAEALTRF  376



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 129/182 (71%), Gaps = 6/182 (3%)
 Frame = +1

Query  22   GGKVEY-NLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRFLILSIG  198
            GG+V + +LIDGGV ANNPTL+AIS VT+ +  ++P++  +     + +   RFL++S+G
Sbjct  205  GGEVRFFDLIDGGVVANNPTLVAISEVTKEISRRNPEFFKT-----KPLDYARFLVISLG  259

Query  199  TGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQALQAGDN  378
            TG++K  + Y+A+ AA WG++GWL     +PL++ F+  SADMVD+H + +FQAL + DN
Sbjct  260  TGSAKTQNTYSAKAAAGWGIIGWLYNKGNSPLVESFTQGSADMVDFHNSVVFQALNSEDN  319

Query  379  YLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPKAGTNKD  558
            YLRIQEDDL    ASVD++TKENL  L  +G++LL  PV ++N+ TG  EP+    TN++
Sbjct  320  YLRIQEDDLSNEAASVDISTKENLQNLVNIGQQLLKNPVSRVNVETGLFEPLKNQSTNEE  379

Query  559  AL  564
            AL
Sbjct  380  AL  381



>ref|XP_002460354.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor]
 gb|EER96875.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor]
Length=373

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T D  G   E++LIDGGVAANNP L+AI  VT+++  ++P +        + +   RF
Sbjct  198  FKTEDCHGNTKEFHLIDGGVAANNPALVAIGEVTKQIFKENPDFFPI-----KPMDYGRF  252

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K+   Y AQ+A +WGVLGWL      PL+D+F+ ASADMVD HI+ +F+A
Sbjct  253  LVISLGTGSAKFEANYNAQKAKSWGVLGWLLGSGSTPLVDIFTQASADMVDIHISAVFKA  312

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVG  471
            L +  NYLRIQ+D L+G+ +SVDV TKEN++ L  VG
Sbjct  313  LHSEQNYLRIQDDTLQGTLSSVDVATKENMEKLARVG  349



>tpg|DAA42306.1| TPA: patatin T5 [Zea mays]
Length=407

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T    G   E++L+DGGVAANNPT++A+S +T+ ++ ++P +     ++        +
Sbjct  204  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF-----NAGRPTEYTNY  258

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            LI+S+GTG++K A+KYTA Q A WG+  WL  G   P+ID+FS AS+DMVD H A +FQA
Sbjct  259  LIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQA  318

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L    NYLRIQ+D L G+T+SVD+ TKEN+++L  +G+ LL KPV ++N+ TG  EP   
Sbjct  319  LHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSG  378

Query  541  AGTNKDALKRL  573
             GTN +AL   
Sbjct  379  EGTNAEALAHF  389



>ref|XP_004148052.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004169209.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=394

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRM-VAKDPKYLTSSTSSKEAVGCHR  177
            F+  D+KG K  ++++DG VAANNPTL A++ V + M + K+   L      K      R
Sbjct  192  FEIKDSKGNKRRFDMVDGAVAANNPTLAAMTHVRKEMSIWKEKSELMPI---KPMETSKR  248

Query  178  FLILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQ  357
             LILS+GTG  K  +KY+A  ++ WG+LGW+      P+ID+FS ASADMVDYHIA+IFQ
Sbjct  249  MLILSLGTGAPKNEEKYSAAVSSKWGILGWIYHSGSTPIIDIFSDASADMVDYHIASIFQ  308

Query  358  ALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVP  537
            +     NYLRIQ+D L G  ASVDV T+ENL  L EVG+ LL K + ++NL +GK EP+ 
Sbjct  309  SEHHQKNYLRIQDDTLSGVVASVDVATEENLLKLIEVGEDLLKKQLSRVNLESGKFEPLD  368

Query  538  KAGTNKDAL  564
              GTN+DAL
Sbjct  369  GHGTNEDAL  377



>ref|XP_008339929.1| PREDICTED: patatin-like protein 1 isoform X2 [Malus domestica]
Length=368

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+  D +G   E+NLIDGG+AANNP+LIAIS V +++ +++  YL      K+     RF
Sbjct  183  FENKDQQGESKEFNLIDGGIAANNPSLIAISEVIKQITSQNQDYL--QIEPKDLY--DRF  238

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG+ +   KY A++A+ W V+ WL      PL+D F  A+ DMVDYH + +FQA
Sbjct  239  LLISLGTGSDRSELKYNAKKASKWNVISWLYTNGSTPLLDCFDEATCDMVDYHNSAVFQA  298

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L++  NYLRI ED L+G  ASVD  T+ENL+ L EVG KLL KPV ++NL T   EPV  
Sbjct  299  LRSEQNYLRIDEDTLEGDVASVDKATRENLENLVEVGNKLLKKPVCRVNLDTCLYEPVED  358

Query  541  AGTNKDALKR  570
             GTN++AL+R
Sbjct  359  EGTNEEALQR  368



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 136/191 (71%), Gaps = 6/191 (3%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F+T  + G   +++LIDGGVAANNP L+AIS VT+ +   +  +    ++        RF
Sbjct  199  FETKTSTGESRDFDLIDGGVAANNPALVAISEVTKEIHQGNSDFFAIRSTE-----YGRF  253

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L++S+GTG++K  +KY A  AA WG+LGWL +G  +PL+DVF+ AS+DMVD+H+AT+FQA
Sbjct  254  LVISLGTGSAKSEEKYDADDAAKWGLLGWLTKGGSSPLVDVFTQASSDMVDFHLATVFQA  313

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            L +  NYLRIQ+D L+ + +SVD+ T+ENL+ L +VG++LL KPV ++NL TG  EP  +
Sbjct  314  LDSEKNYLRIQDDTLEKTVSSVDIATQENLNNLVKVGEELLKKPVSRVNLQTGIYEPAHQ  373

Query  541  AGTNKDALKRL  573
              TN++AL R+
Sbjct  374  -DTNEEALVRV  383



>ref|XP_010320535.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=380

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = +1

Query  1    FDTADAKGGKVEYNLIDGGVAANNPTLIAISTVTQRMVAKDPKYLTSSTSSKEAVGCHRF  180
            F T +  G   E+NLIDG +AANNPTLIAI+  T+++  + P +           G  +F
Sbjct  170  FQTQNEDGKFHEFNLIDGAIAANNPTLIAINEATKQIFEQTPYFKNFKEMKPTNYG--KF  227

Query  181  LILSIGTGNSKYADKYTAQQAATWGVLGWLAQGDGNPLIDVFSVASADMVDYHIATIFQA  360
            L+LSIGTG++K   KY A+ A+ WG+ GWL  G  NP+ID F+ AS DMVDYHI+ +FQ+
Sbjct  228  LVLSIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVDYHISVVFQS  287

Query  361  LQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnllTGKNEPVPK  540
            + +  +YLRIQ+D L G+ ++VD++TKEN++ L E+G  LL KPV ++NL TG  E + K
Sbjct  288  VHSQKHYLRIQDDTLSGADSTVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEQLNK  347

Query  541  -AGTNKDALKRL  573
              GTN++ALK  
Sbjct  348  DGGTNEEALKEF  359



Lambda      K        H        a         alpha
   0.312    0.130    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750