BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006E03 657 bp,

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        223   2e-71   Nicotiana tomentosiformis
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        221   1e-69   Nicotiana tomentosiformis
gb|KHG27160.1|  Pollen-specific SF3                                     221   1e-69   Gossypium arboreum [tree cotton]
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         222   1e-69   Jatropha curcas
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    221   2e-69   Malus domestica [apple tree]
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    222   2e-69   Vitis vinifera
gb|KJB78800.1|  hypothetical protein B456_013G019800                    221   2e-69   Gossypium raimondii
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        221   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        221   3e-69   Malus domestica [apple tree]
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    218   3e-69   Sesamum indicum [beniseed]
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    220   4e-69   Theobroma cacao [chocolate]
gb|ACX47456.1|  LIM1                                                    221   5e-69   Hevea brasiliensis [Para rubber tree]
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             221   5e-69   Prunus persica
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        220   5e-69   Cucumis sativus [cucumbers]
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    220   8e-69   Theobroma cacao [chocolate]
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             220   9e-69   Citrus clementina
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    220   1e-68   Theobroma cacao [chocolate]
gb|KJB67594.1|  hypothetical protein B456_010G199200                    217   1e-68   Gossypium raimondii
ref|XP_004307607.1|  PREDICTED: LIM domain-containing protein WLIM2b    219   1e-68   Fragaria vesca subsp. vesca
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              219   1e-68   Ricinus communis
gb|AGJ83945.1|  lim protein 5                                           216   2e-68   Gossypium hirsutum [American cotton]
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             219   2e-68   Eucalyptus grandis [rose gum]
ref|XP_002315180.1|  LIM domain-containing family protein               219   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    216   4e-68   Malus domestica [apple tree]
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    216   4e-68   Solanum lycopersicum
gb|ABK58469.1|  LIM domain protein WLIM2a                               218   5e-68   Populus tremula x Populus alba [gray poplar]
ref|XP_002312139.1|  LIM domain-containing family protein               218   6e-68   Populus trichocarpa [western balsam poplar]
gb|KHG07853.1|  Pollen-specific SF3                                     214   7e-68   Gossypium arboreum [tree cotton]
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    218   9e-68   Nelumbo nucifera [Indian lotus]
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    217   2e-67   
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    216   3e-67   Populus euphratica
ref|NP_001241110.1|  uncharacterized protein LOC100809121               216   5e-67   Glycine max [soybeans]
ref|XP_010093495.1|  Pollen-specific protein SF3                        216   6e-67   Morus notabilis
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             215   1e-66   Phaseolus vulgaris [French bean]
gb|ABK94608.1|  unknown                                                 214   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          214   2e-66   
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    214   3e-66   Cucumis sativus [cucumbers]
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    211   3e-66   Theobroma cacao [chocolate]
gb|KHN17859.1|  Pollen-specific protein SF3                             213   5e-66   Glycine soja [wild soybean]
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    213   5e-66   
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        213   6e-66   Cucumis melo [Oriental melon]
gb|AFK39062.1|  unknown                                                 213   6e-66   Lotus japonicus
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    213   9e-66   Elaeis guineensis
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        211   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL38006.1|AF443117_1  LIM domain protein                            205   4e-65   Gossypium hirsutum [American cotton]
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    210   7e-65   
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                210   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        209   2e-64   Phoenix dactylifera
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    209   3e-64   Glycine max [soybeans]
gb|AGJ83942.1|  lim protein 2                                           206   8e-64   Gossypium hirsutum [American cotton]
gb|KJB74201.1|  hypothetical protein B456_011G279100                    206   9e-64   Gossypium raimondii
ref|XP_003600847.1|  LIM domain-containing protein                      206   9e-64   Medicago truncatula
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        207   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK34184.1|  unknown                                                 206   1e-63   Medicago truncatula
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    202   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    197   2e-62   Tarenaya hassleriana [spider flower]
gb|EPS58831.1|  hypothetical protein M569_15983                         198   4e-62   Genlisea aurea
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        203   5e-62   Phoenix dactylifera
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             196   1e-61   Eutrema salsugineum
emb|CAA62744.1|  transcription factor L2                                198   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               198   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876333.1|  LIM domain-containing protein                      198   2e-61   Arabidopsis lyrata subsp. lyrata
gb|ACU17588.1|  unknown                                                 200   2e-61   Glycine max [soybeans]
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    201   2e-61   Elaeis guineensis
gb|ABK22125.1|  unknown                                                 201   4e-61   Picea sitchensis
emb|CDY02959.1|  BnaC04g25270D                                          194   7e-61   Brassica napus [oilseed rape]
emb|CDX76073.1|  BnaA04g03370D                                          194   9e-61   Brassica napus [oilseed rape]
dbj|BAH20111.1|  AT3G55770                                              198   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010321447.1|  PREDICTED: LIM domain-containing protein WLI...    198   1e-60   Solanum lycopersicum
emb|CDY60999.1|  BnaA03g56620D                                          194   2e-60   Brassica napus [oilseed rape]
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    194   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        194   2e-60   Brassica rapa
emb|CDY24943.1|  BnaC03g22290D                                          194   2e-60   Brassica napus [oilseed rape]
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    194   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        192   4e-60   Brassica rapa
emb|CDY20498.1|  BnaC04g05460D                                          194   4e-60   Brassica napus [oilseed rape]
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             194   7e-60   Brassica rapa
emb|CDP14069.1|  unnamed protein product                                190   7e-60   Coffea canephora [robusta coffee]
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    192   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             189   1e-59   Capsella rubella
dbj|BAM13339.1|  LIM domain-containing protein                          197   1e-59   Oryza officinalis
dbj|BAM13338.1|  LIM domain-containing protein                          197   1e-59   Oryza punctata
ref|XP_002879831.1|  LIM domain-containing protein                      188   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             192   2e-59   Eutrema salsugineum
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        196   3e-59   Oryza brachyantha
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    187   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    187   5e-59   Camelina sativa [gold-of-pleasure]
emb|CDX72203.1|  BnaC08g26710D                                          188   6e-59   Brassica napus [oilseed rape]
emb|CDY27267.1|  BnaA09g35350D                                          188   6e-59   Brassica napus [oilseed rape]
dbj|BAM13341.1|  LIM domain-containing protein                          195   6e-59   Oryza australiensis
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             187   7e-59   Brassica rapa
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    186   7e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001049655.1|  Os03g0266100                                       194   1e-58   
dbj|BAM13335.1|  LIM domain-containing protein                          194   2e-58   Oryza nivara
ref|NP_181519.1|  protein WLIM2A                                        185   3e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CBL95262.1|  lim domain protein                                     192   7e-58   Pinus pinaster [cluster pine]
dbj|BAM13340.1|  LIM domain-containing protein                          192   2e-57   Oryza latifolia
ref|XP_006291889.1|  hypothetical protein CARUB_v10018065mg             188   2e-56   Capsella rubella
ref|NP_001190099.1|  actin bundler LIM family protein WLIM2b            180   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KCW65632.1|  hypothetical protein EUGRSUZ_G03023                     186   6e-56   Eucalyptus grandis [rose gum]
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          187   8e-56   Amborella trichopoda
ref|NP_001147673.1|  pollen-specific protein SF3                        187   1e-55   Zea mays [maize]
ref|XP_009772727.1|  PREDICTED: pollen-specific protein SF3-like        174   1e-55   Nicotiana sylvestris
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        187   2e-55   Setaria italica
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          186   4e-55   Sorghum bicolor [broomcorn]
emb|CBI40313.3|  unnamed protein product                                183   3e-54   Vitis vinifera
ref|XP_003600848.1|  LIM domain-containing protein                      181   4e-54   Medicago truncatula
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    183   5e-54   Vitis vinifera
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    181   2e-53   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             169   6e-53   Capsella rubella
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    177   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    178   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    174   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        176   2e-51   Solanum tuberosum [potatoes]
ref|XP_006438563.1|  hypothetical protein CICLE_v10033840mg             174   6e-51   Citrus clementina
gb|KDO39245.1|  hypothetical protein CISIN_1g040725mg                   174   6e-51   Citrus sinensis [Valencia orange]
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        174   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT19855.1|  Pollen-specific protein SF3                             174   2e-50   Aegilops tauschii
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        173   2e-50   Phoenix dactylifera
ref|NP_001288583.1|  uncharacterized protein LOC101266456               172   2e-50   Solanum lycopersicum
ref|XP_011469034.1|  PREDICTED: LIM domain-containing protein PLI...    174   2e-50   Fragaria vesca subsp. vesca
ref|XP_004306805.1|  PREDICTED: LIM domain-containing protein PLI...    174   3e-50   Fragaria vesca subsp. vesca
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    172   3e-50   Elaeis guineensis
gb|AAK49580.1|AF370574_1  transcription factor L2                       171   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        171   5e-50   Nicotiana sylvestris
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    170   6e-50   Nicotiana tomentosiformis
emb|CDX71757.1|  BnaC08g31170D                                          172   7e-50   Brassica napus [oilseed rape]
ref|XP_010089139.1|  Pollen-specific protein SF3                        166   2e-49   Morus notabilis
ref|NP_001154680.1|  actin bundler LIM family protein WLIM2b            158   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             171   2e-49   Prunus mume [ume]
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        169   3e-49   Phoenix dactylifera
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    171   4e-49   Sesamum indicum [beniseed]
emb|CDY56926.1|  BnaAnng14450D                                          171   4e-49   Brassica napus [oilseed rape]
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        168   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        170   4e-49   Nicotiana sylvestris
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        168   5e-49   Nicotiana sylvestris
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        171   5e-49   Malus domestica [apple tree]
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        171   5e-49   Malus domestica [apple tree]
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    167   6e-49   Nicotiana tomentosiformis
ref|XP_002882034.1|  LIM domain-containing protein                      171   6e-49   Arabidopsis lyrata subsp. lyrata
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    171   7e-49   Arabis alpina [alpine rockcress]
ref|NP_182104.1|  protein PLIM2A                                        170   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        167   9e-49   Nicotiana tomentosiformis
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    167   1e-48   Elaeis guineensis
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    169   2e-48   Brassica rapa
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             169   2e-48   Eutrema salsugineum
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    163   2e-48   Solanum lycopersicum
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             169   2e-48   Brassica rapa
ref|XP_006431569.1|  hypothetical protein CICLE_v10003359mg             160   2e-48   Citrus clementina
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        163   2e-48   Solanum tuberosum [potatoes]
emb|CDP08845.1|  unnamed protein product                                168   2e-48   Coffea canephora [robusta coffee]
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    167   3e-48   Nicotiana tomentosiformis
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    167   3e-48   Nicotiana tomentosiformis
gb|EPS71497.1|  hypothetical protein M569_03263                         168   3e-48   Genlisea aurea
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        164   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        166   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    166   7e-48   Solanum lycopersicum
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             167   8e-48   Eutrema salsugineum
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             164   1e-47   Selaginella moellendorffii
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    167   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        164   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006431570.1|  hypothetical protein CICLE_v10003747mg             157   2e-47   Citrus clementina
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    166   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    164   3e-47   Vitis vinifera
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    165   3e-47   Populus euphratica
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    166   3e-47   Tarenaya hassleriana [spider flower]
ref|NP_171683.1|  LIM family protein                                    165   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    166   4e-47   Brassica rapa
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        160   4e-47   Malus domestica [apple tree]
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    167   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    165   5e-47   Camelina sativa [gold-of-pleasure]
gb|ABL74496.1|  LIM domain protein PLIM2b                               164   6e-47   Populus tremula x Populus alba [gray poplar]
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                164   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_009118149.1|  PREDICTED: pollen-specific protein SF3-like        147   1e-46   Brassica rapa
ref|XP_002302574.1|  LIM domain-containing family protein               164   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_003623892.1|  LIM domain protein 2b                              161   1e-46   Medicago truncatula
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        158   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        159   1e-46   Oryza brachyantha
ref|NP_001047550.1|  Os02g0641000                                       159   1e-46   
ref|NP_001140551.1|  uncharacterized LOC100272616                       164   2e-46   Zea mays [maize]
ref|NP_001132843.1|  uncharacterized LOC100194335                       164   2e-46   Zea mays [maize]
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    164   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002892043.1|  LIM domain-containing protein                      163   2e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    162   2e-46   Cucumis melo [Oriental melon]
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        162   2e-46   
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             164   2e-46   Capsella rubella
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    164   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    162   2e-46   
ref|XP_010107618.1|  Pollen-specific protein SF3                        163   3e-46   Morus notabilis
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    164   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    164   3e-46   Tarenaya hassleriana [spider flower]
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    160   3e-46   Setaria italica
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    161   3e-46   Sesamum indicum [beniseed]
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       160   4e-46   Cucumis sativus [cucumbers]
gb|EMT25782.1|  Pollen-specific protein SF3                             159   4e-46   Aegilops tauschii
ref|XP_001765937.1|  predicted protein                                  157   4e-46   Physcomitrella patens
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        157   5e-46   Malus domestica [apple tree]
dbj|BAK04207.1|  predicted protein                                      159   5e-46   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             162   5e-46   Capsella rubella
gb|EPS59684.1|  hypothetical protein M569_15118                         160   5e-46   Genlisea aurea
gb|ACN26203.1|  unknown                                                 156   6e-46   Zea mays [maize]
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    162   7e-46   Tarenaya hassleriana [spider flower]
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             162   7e-46   Prunus persica
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                161   8e-46   Erythranthe guttata [common monkey flower]
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         158   9e-46   Jatropha curcas
emb|CDY18899.1|  BnaC04g04510D                                          162   9e-46   Brassica napus [oilseed rape]
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        162   9e-46   Brassica rapa
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          157   1e-45   Sorghum bicolor [broomcorn]
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    156   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    161   1e-45   Populus euphratica
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        155   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    162   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             161   1e-45   Eutrema salsugineum
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    159   2e-45   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ABK58466.1|  LIM domain protein PLIM2a                               161   2e-45   Populus tremula x Populus alba [gray poplar]
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    161   2e-45   Medicago truncatula
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        161   2e-45   Eucalyptus grandis [rose gum]
ref|XP_010054850.1|  PREDICTED: pollen-specific protein SF3-like        161   2e-45   Eucalyptus grandis [rose gum]
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    161   3e-45   Camelina sativa [gold-of-pleasure]
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    161   3e-45   Arabis alpina [alpine rockcress]
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    161   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_001771340.1|  predicted protein                                  153   3e-45   Physcomitrella patens
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        155   4e-45   Eucalyptus grandis [rose gum]
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    154   4e-45   Zea mays [maize]
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    159   4e-45   Theobroma cacao [chocolate]
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        160   4e-45   Cucumis sativus [cucumbers]
ref|XP_002878372.1|  LIM domain-containing protein                      160   4e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_009340168.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    159   4e-45   Pyrus x bretschneideri [bai li]
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    156   5e-45   Populus euphratica
ref|XP_002320783.2|  LIM domain-containing family protein               160   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        155   5e-45   Setaria italica
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        157   5e-45   Oryza brachyantha
ref|NP_001053405.1|  Os04g0532500                                       156   5e-45   
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        159   6e-45   Citrus sinensis [Valencia orange]
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              157   1e-44   Ricinus communis
emb|CDY27358.1|  BnaC04g50470D                                          159   1e-44   Brassica napus [oilseed rape]
gb|KHN29376.1|  Pollen-specific protein SF3                             157   2e-44   Glycine soja [wild soybean]
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             157   2e-44   Selaginella moellendorffii
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        157   2e-44   Glycine max [soybeans]
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    156   2e-44   Brachypodium distachyon [annual false brome]
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             159   2e-44   Capsella rubella
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        159   2e-44   Brassica rapa
emb|CDY37066.1|  BnaA04g26440D                                          159   2e-44   Brassica napus [oilseed rape]
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             158   2e-44   Phaseolus vulgaris [French bean]
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              155   2e-44   Ricinus communis
gb|ABK22236.1|  unknown                                                 154   3e-44   Picea sitchensis
emb|CDY38028.1|  BnaCnng08890D                                          158   3e-44   Brassica napus [oilseed rape]
gb|KJB52067.1|  hypothetical protein B456_008G245300                    158   3e-44   Gossypium raimondii
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             153   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        156   3e-44   Glycine max [soybeans]
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             157   4e-44   Brassica rapa
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    158   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    157   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        157   4e-44   Brassica rapa
emb|CDY15152.1|  BnaC05g00310D                                          157   4e-44   Brassica napus [oilseed rape]
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          154   5e-44   Sorghum bicolor [broomcorn]
gb|AFK33321.1|  unknown                                                 155   5e-44   Lotus japonicus
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    157   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    157   6e-44   Camelina sativa [gold-of-pleasure]
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    157   7e-44   Arabis alpina [alpine rockcress]
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    152   7e-44   Theobroma cacao [chocolate]
emb|CDY01571.1|  BnaC07g35610D                                          157   7e-44   Brassica napus [oilseed rape]
gb|KDP28657.1|  hypothetical protein JCGZ_14428                         156   7e-44   Jatropha curcas
gb|KJB25793.1|  hypothetical protein B456_004G209700                    152   8e-44   Gossypium raimondii
dbj|BAK06966.1|  predicted protein                                      151   8e-44   Hordeum vulgare subsp. vulgare [barley]
gb|ABK23670.1|  unknown                                                 154   8e-44   Picea sitchensis
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        151   9e-44   Citrus sinensis [Valencia orange]
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             155   1e-43   Selaginella moellendorffii
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    152   1e-43   Populus euphratica
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             150   1e-43   Glycine max [soybeans]
gb|ACA33841.1|  LIM2 transcription factor                               155   1e-43   Pinus pinaster [cluster pine]
gb|KHG24611.1|  Pollen-specific SF3                                     156   1e-43   Gossypium arboreum [tree cotton]
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        156   1e-43   Cicer arietinum [garbanzo]
gb|KJB41286.1|  hypothetical protein B456_007G097400                    156   1e-43   Gossypium raimondii
gb|AGJ83944.1|  lim protein 4                                           156   1e-43   Gossypium hirsutum [American cotton]
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        150   1e-43   Prunus mume [ume]
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             150   1e-43   Prunus persica
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             154   2e-43   Phaseolus vulgaris [French bean]
ref|XP_011080992.1|  PREDICTED: LIM domain-containing protein WLI...    151   2e-43   Sesamum indicum [beniseed]
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             153   2e-43   
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    155   2e-43   
gb|KHG00940.1|  Pollen-specific SF3                                     155   3e-43   
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        155   3e-43   
gb|AII80545.1|  LIM-domain protein 11                                   155   3e-43   
gb|KHG24101.1|  Pollen-specific SF3                                     155   4e-43   
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   149   6e-43   
gb|KJB24709.1|  hypothetical protein B456_004G157300                    154   6e-43   
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             150   7e-43   
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    150   8e-43   
ref|XP_004492709.1|  PREDICTED: pollen-specific protein SF3-like        151   1e-42   
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        153   1e-42   
gb|EPS67160.1|  hypothetical protein M569_07616                         147   1e-42   
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        153   2e-42   
gb|KHG08337.1|  Pollen-specific SF3                                     147   2e-42   
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        152   2e-42   
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        147   2e-42   
gb|EMS55690.1|  Pollen-specific protein SF3                             145   2e-42   
emb|CDP17006.1|  unnamed protein product                                152   2e-42   
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    152   3e-42   
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        150   3e-42   
tpg|DAA44554.1|  TPA: putative LIM-type zinc finger domain family...    149   4e-42   
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    152   4e-42   
ref|NP_001237551.1|  uncharacterized protein LOC100305845               150   4e-42   
ref|XP_009785548.1|  PREDICTED: pollen-specific protein SF3-like        145   4e-42   
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    152   4e-42   
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         152   4e-42   
emb|CAB71053.1|  LIM domain protein                                     152   4e-42   
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    151   5e-42   
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    151   5e-42   
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     151   6e-42   
ref|XP_011072367.1|  PREDICTED: LIM domain-containing protein WLI...    146   7e-42   
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             151   7e-42   
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     144   8e-42   
ref|XP_004976340.1|  PREDICTED: pollen-specific protein SF3-like ...    145   1e-41   
gb|ACU13968.1|  unknown                                                 145   1e-41   
gb|KJB22346.1|  hypothetical protein B456_004G042300                    150   1e-41   
gb|EYU29736.1|  hypothetical protein MIMGU_mgv1a014022mg                148   1e-41   
gb|KHN19331.1|  Pollen-specific protein SF3                             149   1e-41   
gb|AGJ83943.1|  lim protein 3                                           147   1e-41   
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    150   2e-41   
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             149   2e-41   
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    150   2e-41   
gb|KHN16307.1|  Pollen-specific protein SF3                             148   2e-41   
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             150   2e-41   
ref|NP_001238190.1|  uncharacterized protein LOC100500444               148   2e-41   
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     150   2e-41   
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        149   3e-41   
ref|XP_009628860.1|  PREDICTED: pollen-specific protein SF3-like        143   3e-41   
ref|XP_011463839.1|  PREDICTED: LIM domain-containing protein WLI...    139   3e-41   
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             143   3e-41   
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          149   3e-41   
gb|ABK94586.1|  unknown                                                 149   4e-41   
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              149   4e-41   
ref|NP_001064995.1|  Os10g0503100                                       146   4e-41   
gb|EAY79118.1|  hypothetical protein OsI_34224                          146   4e-41   
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        149   4e-41   
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        146   4e-41   
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    149   4e-41   
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    149   5e-41   
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    149   5e-41   
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        149   5e-41   
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             149   5e-41   
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        145   6e-41   
ref|NP_001031545.1|  protein PLIM2A                                     149   6e-41   
gb|ABK58465.1|  LIM domain protein GLIM1b                               149   7e-41   
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             147   7e-41   
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             148   7e-41   
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        144   8e-41   
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        143   8e-41   
ref|XP_004299580.1|  PREDICTED: LIM domain-containing protein WLI...    148   8e-41   
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    147   9e-41   
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     148   9e-41   
gb|KHG14633.1|  Pollen-specific SF3                                     148   1e-40   
gb|AII80542.1|  LIM-domain protein 8                                    148   1e-40   
emb|CDY68273.1|  BnaAnng26690D                                          147   1e-40   
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        147   1e-40   
ref|XP_011029229.1|  PREDICTED: LIM domain-containing protein WLI...    141   1e-40   
emb|CDX95666.1|  BnaC03g25470D                                          147   1e-40   
gb|EEC80296.1|  hypothetical protein OsI_22314                          149   1e-40   
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        143   1e-40   
ref|NP_001235271.1|  uncharacterized protein LOC100500501               145   1e-40   
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     147   1e-40   
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    147   1e-40   
ref|XP_006352311.1|  PREDICTED: pollen-specific protein SF3-like        142   2e-40   
gb|KHN04435.1|  Pollen-specific protein SF3                             148   2e-40   
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    148   2e-40   
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    147   2e-40   
ref|XP_010111544.1|  Pollen-specific protein SF3                        147   2e-40   
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     147   2e-40   
ref|XP_009133751.1|  PREDICTED: pollen-specific protein SF3-like        145   2e-40   
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    147   2e-40   
gb|KJB32232.1|  hypothetical protein B456_005G230900                    147   3e-40   
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        147   3e-40   
ref|NP_001238580.1|  uncharacterized protein LOC100499957               147   4e-40   
ref|NP_001235758.1|  uncharacterized protein LOC100305720               147   4e-40   
tpg|DAA44552.1|  TPA: putative LIM-type zinc finger domain family...    142   4e-40   
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        147   6e-40   
gb|ABK58464.1|  LIM domain protein GLIM1a                               146   6e-40   
gb|ABK95336.1|  unknown                                                 146   6e-40   
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             146   6e-40   
ref|NP_001237652.1|  uncharacterized protein LOC100527547               146   6e-40   
gb|AGJ83946.1|  lim protein 6                                           146   7e-40   
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    146   7e-40   
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    144   7e-40   
gb|KJB32231.1|  hypothetical protein B456_005G230900                    146   8e-40   
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             146   8e-40   
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    135   1e-39   
gb|KDO39276.1|  hypothetical protein CISIN_1g042895mg                   130   1e-39   
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    145   1e-39   
gb|ABL74498.1|  LIM domain protein BLIM2b                               143   1e-39   
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     145   2e-39   
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        144   2e-39   
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             145   2e-39   
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             145   2e-39   
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        145   2e-39   
ref|XP_010227809.1|  PREDICTED: enolase-phosphatase E1-like             144   2e-39   
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        145   3e-39   
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             144   3e-39   
gb|EYU38365.1|  hypothetical protein MIMGU_mgv1a014348mg                137   3e-39   
dbj|BAJ86406.1|  predicted protein                                      141   3e-39   
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        143   3e-39   
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    145   3e-39   
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        144   3e-39   
gb|KHN36972.1|  Pollen-specific protein SF3                             144   3e-39   
ref|NP_001238429.1|  uncharacterized protein LOC100499947               144   3e-39   
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        144   3e-39   
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        144   4e-39   
ref|NP_001057248.1|  Os06g0237300                                       145   4e-39   
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     144   4e-39   
ref|XP_006431571.1|  hypothetical protein CICLE_v10003160mg             129   4e-39   
ref|NP_001104937.2|  LOC541782                                          144   4e-39   
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        144   4e-39   
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        143   4e-39   
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     144   4e-39   
emb|CDP09772.1|  unnamed protein product                                137   4e-39   
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        144   5e-39   
ref|XP_004965094.1|  PREDICTED: microtubule-associated protein fu...    144   5e-39   
gb|ABY21316.1|  LIM1                                                    144   5e-39   
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        143   5e-39   
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        143   5e-39   
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          144   5e-39   
dbj|BAM05589.1|  LIM transcription factor                               143   5e-39   
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             144   5e-39   
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        144   6e-39   
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    143   6e-39   
dbj|BAB84584.1|  transcription factor LIM                               144   6e-39   
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             143   6e-39   
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        144   6e-39   
gb|AFK42495.1|  unknown                                                 144   6e-39   
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    142   6e-39   
gb|AFK47041.1|  unknown                                                 144   6e-39   
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                143   7e-39   
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                142   7e-39   
gb|KJB77631.1|  hypothetical protein B456_012G147400                    144   7e-39   
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                143   7e-39   
ref|XP_003589058.1|  Transcription factor lim1                          144   7e-39   
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    144   7e-39   
gb|AII80541.1|  LIM-domain protein 7                                    144   8e-39   
ref|XP_010676493.1|  PREDICTED: LIM domain-containing protein WLI...    137   8e-39   
gb|ABW69660.1|  transcription factor LIM                                143   8e-39   
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    143   9e-39   
gb|ACG34183.1|  pollen-specific protein SF3                             143   9e-39   
ref|XP_011469035.1|  PREDICTED: LIM domain-containing protein PLI...    136   1e-38   
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        143   1e-38   
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    143   1e-38   
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     142   1e-38   
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    143   1e-38   
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   140   1e-38   
gb|AAF75284.1|AF116850_1  LIM domain protein PLIM-2                     144   1e-38   
ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        140   1e-38   
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             141   1e-38   
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      143   1e-38   
gb|KDO36535.1|  hypothetical protein CISIN_1g034188mg                   121   1e-38   
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             141   1e-38   
emb|CDP01275.1|  unnamed protein product                                142   1e-38   
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                142   1e-38   
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        142   2e-38   
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             142   2e-38   
dbj|BAM05591.1|  LIM transcription factor                               141   2e-38   
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        142   2e-38   
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        142   2e-38   
ref|NP_001148027.1|  pollen-specific protein SF3                        142   2e-38   
dbj|BAJ94823.1|  predicted protein                                      142   2e-38   
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   140   2e-38   
ref|XP_004290976.1|  PREDICTED: LIM domain-containing protein WLIM1     142   2e-38   
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        142   2e-38   
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        142   3e-38   
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        140   3e-38   
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        142   3e-38   
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    142   3e-38   
emb|CDO97286.1|  unnamed protein product                                140   3e-38   
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       139   3e-38   
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        140   3e-38   
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        142   3e-38   
ref|XP_010094354.1|  Pollen-specific protein SF3                        142   3e-38   
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              141   4e-38   
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        141   4e-38   
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    141   4e-38   
ref|NP_172491.1|  transcription factor lim1                             141   4e-38   
ref|XP_009389653.1|  PREDICTED: pollen-specific protein SF3-like        141   4e-38   
emb|CDY20647.1|  BnaC08g14110D                                          141   4e-38   
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        141   4e-38   
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             141   5e-38   
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     141   5e-38   
ref|XP_004245622.1|  PREDICTED: LIM domain-containing protein WLI...    139   5e-38   
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    141   5e-38   
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        141   5e-38   
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         141   6e-38   
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             140   6e-38   
emb|CDX94916.1|  BnaC05g07550D                                          140   6e-38   
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        140   6e-38   
gb|KHG06745.1|  Pollen-specific protein SF3                             138   7e-38   
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          139   7e-38   
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        140   8e-38   
ref|XP_011457848.1|  PREDICTED: LIM domain-containing protein WLI...    139   8e-38   
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        139   9e-38   
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    140   9e-38   
gb|KJB52068.1|  hypothetical protein B456_008G245300                    140   1e-37   
dbj|BAB84581.1|  transcription factor LIM                               139   1e-37   
dbj|BAA82827.1|  transcription factor Ntlim1                            140   1e-37   



>ref|XP_009602682.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009602683.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009786370.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tabacum]
 emb|CAA71891.1| LIM-domain SF3 protein [Nicotiana tabacum]
Length=189

 Score =   223 bits (569),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSN+SSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLSNFSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVENQSYHK+CFKCSHGGCSL+PS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVENQSYHKTCFKCSHGGCSLSPS  145


 Score = 73.6 bits (179),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVELLSADG+NYHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVNYHKSCF  35


 Score = 58.9 bits (141),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   +L  SNY+++ G+LYCKPHF QLFKE G++N
Sbjct  131  TCFKCSHGGCSLSPSNYAALNGILYCKPHFSQLFKEKGSYN  171


 Score = 39.3 bits (90),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +  +YHK+  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKTCF  133


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +  +YHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVNYHKSCFKCSH  39



>ref|XP_009587504.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   221 bits (563),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQL+KESGNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLYKESGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATC KTAYPLEKVTVENQSYHKSCFKCSHGGCSL PS
Sbjct  93   SPSKAARMFSGTQEKCATCDKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPS  145


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCF  35


 Score = 61.2 bits (147),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N
Sbjct  131  SCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSYN  171


 Score = 41.6 bits (96),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C+KT YP+E ++ +  +YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCDKTAYPLEKVTVENQSYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTH  39



>gb|KHG27160.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   221 bits (564),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL NYSSMEGV+YCKPHFEQLFKESGNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLGNYSSMEGVVYCKPHFEQLFKESGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPITPS  145


 Score = 68.9 bits (167),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADGI YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGIPYHKSCF  35


 Score = 57.8 bits (138),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 44.3 bits (103),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSH  39



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   222 bits (565),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPS  145


 Score = 68.9 bits (167),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADGI+YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGISYHKSCF  35


 Score = 59.7 bits (143),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY+++EGVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAASMPE  188


 Score = 40.8 bits (94),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFH  39



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   221 bits (563),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 68.9 bits (167),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 39.7 bits (91),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKC+H
Sbjct  3    FIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTH  39



>ref|XP_002279922.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 ref|XP_010658484.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 emb|CAN81425.1| hypothetical protein VITISV_014590 [Vitis vinifera]
 emb|CBI31546.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHC GTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA+KLT
Sbjct  28   VVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  88   PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPISPS  145


 Score = 56.6 bits (135),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  176


 Score = 40.4 bits (93),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC KTVYPVE LSADG+ YHKS  
Sbjct  1    MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCF  35


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSH  39



>gb|KJB78800.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
 gb|KJB78801.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
 gb|KJB78802.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
Length=189

 Score =   221 bits (562),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL NYSSMEGV+YCKPHFEQLFKESGNFNKNFQSPA+SA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLGNYSSMEGVVYCKPHFEQLFKESGNFNKNFQSPARSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPITPS  145


 Score = 68.9 bits (167),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADGI YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGIPYHKSCF  35


 Score = 58.2 bits (139),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 44.3 bits (103),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSH  39



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   221 bits (562),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 39.7 bits (91),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKC+H
Sbjct  3    FIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTH  39



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   221 bits (562),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 39.7 bits (91),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKC+H
Sbjct  3    FIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTH  39



>ref|XP_011076748.1| PREDICTED: LIM domain-containing protein WLIM2b [Sesamum indicum]
Length=189

 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G+F+KNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGSFSKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE+QSYHKSCFKCSHGGCSLTPS
Sbjct  93   SPSKAAGMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCSLTPS  145


 Score = 71.2 bits (173),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVSYHKSCF  35


 Score = 63.2 bits (152),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S + K A  + P+
Sbjct  131  SCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKSASMKRATTVVPD  188


 Score = 39.3 bits (90),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVESQSYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSH  39



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   220 bits (561),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPS  145


 Score = 68.6 bits (166),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCF  35


 Score = 57.8 bits (138),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 44.3 bits (103),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSH  39



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   221 bits (562),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPS  145


 Score = 58.5 bits (140),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH   +L  SNY+++EGVLYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYN  171


 Score = 40.4 bits (93),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCF  35


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFH  39



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   ACFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 40.4 bits (93),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADG++YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGVSYHKACF  35


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHK+CFKC+H
Sbjct  3    FIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTH  39



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   220 bits (560),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQ+KCATCGKT YPLEKVTVE+QSYHKSCFKCSHGGC+L+PS
Sbjct  93   SPSKAAGMFSGTQDKCATCGKTVYPLEKVTVESQSYHKSCFKCSHGGCALSPS  145


 Score = 68.6 bits (166),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADG++YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCF  35


 Score = 57.8 bits (138),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 40.8 bits (94),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCATCGKTVYPLEKVTVESQSYHKSCF  133


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSH  39



>ref|XP_007009110.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
 gb|EOY17920.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
Length=182

 Score =   220 bits (561),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  26   SCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  85

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++PS
Sbjct  86   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPS  138


 Score = 58.2 bits (139),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  124  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  181


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  85   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  126


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  211  QKCKACEKTVYPVELLSADGINYHKSVL  294
            QKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    QKCKACEKTVYPVELLSADGVPYHKSCF  28



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   220 bits (561),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA+KLT
Sbjct  28   VVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAASMFSGTQEKCA+C KT YPLEKV VENQ+YHK+CFKCSHGGCS++PS
Sbjct  88   PELTRSPSKAASMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISPS  145


 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCK CEKTVYPVE LSADG+ YHKS  
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCF  35


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            +CF+CSH   ++  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  TCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMKRAAASVPE  188


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSH  39



>ref|XP_007009107.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY17917.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
Length=191

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  35   SCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  94

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++PS
Sbjct  95   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPS  147


 Score = 58.2 bits (139),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  133  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  190


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  94   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  135


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  211  QKCKACEKTVYPVELLSADGINYHKSVL  294
            +KCKACEKTVYPVELLSADG+ YHKS  
Sbjct  10   KKCKACEKTVYPVELLSADGVPYHKSCF  37



>gb|KJB67594.1| hypothetical protein B456_010G199200 [Gossypium raimondii]
Length=189

 Score =   217 bits (552),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL+NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQS AK+A+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLANYSSMEGVLYCKPHFEQLFKETGNFNKNFQSSAKAAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGT EKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPS  145


 Score = 70.5 bits (171),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCF  35


 Score = 59.7 bits (143),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 40.8 bits (94),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSH  39



>ref|XP_004307607.1| PREDICTED: LIM domain-containing protein WLIM2b [Fragaria vesca 
subsp. vesca]
Length=200

 Score =   219 bits (559),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPE+TR
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPEMTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 67.4 bits (163),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC+KTVYPVE LSADGI+YHKS  
Sbjct  1    MSFIGTQQKCKACQKTVYPVEELSADGISYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 39.3 bits (90),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKC+H
Sbjct  3    FIGTQQKCKACQKTVYPVEELSADGISYHKSCFKCTH  39



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGV+YCKPHFEQLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVVYCKPHFEQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCS++PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSISPS  145


 Score = 59.3 bits (142),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   ++  SNY+++EGVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCSISPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAASVPE  188


 Score = 40.8 bits (94),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCF  35


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFH  39



>gb|AGJ83945.1| lim protein 5 [Gossypium hirsutum]
Length=189

 Score =   216 bits (551),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL+NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQS AK+A+KLTPE+TR
Sbjct  33   SCFKCSHCKGTLKLANYSSMEGVLYCKPHFEQLFKETGNFNKNFQSSAKAAEKLTPEMTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGT EKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPS  145


 Score = 70.5 bits (171),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCF  35


 Score = 60.1 bits (144),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 41.2 bits (95),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSH  39



>ref|XP_010067487.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067488.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067489.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 gb|KCW65631.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=189

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLS+YSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSADKLTPEL R
Sbjct  33   SCFKCSHCKGTLKLSSYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSADKLTPELAR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE+QSYHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAAGMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPS  145


 Score = 57.8 bits (138),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMKRAAASIPE  188


 Score = 39.3 bits (90),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVESQSYHKSCF  133


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKACEKTVYPVE LSADG+ YHKS  
Sbjct  1    MSFTGTQVKCKACEKTVYPVEQLSADGVAYHKSCF  35


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ KC  C KT YP+E+++ +  +YHKSCFKCSH
Sbjct  3    FTGTQVKCKACEKTVYPVEQLSADGVAYHKSCFKCSH  39



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+C HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSA+KL PELTR
Sbjct  33   TCFKCFHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKSAEKLNPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPS  145


 Score = 58.5 bits (140),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE G++N   +S   K A    PE
Sbjct  131  SCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSATMKRAAASVPE  188


 Score = 40.8 bits (94),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHK+  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCF  35


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  +YHK+CFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFH  39



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   216 bits (551),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPELT  466
            SCF+C+HCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPA KSA+KLTPELT
Sbjct  33   SCFKCTHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAAKSAEKLTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            RSPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  146


 Score = 68.9 bits (167),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  177


 Score = 39.7 bits (91),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  93   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCF  134


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E+++ +  SYHKSCFKC+H
Sbjct  3    FIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTH  39



>ref|XP_004239928.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Solanum 
lycopersicum]
 ref|XP_006355670.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   216 bits (549),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLS+YSSMEGVLYCKPHFEQL+KESGNFNKNFQSP KSA+KLTP LT+
Sbjct  33   SCFKCTHCKGTLKLSSYSSMEGVLYCKPHFEQLYKESGNFNKNFQSPVKSAEKLTPMLTK  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSL PS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPS  145


 Score = 69.7 bits (169),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCF  35


 Score = 61.2 bits (147),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKS  176


 Score = 40.4 bits (93),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +  +YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCF  133


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTH  39



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   218 bits (555),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGVLYCKPHF+QLFKE+GNFNKNFQSPAK+A+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVLYCKPHFDQLFKETGNFNKNFQSPAKTAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPS  145


 Score = 67.0 bits (162),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  S+Y+++EGVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCAITPSSYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAAPVPE  188


 Score = 39.3 bits (90),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  +YHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFH  39



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   218 bits (555),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGVLYCKPHF+QLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVLYCKPHFDQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPS  145


 Score = 57.4 bits (137),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYN  171


 Score = 39.3 bits (90),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLS DG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCF  35


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  +YHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFH  39



>gb|KHG07853.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   214 bits (545),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKL+NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQS AK+A+KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLANYSSMEGVLYCKPHFEQLFKETGNFNKNFQSSAKAAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGT EKCATCGKTAYPLEKVTVE QSYHKSCFKCSH GCSL+PS
Sbjct  93   SPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPS  145


 Score = 70.5 bits (171),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCF  35


 Score = 58.9 bits (141),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH   +L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHSGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 40.8 bits (94),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKS  
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSH  39



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   218 bits (554),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+G+F KNFQSPAKSA+KLTPELTR
Sbjct  34   SCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGSFKKNFQSPAKSAEKLTPELTR  93

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  94   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  146


 Score = 57.4 bits (137),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN-----KNFQSPAKSADKLT  454
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N      + + PA S     
Sbjct  132  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASIKRPAASVPDAR  191

Query  455  P  457
            P
Sbjct  192  P  192


 Score = 40.4 bits (93),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  93   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  134


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCKACEKTVY V+ LSADG+ YHKS  
Sbjct  4    FGGTQQKCKACEKTVYVVDQLSADGVTYHKSCF  36


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            + F GTQ+KC  C KT Y +++++ +  +YHKSCFKCSH
Sbjct  2    AFFGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSH  40



>ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like 
[Cucumis sativus]
Length=195

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSM+GVLYCKPHFEQLFKE+GNF+KNF SPAKS++KLTPELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMDGVLYCKPHFEQLFKETGNFSKNFLSPAKSSEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPS  145


 Score = 54.7 bits (130),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSH   +L  SNY++++G+L CK HF QLFKE G++N   +S +      T +   
Sbjct  131  SCFKCSHGGCSLSPSNYAALDGILXCKHHFSQLFKEKGSYNHLIKSASMKRQAATSD--P  188

Query  470  SPSKAAS  490
             PSK  S
Sbjct  189  DPSKVES  195


 Score = 40.8 bits (94),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKS  
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCF  35


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  S+HKSCFKCSH
Sbjct  3    FIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSH  39



>ref|XP_011040324.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011040398.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=189

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+C HCKGTLKL NYSSMEGVLYCKPHF+QLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   TCFKCFHCKGTLKLGNYSSMEGVLYCKPHFDQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPS  145


 Score = 58.9 bits (141),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAAPVPE  188


 Score = 39.3 bits (90),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHK+  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCF  35


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  +YHK+CFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFH  39



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKESG+F+KNFQSPAK ADK TPELTR
Sbjct  33   ACFRCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKESGSFSKNFQSPAKLADKTTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPS  145


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACF  35


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSH  39



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   216 bits (549),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAKSA+KL PELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKSAEKLNPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+ +YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPS  145


 Score = 60.8 bits (146),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE GN+N   +S +       P
Sbjct  131  SCFKCSHGGCAITPSNYAALEGVLYCKHHFAQLFKEKGNYNHVLRSASSKRTAAAP  186


 Score = 42.0 bits (97),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ + + YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCF  133


 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC+KTVYPVE LSADG++YHKS  
Sbjct  1    MSFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCF  35


 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E+++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSH  39



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G F+KNFQSPAK ADK TPELTR
Sbjct  33   ACFRCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGTFSKNFQSPAKLADKTTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPS  145


 Score = 57.0 bits (136),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 43.1 bits (100),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACF  35


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSH  39



>gb|ABK94608.1| unknown [Populus trichocarpa]
Length=189

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C HCKGTLKLSNYSSMEGVLYCKPH +QLFKE+GNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCFHCKGTLKLSNYSSMEGVLYCKPHLDQLFKETGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVT E+Q+YHKSCFKCSHGGC++TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTAESQAYHKSCFKCSHGGCAITPS  145


 Score = 57.8 bits (138),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYN  171


 Score = 41.2 bits (95),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++A+   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTAESQAYHKSCF  133


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYP+ELLS DG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCF  35


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  +YHKSCFKC H
Sbjct  3    FTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFH  39



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+C+HCKGTLKL NYSSMEGVLYCKPHFEQLFKE+G+FNK+FQSPAKS +KLT
Sbjct  28   VLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKPHFEQLFKETGSFNKSFQSPAKSVEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+QSYHKSCFKCSHGGC +TPS
Sbjct  88   PELTRSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPS  145


 Score = 54.3 bits (129),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  S Y+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPITPSTYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 40.4 bits (93),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCF  133


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKACEKTVY ++ LSADG+ YHKS  
Sbjct  1    MAFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCF  35


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +++++ +   YHKSCFKC+H
Sbjct  3    FSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNH  39



>ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis 
sativus]
 gb|KGN50627.1| hypothetical protein Csa_5G198170 [Cucumis sativus]
Length=195

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSM+GVLYCKPHFEQLFKE+GNF+KNF SPAKS++K TPELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMDGVLYCKPHFEQLFKETGNFSKNFLSPAKSSEKPTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPS  145


 Score = 57.8 bits (138),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSH   +L  SNY++++G+LYCK HF QLFKE G++N   +S +      T +   
Sbjct  131  SCFKCSHGGCSLSPSNYAALDGILYCKHHFSQLFKEKGSYNHLIKSASMKRQAATSD--P  188

Query  470  SPSKAAS  490
             PSK  S
Sbjct  189  DPSKVES  195


 Score = 40.8 bits (94),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKS  
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCF  35


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  S+HKSCFKCSH
Sbjct  3    FIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSH  39



>ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
Length=197

 Score =   211 bits (536),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 109/121 (90%), Gaps = 8/121 (7%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--------PAKSAD  445
            SCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFKE+GNFNKNFQS         AKSA+
Sbjct  33   SCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSLSLILLSAAAKSAE  92

Query  446  KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTP  625
            KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++P
Sbjct  93   KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISP  152

Query  626  S  628
            S
Sbjct  153  S  153


 Score = 68.6 bits (166),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCF  35


 Score = 58.5 bits (140),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  139  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  196


 Score = 43.9 bits (102),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  100  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  141


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   YHKSCFKCSH
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSH  39



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESG+F+KNFQSPAK ADK T ELTR
Sbjct  33   ACFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGSFSKNFQSPAKLADKTTHELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPS  145


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACF  35


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSH  39



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESG+F+KNFQSPAK ADK T ELTR
Sbjct  33   ACFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGSFSKNFQSPAKLADKTTHELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPS  145


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACF  35


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSH  39



>ref|XP_008463203.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463204.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463205.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=195

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSM+GVLYCKPHFEQLFKE+GNF+KNF SPAKS++K TPELTR
Sbjct  33   SCFKCSHCKGTLKLSNYSSMDGVLYCKPHFEQLFKETGNFSKNFLSPAKSSEKPTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPS+AASMFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGCSL+PS
Sbjct  93   SPSRAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPS  145


 Score = 59.3 bits (142),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSH   +L  SNY+++EG+LYCK HF QLFKE G++N   +S +      T +   
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMKRQAATSD--S  188

Query  470  SPSKAAS  490
             PSK  S
Sbjct  189  DPSKVES  195


 Score = 39.7 bits (91),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKS  
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCF  35


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  S+HKSCFKCSH
Sbjct  3    FIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSH  39



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G F KNFQSPAK ADK TPELTR
Sbjct  33   ACFRCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGTFKKNFQSPAKLADKNTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 58.2 bits (139),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 39.3 bits (90),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF+GTQQKCKACEKTVYPV+ LSADG +YHK+  
Sbjct  1    MSFLGTQQKCKACEKTVYPVDQLSADGTSYHKACF  35


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  SYHK+CF+CSH
Sbjct  3    FLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSH  39



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+C+HCKGTLKLSNYSS+EGVLYCKPHFEQLFKE+G+FNK+FQSPAKSA+KLT
Sbjct  28   IAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHFEQLFKETGSFNKSFQSPAKSAEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAA MFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC ++PS
Sbjct  88   PELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPS  145


 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKLTPEL  463
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   + +  K     TP+L
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASIKRTAASTPDL  189


 Score = 42.0 bits (97),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC KTVY ++ LSADGI YHKS  
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCF  35


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +++++ +  +YHKSCFKC+H
Sbjct  3    FSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNH  39



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+C+HCKGTL LS YSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA+K  
Sbjct  30   VVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAEK-A  88

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAASMFSGTQEKCATC KTAYPLEKVTVE Q+YHKSCFKCSHGGCS+TPS
Sbjct  89   PELTRSPSKAASMFSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPS  146


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  463
            SCF+CSH   ++  SNY+++EG+LYCK HF QLFKE G++N   +S + K +    P+L
Sbjct  132  SCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRSAATAPDL  190


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             +F GTQQKCKAC+KTVY ++ L+ADG+ +HKS  
Sbjct  3    FNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCF  37


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            F+GTQ+KC  C KT Y ++++T +   +HKSCFKC+H   +LT S
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLS  49



>gb|AAL38006.1|AF443117_1 LIM domain protein [Gossypium hirsutum]
 gb|AII80543.1| LIM-domian protein 9 [Gossypium hirsutum]
Length=189

 Score =   205 bits (522),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SC +CSHCKGTLKL+NYSSMEGVLYCKPHFEQLFKE+GNFNK+FQ  AK+A+KLTPE+TR
Sbjct  33   SCSKCSHCKGTLKLANYSSMEGVLYCKPHFEQLFKETGNFNKDFQLSAKAAEKLTPEMTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGT EKCATCGKTAYPLEKVTVE QSY KSCFKCSHGGCSL+PS
Sbjct  93   SPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYLKSCFKCSHGGCSLSPS  145


 Score = 70.1 bits (170),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKS  288
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKS
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKS  33


 Score = 60.1 bits (144),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188


 Score = 36.6 bits (83),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GT +KC  C KT YP+E ++ +G +Y KS  
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYLKSCF  133


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +   YHKSC KCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELLSADGVPYHKSCSKCSH  39



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   210 bits (534),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKGTLKLS+YSSMEGVLYCKPH+EQLFKE+G F KNF SPAK ADK TPELTR
Sbjct  33   ACFRCSHCKGTLKLSSYSSMEGVLYCKPHYEQLFKETGTFKKNFTSPAKLADKTTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQ+KCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   SPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  145


 Score = 64.7 bits (156),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACF  35


 Score = 58.2 bits (139),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  131  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAATSVPE  188


 Score = 39.7 bits (91),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCF  133


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  SYHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSH  39



>gb|EYU19976.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
 gb|EYU19977.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
Length=199

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKL-TPELT  466
            SCFRCSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G+F KNF SPAKSA+K  TPE+T
Sbjct  33   SCFRCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGSFTKNFTSPAKSAEKSSTPEMT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            RSPSKAA MFSGTQ+KCATC KTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS
Sbjct  93   RSPSKAAGMFSGTQDKCATCAKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  146


 Score = 63.5 bits (153),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S +         +  
Sbjct  132  SCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYNHVLKSASMKRPTAVVAVPD  191

Query  470  SPSKAAS  490
            SP+  A+
Sbjct  192  SPTHQAT  198


 Score = 40.0 bits (92),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  102  FSGTQDKCATCAKTAYPLEKVTVENQSYHKSCF  134


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF+GT QKCKACEKTVY VELLSADGI++HKS  
Sbjct  1    MSFLGTTQKCKACEKTVYHVELLSADGISFHKSCF  35



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSS+EGVLYCKPHFEQLFKE+G+FNK+FQSPAKSA+KLTPELTR
Sbjct  33   SCFKCNHCKGTLKLSNYSSLEGVLYCKPHFEQLFKETGSFNKSFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQEKC  CGKTAYPLEKVTVE Q+YHKSCFKCSHGGC ++PS
Sbjct  93   SPSKAAGMFSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPS  145


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC AC KT YP+E ++ +G  YHKS  
Sbjct  101  FSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC KTVY ++ LSADG++YHKS  
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCF  35


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +++++ +  SYHKSCFKC+H
Sbjct  3    FSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNH  39



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G+F KNFQSPAK A K TPELTR
Sbjct  33   ACFKCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGSFKKNFQSPAKQAVKTTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHG C +TPS
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPS  145


 Score = 57.8 bits (138),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EGVLYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGSCPITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 43.5 bits (101),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKC+AC+KTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACF  35


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CFKCSH
Sbjct  3    FIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSH  39



>gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum]
 gb|KHG28834.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   206 bits (523),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLK  NYSSMEGVLYCKPHFEQLFKE+GN+NKNFQSPAKSA+KLT +LTR
Sbjct  33   SCFKCSHCKGTLKWGNYSSMEGVLYCKPHFEQLFKEAGNYNKNFQSPAKSAEKLT-QLTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++PS
Sbjct  92   SPSKAAGMFSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPS  144


 Score = 65.5 bits (158),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVEL+S DG+ +HKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  130  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  175


 Score = 42.0 bits (97),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 32/67 (48%), Gaps = 2/67 (3%)
 Frame = +1

Query  94   QAGRSRTPFFLQGLKGQIWTLLLRDFRSTKKRMSFIGTQQKCKACEKTVYPVELLSADGI  273
            +AG     F       +  T L R    +K    F GTQ KC  C KT YP+E ++ +G 
Sbjct  68   EAGNYNKNFQSPAKSAEKLTQLTRS--PSKAAGMFSGTQDKCATCGKTAYPLEKVTVEGQ  125

Query  274  NYHKSVL  294
            +YHKS  
Sbjct  126  SYHKSCF  132


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E V+V+   +HKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSH  39



>gb|KJB74201.1| hypothetical protein B456_011G279100 [Gossypium raimondii]
 gb|KJB74202.1| hypothetical protein B456_011G279100 [Gossypium raimondii]
Length=188

 Score =   206 bits (523),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLK  NYSSMEGVLYCKPHFEQLFKE+GN+NKNFQSPAKSA+KLT +LTR
Sbjct  33   SCFKCSHCKGTLKWGNYSSMEGVLYCKPHFEQLFKEAGNYNKNFQSPAKSAEKLT-QLTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC ++PS
Sbjct  92   SPSKAAGMFSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPS  144


 Score = 65.5 bits (158),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPVEL+S DG+ +HKS  
Sbjct  1    MSFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  130  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  175


 Score = 42.0 bits (97),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 32/67 (48%), Gaps = 2/67 (3%)
 Frame = +1

Query  94   QAGRSRTPFFLQGLKGQIWTLLLRDFRSTKKRMSFIGTQQKCKACEKTVYPVELLSADGI  273
            +AG     F       +  T L R    +K    F GTQ KC  C KT YP+E ++ +G 
Sbjct  68   EAGNYNKNFQSPAKSAEKLTQLTRS--PSKAAGMFSGTQDKCATCGKTAYPLEKVTVEGQ  125

Query  274  NYHKSVL  294
            +YHKS  
Sbjct  126  SYHKSCF  132


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E V+V+   +HKSCFKCSH
Sbjct  3    FIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSH  39



>ref|XP_003600847.1| LIM domain-containing protein [Medicago truncatula]
 gb|ACJ85930.1| unknown [Medicago truncatula]
 gb|ACJ86074.1| unknown [Medicago truncatula]
 gb|AES71098.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK39027.1| unknown [Medicago truncatula]
 gb|AFK39398.1| unknown [Medicago truncatula]
Length=191

 Score =   206 bits (524),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF--NKNFQSPAKSADKLTPEL  463
            +CFRCSHCKGTLKLS+YSSMEGVLYCKPHFEQLFKE GNF  NKNFQSPAK AD  TP L
Sbjct  33   ACFRCSHCKGTLKLSSYSSMEGVLYCKPHFEQLFKEHGNFSKNKNFQSPAKVADGTTPVL  92

Query  464  TRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TR+PSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   TRTPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  147


 Score = 64.7 bits (156),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACF  35


 Score = 58.2 bits (139),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  133  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  190


 Score = 39.3 bits (90),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  103  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  135


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  SYHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSH  39



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+C+HCKGTL LS YSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA+K  
Sbjct  30   VVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAEK-A  88

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRS SKAASMFSGTQEKCATC KTAYPLEKVTVE Q+YHKSCFKCSHGGCS+TPS
Sbjct  89   PELTRSTSKAASMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPS  146


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  463
            SCF+CSH   ++  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    P+L
Sbjct  132  SCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAATAPDL  190


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             +F GTQQKCKAC+KTVY ++ L+ADG+ +HKS  
Sbjct  3    FNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCF  37


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            F+GTQ+KC  C KT Y ++++T +   +HKSCFKC+H   +LT S
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLS  49



>gb|AFK34184.1| unknown [Medicago truncatula]
Length=191

 Score =   206 bits (523),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF--NKNFQSPAKSADKLTPEL  463
            +CFRCSHCKGTLKLS+YSSMEGVLYCKPHFEQLFKE GNF  NKNFQSPAK AD  TP L
Sbjct  33   ACFRCSHCKGTLKLSSYSSMEGVLYCKPHFEQLFKEHGNFSKNKNFQSPAKVADGTTPVL  92

Query  464  TRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TR+PSKAA MFSGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  93   TRTPSKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  147


 Score = 64.7 bits (156),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+  
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACF  35


 Score = 57.0 bits (136),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKLTPEL  463
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   + +  K A    PE 
Sbjct  133  SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHFIKFASIKRAAASVPEF  191


 Score = 39.3 bits (90),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  103  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  135


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  SYHK+CF+CSH
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSH  39



>ref|XP_010554627.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
 ref|XP_010554628.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
Length=196

 Score =   202 bits (514),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LSNYSSMEGVLYCKPHFEQLFKE+GNFNKNFQSPAK A+K TPELTR
Sbjct  33   SCFKCTHCKSRLQLSNYSSMEGVLYCKPHFEQLFKETGNFNKNFQSPAKPAEKPTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK ASMFSGTQ+KCATC KT YPLEKVTVE+QSYHKSCFKCSHGGC ++PS
Sbjct  93   TPSKFASMFSGTQDKCATCSKTVYPLEKVTVESQSYHKSCFKCSHGGCPISPS  145


 Score = 65.9 bits (159),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCK C+KTVYPVELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKTCDKTVYPVELLSADGVGYHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 41.6 bits (96),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCATCSKTVYPLEKVTVESQSYHKSCF  133


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC TC KT YP+E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKTCDKTVYPVELLSADGVGYHKSCFKCTH  39



>ref|XP_010534537.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534538.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534539.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534540.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
Length=199

 Score =   197 bits (502),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LSNYSSMEGVLYCKPHFEQLFKE+G+F+KNFQSPAK A+K TPELTR
Sbjct  33   SCFKCTHCKSRLQLSNYSSMEGVLYCKPHFEQLFKETGSFHKNFQSPAKPAEKPTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK A MFSGTQ+KC TCGKT YPLEKVTVE+QSYHKSCFKCSHGGC ++PS
Sbjct  93   TPSKVAGMFSGTQDKCTTCGKTVYPLEKVTVESQSYHKSCFKCSHGGCPISPS  145


 Score = 68.9 bits (167),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKS  176


 Score = 40.4 bits (93),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCTTCGKTVYPLEKVTVESQSYHKSCF  133


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTH  39



>gb|EPS58831.1| hypothetical protein M569_15983, partial [Genlisea aurea]
Length=189

 Score =   198 bits (503),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  472
            CF+C+ CKGTLKLSNYSSM+GVLYCKPH+EQLFKE+G+F KNFQSP+KSA+K +P LT+S
Sbjct  34   CFKCTFCKGTLKLSNYSSMDGVLYCKPHYEQLFKETGSFTKNFQSPSKSAEKPSPTLTKS  93

Query  473  PSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PSKAA MFSGT +KCA CGKTAYPLEKV+VENQSYHKSCFKCSHGGCSLTPS
Sbjct  94   PSKAAGMFSGTVDKCAVCGKTAYPLEKVSVENQSYHKSCFKCSHGGCSLTPS  145


 Score = 67.4 bits (163),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            MSFIGTQQKCK CEKTVYPVELLSADG++YHK
Sbjct  1    MSFIGTQQKCKVCEKTVYPVELLSADGVDYHK  32


 Score = 63.5 bits (153),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N    SP+ K +  + P+
Sbjct  131  SCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYNHLKNSPSVKRSTAIVPD  188


 Score = 37.4 bits (85),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KT YP+E +S +  +YHKS  
Sbjct  101  FSGTVDKCAVCGKTAYPLEKVSVENQSYHKSCF  133



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   203 bits (516),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+C+HCKGTLKLSNYSS+EGVLYCKPHFEQLFKE+G+FNK+FQSPAK A+K T
Sbjct  28   IAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHFEQLFKETGSFNKSFQSPAKPAEKPT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRS SKAA MFSGTQEKCATCGKTAYPLEKVTVE Q+YHK CF+CSHGGCS++PS
Sbjct  88   PELTRSRSKAAGMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSISPS  145


 Score = 59.7 bits (143),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  463
            CFRCSH   ++  SNY+++EG+LYCK HF QLFKE G++N   +S + K     TP+L
Sbjct  132  CFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRTAASTPDL  189


 Score = 40.4 bits (93),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHK  285
            F GTQ+KC  C KT YP+E ++ +G  YHK
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHK  130


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC+KTVY ++ LSADGI YHKS  
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCF  35


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +++++ +  +YHKSCFKC+H
Sbjct  3    FSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNH  39



>ref|XP_006403418.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403419.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403420.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403421.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44871.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44872.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44873.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44874.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
Length=199

 Score =   196 bits (497),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAK A+K +PELTR
Sbjct  33   SCFKCTHCKSRLQLSRYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKPAEKSSPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A MFSGTQEKCATC KT YP+EK+TVE+Q+YHKSCFKCSHGGC L+PS
Sbjct  93   TPSRVAGMFSGTQEKCATCSKTVYPIEKITVESQTYHKSCFKCSHGGCPLSPS  145


 Score = 68.2 bits (165),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADG++YH+S  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHRSCF  35


 Score = 57.4 bits (137),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPLSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  176


 Score = 43.1 bits (100),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCSKTVYPIEKITVESQTYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYH+SCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGVSYHRSCFKCTH  39



>emb|CAA62744.1| transcription factor L2 [Arabidopsis thaliana]
Length=172

 Score =   198 bits (504),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  93   TPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  145


 Score = 65.5 bits (158),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 45.8 bits (107),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFK  394
            SCF+CSH    +  SNY+++EG+LYCK HF QL +
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLLR  165


 Score = 43.1 bits (100),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  133


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|NP_191136.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030868.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030869.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030870.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_680133.2| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 sp|Q9M047.1|WLI2B_ARATH RecName: Full=LIM domain-containing protein WLIM2b; AltName: 
Full=Widely-expressed LIM protein 2B [Arabidopsis thaliana]
 emb|CAB81602.1| transcription factor L2 [Arabidopsis thaliana]
 gb|AAL36280.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM14188.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM60942.1| transcription factor L2 [Arabidopsis thaliana]
 dbj|BAH19816.1| AT3G55770 [Arabidopsis thaliana]
 dbj|BAH20021.1| AT3G55770 [Arabidopsis thaliana]
 gb|AEE79434.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79435.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79436.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79437.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79438.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=199

 Score =   198 bits (503),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  93   TPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  145


 Score = 65.5 bits (158),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  176


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  133


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_002876333.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52592.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=199

 Score =   198 bits (503),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAK ADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKPADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ AS FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  93   TPSRVASRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  145


 Score = 65.5 bits (158),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  176


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  133


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>gb|ACU17588.1| unknown [Glycine max]
Length=139

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G+F KNFQSPAK A K TPELTR
Sbjct  33   ACFKCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGSFKKNFQSPAKQAVKTTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHG  607
            SPSKAASMFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHG
Sbjct  93   SPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHG  138


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKC+AC+KTVYPV+ LSADG  YHK+  
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACF  35


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+++++ +  +YHK+CFKCSH
Sbjct  3    FIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSH  39



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLSNYSS+EGVLYCKPHFEQLFKE+G+FNK+FQSPAKSA+K  PELTR
Sbjct  33   SCFKCNHCKGTLKLSNYSSLEGVLYCKPHFEQLFKETGSFNKSFQSPAKSAEKSNPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            S SKAA MFSGT EKCATCGKTAYPLEKVTVE Q+YHKSCF+CSHGGC ++PS
Sbjct  93   SRSKAAGMFSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPS  145


 Score = 60.5 bits (145),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  463
            SCFRCSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K     TP+L
Sbjct  131  SCFRCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRTAASTPDL  189


 Score = 39.3 bits (90),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT +KC  C KT YP+E ++ +G  YHKS  
Sbjct  101  FSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC+KTVY ++ LSADGI YHKS  
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCF  35


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +++++ +  +YHKSCFKC+H
Sbjct  3    FSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNH  39



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAKSADKLTPEL  463
            SCFRC+HCKGTLKLSNYSSMEGVLYCKPHF+QLF+ESGNFNKNFQS   +K  D L+PEL
Sbjct  33   SCFRCNHCKGTLKLSNYSSMEGVLYCKPHFDQLFRESGNFNKNFQSQRSSKVIDGLSPEL  92

Query  464  TRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TRSPSK + MFSGTQ+KCATCGKTAYPLEKVTVE+ SYHKSCFKCSHGGCS++PS
Sbjct  93   TRSPSKVSMMFSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPS  147


 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPEL  463
            SCF+CSH   ++  SNY+++EG+LYCK HF QLFKE G++N   ++         PE+
Sbjct  133  SCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKTATMKRAAAVPEV  190


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC+KTVY V+ LSADG++YHKS  
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCF  35


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +++++ +  SYHKSCF+C+H
Sbjct  3    FTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNH  39



>emb|CDY02959.1| BnaC04g25270D [Brassica napus]
Length=269

 Score =   194 bits (494),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSPAK A+K  PELTR
Sbjct  103  SCFKCSHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSNPELTR  162

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  163  TPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  215


 Score = 66.6 bits (161),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  72   SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  105


 Score = 57.0 bits (136),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  201  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  246


 Score = 43.1 bits (100),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  171  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  203


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  71   SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSH  109



>emb|CDX76073.1| BnaA04g03370D [Brassica napus]
Length=270

 Score =   194 bits (494),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSPAK A+K +PELTR
Sbjct  104  SCFKCTHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTR  163

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  164  TPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  216


 Score = 66.2 bits (160),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG+ YHKS  
Sbjct  73   SFTGTQQKCKACEKTVYPVELLSADGVTYHKSCF  106


 Score = 57.4 bits (137),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  202  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  247


 Score = 43.1 bits (100),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  172  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  204


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  +YHKSCFKC+H
Sbjct  72   SSFTGTQQKCKACEKTVYPVELLSADGVTYHKSCFKCTH  110



>dbj|BAH20111.1| AT3G55770 [Arabidopsis thaliana]
Length=199

 Score =   198 bits (503),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  93   TPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  145


 Score = 62.8 bits (151),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC KTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACGKTVYAVELLSADGVGYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  131  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  176


 Score = 42.7 bits (99),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  133


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  CGKT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACGKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_010321447.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X2 [Solanum 
lycopersicum]
Length=161

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 106/121 (88%), Gaps = 4/121 (3%)
 Frame = +2

Query  266  MGLIITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSAD  445
            MGL+IT+L     S      +LS+YSSMEGVLYCKPHFEQL+KESGNFNKNFQSP KSA+
Sbjct  1    MGLVITNL----VSSVLIVKELSSYSSMEGVLYCKPHFEQLYKESGNFNKNFQSPVKSAE  56

Query  446  KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTP  625
            KLTP LT+SPSKAA MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSL P
Sbjct  57   KLTPMLTKSPSKAAGMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNP  116

Query  626  S  628
            S
Sbjct  117  S  117


 Score = 62.0 bits (149),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S
Sbjct  103  SCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKS  148


 Score = 40.0 bits (92),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKS  288
            F GTQ+KC  C KT YP+E ++ +  +YHKS
Sbjct  73   FSGTQEKCATCGKTAYPLEKVTVENQSYHKS  103



>emb|CDY60999.1| BnaA03g56620D [Brassica napus]
Length=200

 Score =   194 bits (494),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK TL+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKTTLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC+++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPS  146


 Score = 65.1 bits (157),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.8 bits (94),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  S+HKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSH  39



>ref|XP_010427370.1| PREDICTED: LIM domain-containing protein WLIM2b [Camelina sativa]
Length=200

 Score =   194 bits (493),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK-LTPELT  466
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAK ADK  TPELT
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKPADKSATPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC+L+PS
Sbjct  93   RTPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPS  146


 Score = 65.5 bits (158),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 58.2 bits (139),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 42.7 bits (99),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  134


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_009133391.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61745.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   194 bits (494),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK TL+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKTTLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC+++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPS  146


 Score = 65.1 bits (157),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.8 bits (94),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  S+HKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSH  39



>emb|CDY24943.1| BnaC03g22290D [Brassica napus]
Length=197

 Score =   194 bits (493),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK TL+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKTTLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC+++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPS  146


 Score = 65.1 bits (157),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 41.2 bits (95),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  S+HKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSH  39



>ref|XP_010516165.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=197

 Score =   194 bits (493),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK-LTPELT  466
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAK ADK  TPELT
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKPADKSTTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC+L+PS
Sbjct  93   RTPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPS  146


 Score = 65.5 bits (158),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 58.2 bits (139),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 43.1 bits (100),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  134


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_009139138.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61744.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   192 bits (488),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSPAK A+K +PELTR
Sbjct  34   SCFKCTHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTR  93

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  94   TPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  146


 Score = 67.0 bits (162),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  36


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  134


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTH  40



>emb|CDY20498.1| BnaC04g05460D [Brassica napus]
 emb|CDX74822.1| BnaA05g05680D [Brassica napus]
Length=200

 Score =   194 bits (493),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK TL+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKSTLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 64.3 bits (155),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.8 bits (94),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   +HKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSH  39



>ref|XP_009143273.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=199

 Score =   194 bits (492),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK TL+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKSTLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 64.3 bits (155),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.8 bits (94),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   +HKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSH  39



>emb|CDP14069.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   190 bits (483),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 110/154 (71%), Gaps = 41/154 (27%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTLKLSNYSSMEGVLYCKPH+EQLFKE+G+FNK+FQSPAKSA+KLTPEL  
Sbjct  33   SCFKCSHCKGTLKLSNYSSMEGVLYCKPHYEQLFKETGSFNKSFQSPAKSAEKLTPELAS  92

Query  470  -----SPSKAASMFSGTQEKCATCGKTAYPLEK---------------------------  553
                 SPSKAA MFSGTQ+KCATCGKTAYPLEK                           
Sbjct  93   FPPYLSPSKAAGMFSGTQDKCATCGKTAYPLEKTINILVFNFLSRQPPLALHCTTIYFKK  152

Query  554  ---------VTVENQSYHKSCFKCSHGGCSLTPS  628
                     VTVENQSYHKSCFKCSHGGCSL+PS
Sbjct  153  NDIGYNDLPVTVENQSYHKSCFKCSHGGCSLSPS  186


 Score = 67.8 bits (164),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCKAC KTVYPVELLSADG++YHKS  
Sbjct  1    MSFIGTQQKCKACVKTVYPVELLSADGVSYHKSCF  35


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S
Sbjct  172  SCFKCSHGGCSLSPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKS  217


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FIGTQQKCKACVKTVYPVELLSADGVSYHKSCFKCSH  39



>ref|XP_010504446.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
 ref|XP_010504447.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=200

 Score =   192 bits (488),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK-LTPELT  466
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAK  DK  TPELT
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKPTDKSATPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC+L+PS
Sbjct  93   RTPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPS  146


 Score = 65.5 bits (158),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 58.2 bits (139),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 43.1 bits (100),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  134


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_006295906.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
 gb|EOA28804.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
Length=200

 Score =   189 bits (480),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK  +DK TPELT
Sbjct  33   SCFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLSDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGMFSGTQDKCATCNKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 68.2 bits (165),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 41.2 bits (95),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCNKTVYPIEKVTVESQCYHKSCF  134


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSH  39



>dbj|BAM13339.1| LIM domain-containing protein [Oryza officinalis]
Length=196

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TPELTRSPSKAA MFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   TPELTRSPSKAARMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>dbj|BAM13338.1| LIM domain-containing protein [Oryza punctata]
Length=196

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TPELTRSPSKAA MFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   TPELTRSPSKAARMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_002879831.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56090.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   188 bits (477),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK   DK TPELT
Sbjct  33   SCFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLTDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRLAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 68.6 bits (166),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADGI+YHKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 41.2 bits (95),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGISYHKSCFKCSH  39



>ref|XP_006411232.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411233.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411234.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52685.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52686.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52687.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
Length=203

 Score =   192 bits (487),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGVLYCKPHFEQLFKE+G+FNKNFQSPAK   DK TPELT
Sbjct  34   SCFKCSHCKSRLQLSNYSSMEGVLYCKPHFEQLFKETGSFNKNFQSPAKPLTDKPTPELT  93

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  94   RTPSRVAGMFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  147


 Score = 64.3 bits (155),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKS  
Sbjct  2    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCF  36


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  133  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  178


 Score = 41.2 bits (95),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  103  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  135


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +   +HKSCFKCSH
Sbjct  4    FTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSH  40



>ref|XP_006649807.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
 dbj|BAM13342.1| LIM domain-containing protein [Oryza brachyantha]
Length=195

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK  ++KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPISEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TP+LTRSPSKAA MFSGTQEKCATCGKTAYPLEKVTVE QSYHKSCFKCSHGGC+++PS
Sbjct  87   TPDLTRSPSKAARMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCAISPS  145


 Score = 57.4 bits (137),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +  +    +  PE
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASVKRSEAQPE  187


 Score = 43.1 bits (100),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G +YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_010517368.1| PREDICTED: LIM domain-containing protein WLIM2a [Camelina sativa]
Length=201

 Score =   187 bits (476),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK  +DK TPELT
Sbjct  33   SCFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLSDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A +FSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGLFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 68.2 bits (165),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.8 bits (94),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSH  39



>ref|XP_010508950.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=199

 Score =   187 bits (475),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK  +DK TPELT
Sbjct  33   SCFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLSDKPTPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A +FSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGLFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 67.8 bits (164),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCF  35


 Score = 56.2 bits (134),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN  172


 Score = 40.8 bits (94),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSH  39



>emb|CDX72203.1| BnaC08g26710D [Brassica napus]
Length=201

 Score =   188 bits (477),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK-SADKLTPELT  466
            SCF+CSHCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSP K +A+K +PELT
Sbjct  34   SCFKCSHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPVKPAAEKSSPELT  93

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  94   RTPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  147


 Score = 67.0 bits (162),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  36


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  133  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  178


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  135


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSH  40



>emb|CDY27267.1| BnaA09g35350D [Brassica napus]
Length=201

 Score =   188 bits (477),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK-SADKLTPELT  466
            SCF+CSHCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSP K +A+K +PELT
Sbjct  34   SCFKCSHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPVKPAAEKSSPELT  93

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  94   RTPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  147


 Score = 67.0 bits (162),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  36


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  133  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  178


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  135


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSH  40



>dbj|BAM13341.1| LIM domain-containing protein [Oryza australiensis]
Length=196

 Score =   195 bits (496),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PELTRSPSKAA MFSGTQEKCATCGKTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   IPELTRSPSKAARMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_009116276.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=201

 Score =   187 bits (476),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK-SADKLTPELT  466
            SCF+CSHCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSP K +A+K +PELT
Sbjct  34   SCFKCSHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPVKPAAEKSSPELT  93

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  94   RTPSRVAGMFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  147


 Score = 67.0 bits (162),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  36


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  133  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  178


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  135


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSH  40



>ref|XP_010505685.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
 ref|XP_010505686.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=207

 Score =   186 bits (473),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            SCF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK  ++K TPELT
Sbjct  33   SCFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLSEKATPELT  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A +FSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRVAGLFSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 68.2 bits (165),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKS  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 41.2 bits (95),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCF  134


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSH  39



>ref|NP_001049655.1| Os03g0266100 [Oryza sativa Japonica Group]
 gb|AAP06876.1| putative LIM-domain protein [Oryza sativa Japonica Group]
 gb|ABF95147.1| Pollen-specific protein SF3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11569.1| Os03g0266100 [Oryza sativa Japonica Group]
 gb|EAY89369.1| hypothetical protein OsI_10876 [Oryza sativa Indica Group]
 gb|EAZ26370.1| hypothetical protein OsJ_10253 [Oryza sativa Japonica Group]
 dbj|BAG86715.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAM13336.1| LIM domain-containing protein [Oryza rufipogon]
 dbj|BAM13337.1| LIM domain-containing protein [Oryza barthii]
 gb|AFI80892.1| LIM-domain protein [Oryza sativa Japonica Group]
Length=196

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TPELTRSPSKAA MFSGTQEKCATC KTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   TPELTRSPSKAARMFSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 42.7 bits (99),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>dbj|BAM13335.1| LIM domain-containing protein [Oryza nivara]
Length=196

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YC+PHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCRPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TPELTRSPSKAA MFSGTQEKCATC KTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   TPELTRSPSKAARMFSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 42.7 bits (99),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|NP_181519.1| protein WLIM2A [Arabidopsis thaliana]
 sp|O04193.1|WLI2A_ARATH RecName: Full=LIM domain-containing protein WLIM2a; AltName: 
Full=Widely-expressed LIM protein 2; Short=AtWLIM2 [Arabidopsis 
thaliana]
 gb|AAB95275.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAM19819.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AAM67434.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AEC09747.1| protein WLIM2A [Arabidopsis thaliana]
Length=200

 Score =   185 bits (469),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-ADKLTPELT  466
            +CF+CSHCK  L+LSNYSSMEGV+YC+PHFEQLFKESG+F+KNFQSPAK   DK TPEL 
Sbjct  33   ACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSPAKPLTDKPTPELN  92

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            R+PS+ A MFSGTQ+KCATC KT YP+EKVTVE+Q YHKSCFKCSHGGC ++PS
Sbjct  93   RTPSRLAGMFSGTQDKCATCTKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPS  146


 Score = 67.4 bits (163),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKC+ACEKTVYPVELLSADGI+YHK+  
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKACF  35


 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  132  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  177


 Score = 40.4 bits (93),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 2/45 (4%)
 Frame = +1

Query  166  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +   T  R++  F GTQ KC  C KTVYP+E ++ +   YHKS  
Sbjct  90   ELNRTPSRLAGMFSGTQDKCATCTKTVYPIEKVTVESQCYHKSCF  134


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHK+CFKCSH
Sbjct  3    FTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSH  39



>emb|CBL95262.1| lim domain protein [Pinus pinaster]
Length=197

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAKSADKLTPEL  463
            +CFRC+HCKGTLKLSNYSSMEGVLYCKPHF+QLF+ESGNFNKNFQS   +K+ D L PE+
Sbjct  33   ACFRCNHCKGTLKLSNYSSMEGVLYCKPHFDQLFRESGNFNKNFQSQRSSKAIDGLQPEM  92

Query  464  TRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            TRSPSK + MF GTQ+KC TCGKTAYPLEKVTV N S+HKSCF+CSHGGCS++PS
Sbjct  93   TRSPSKVSMMFFGTQDKCGTCGKTAYPLEKVTVGNLSFHKSCFRCSHGGCSISPS  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELT  466
            SCFRCSH   ++  SNY+++EG+LYCK HF QLFKE G++N   ++ +       PE+ 
Sbjct  133  SCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKTASMKRAAAVPEVA  191


 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC+KTVY V+ LSADG++YHK+  
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKACF  35


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +++++ +  SYHK+CF+C+H
Sbjct  3    FTGTQQKCKACDKTVYFVDQLSADGVSYHKACFRCNH  39



>dbj|BAM13340.1| LIM domain-containing protein [Oryza latifolia]
Length=196

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKL  451
            ++   SCF+C HCK TL L NYSS+EGV YCKPHFEQLFKE+G++NK+FQSPAK A +KL
Sbjct  27   VVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHFEQLFKETGSYNKSFQSPAKPASEKL  86

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PELTRSPSKAA MFSGTQEKCATC KTAYPLEKVTVE Q+YHKSCFKCSHGGC+++PS
Sbjct  87   IPELTRSPSKAARMFSGTQEKCATCFKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPS  145


 Score = 57.0 bits (136),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCAISPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 41.6 bits (96),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKS  
Sbjct  95   SKAARM-FSGTQEKCATCFKTAYPLEKVTVEGQAYHKSCF  133


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_006291889.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
 gb|EOA24787.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
Length=179

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +2

Query  242  ILWSCCQLMGLIITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNF  421
            +LWS  QLM L ITSL+    +   G     +YSSMEGVLYCKPHFEQLFKESG+FNKNF
Sbjct  1    MLWSFSQLMELAITSLASNALTAKAGF----SYSSMEGVLYCKPHFEQLFKESGSFNKNF  56

Query  422  QSPAKSADKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCS  601
            QSPAK ADK TPELTR+PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCS
Sbjct  57   QSPAKPADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCS  116

Query  602  HGGCSLTPS  628
            HGGC ++PS
Sbjct  117  HGGCPISPS  125


 Score = 57.0 bits (136),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  111  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  156


 Score = 43.1 bits (100),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  81   FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  113



>ref|NP_001190099.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79440.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=233

 Score =   180 bits (457),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 104/147 (71%), Gaps = 34/147 (23%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEK--------------------------------  553
            +PS+ A  FSGTQEKCATC KT YP+EK                                
Sbjct  93   TPSRVAGRFSGTQEKCATCSKTVYPIEKIHNPLSYRELARKPNVLHRCIDPGDIGSCYFN  152

Query  554  --VTVENQSYHKSCFKCSHGGCSLTPS  628
              VTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  153  LHVTVESQTYHKSCFKCSHGGCPISPS  179


 Score = 65.1 bits (157),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  165  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  210


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>gb|KCW65632.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
 gb|KCW65633.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=138

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +2

Query  347  MEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCATC  526
            MEGVLYCKPHFEQLFKE+GNFNKNFQSPAKSADKLTPEL RSPSKAA MFSGTQ+KCATC
Sbjct  1    MEGVLYCKPHFEQLFKETGNFNKNFQSPAKSADKLTPELARSPSKAAGMFSGTQDKCATC  60

Query  527  GKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            GKTAYPLEKVTVE+QSYHKSCFKCSHGGC +TPS
Sbjct  61   GKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPS  94


 Score = 57.4 bits (137),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  80   SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMKRAAASIPE  137


 Score = 39.3 bits (90),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  50   FSGTQDKCATCGKTAYPLEKVTVESQSYHKSCF  82



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   187 bits (475),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSS+EGVLYCKPHFEQLFKE+G+FNK+FQ P KSADK   +L R
Sbjct  33   SCFKCSHCKGTLSISNYSSLEGVLYCKPHFEQLFKETGSFNKSFQLPPKSADK-QHDLAR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+FSGTQ+KCATC KTAYPLEKVTVE +SYHKSCFKCSHGGC LTPS
Sbjct  92   APSKLSSLFSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPS  144


 Score = 57.0 bits (136),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT QKCK C+KTVY V+LLSADG+NYHKS  
Sbjct  1    MAFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCF  35


 Score = 56.2 bits (134),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S Y++++G+LYCK HF QLFKE GN+N
Sbjct  130  SCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYN  170


 Score = 41.6 bits (96),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +G +YHKS  
Sbjct  100  FSGTQDKCATCYKTAYPLEKVTVEGESYHKSCF  132



>ref|NP_001147673.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG28333.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG44688.1| pollen-specific protein SF3 [Zea mays]
 gb|ACN35331.1| unknown [Zea mays]
 tpg|DAA44553.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB05137.1| LIM transcription factor, partial [Zea mays]
Length=198

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 3/121 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAK-SAD  445
            ++   SCF+C HCK TL LSNYSS EGV YCK HFEQLFKE+G++NK+FQS  PAK + +
Sbjct  27   VVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKTHFEQLFKETGSYNKSFQSQSPAKITPE  86

Query  446  KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTP  625
            KL PELTRSPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE +SYHKSCFKCSHGGC++TP
Sbjct  87   KLAPELTRSPSKAARMFSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCFKCSHGGCAITP  146

Query  626  S  628
            S
Sbjct  147  S  147


 Score = 58.5 bits (140),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKLTPELT  466
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   + +  K A +  PE  
Sbjct  133  SCFKCSHGGCAITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASVKRAAEAQPEQP  192

Query  467  RSPS  478
             S S
Sbjct  193  ASDS  196


 Score = 38.9 bits (89),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 24/40 (60%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  97   SKAARM-FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCF  135


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_009772727.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=138

 Score =   174 bits (442),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTLKLS+YSSMEGVLYCKPHFEQL+KESGNFNKNFQSPAKSA+KLTPELTR
Sbjct  33   SCFKCTHCKGTLKLSSYSSMEGVLYCKPHFEQLYKESGNFNKNFQSPAKSAEKLTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTV  562
            SPSKA+ MFSGTQEKCATCGKTAYPLEKV +
Sbjct  93   SPSKASRMFSGTQEKCATCGKTAYPLEKVHI  123


 Score = 69.7 bits (169),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCF  35


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTH  39



>ref|XP_004984674.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=199

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 3/121 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAK-SAD  445
            ++   SCF+C HCK TL LSNYSS EGV YCK HFEQLFKE+G++NK+FQS  PAK + +
Sbjct  27   VVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKAHFEQLFKETGSYNKSFQSQSPAKLTPE  86

Query  446  KLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTP  625
            KL PELTRSPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE ++YHKSCFKCSHGGC++TP
Sbjct  87   KLAPELTRSPSKAARMFSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCFKCSHGGCAITP  146

Query  626  S  628
            S
Sbjct  147  S  147


 Score = 57.8 bits (138),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSH    +  SNY+++EG LYCK HF QLFKE G++N   +  +    +  PE   
Sbjct  133  SCFKCSHGGCAITPSNYAALEGTLYCKHHFSQLFKEKGSYNHLIKCASVKRAEAQPEQPA  192

Query  470  SPSKAAS  490
             P+  +S
Sbjct  193  QPAADSS  199


 Score = 38.1 bits (87),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 23/40 (58%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  97   SKAARM-FSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCF  135


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQH  38


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCF  34



>ref|XP_002468127.1| hypothetical protein SORBIDRAFT_01g040050 [Sorghum bicolor]
 gb|EER95125.1| hypothetical protein SORBIDRAFT_01g040050 [Sorghum bicolor]
Length=197

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 3/116 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAK-SADKLTPE  460
            SCF+C HCK TL LSNYSS EGV YCK HFEQLFKE+G++NK+FQS  PAK + +KL PE
Sbjct  32   SCFKCQHCKSTLSLSNYSSFEGVPYCKAHFEQLFKETGSYNKSFQSQSPAKITPEKLAPE  91

Query  461  LTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            LTRSPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE ++YHKSCFKCSHGGC++TPS
Sbjct  92   LTRSPSKAARMFSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCFKCSHGGCAITPS  147


 Score = 58.5 bits (140),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKLTPELT  466
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   + +  K A +  PE  
Sbjct  133  SCFKCSHGGCAITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASVKRAAEAQPEQP  192

Query  467  RSPS  478
             S S
Sbjct  193  ASDS  196


 Score = 38.1 bits (87),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 23/40 (58%), Gaps = 1/40 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            S   RM F GTQ KC  C KT YP+E ++ +   YHKS  
Sbjct  97   SKAARM-FSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCF  135


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +  ++H+SCFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGVAFHRSCFKCQH  38


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQQKCK C KTVYP++ LS DG+ +H+S  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVAFHRSCF  34



>emb|CBI40313.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AK ADKL  EL+R
Sbjct  33   TCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTSAKPADKLN-ELSR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KC+ C KT YPLEKVT+E +SYHKSCFKC+HGGC LT S
Sbjct  92   APSKLSSMFSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHS  144


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG +YHK+  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCF  35



>ref|XP_003600848.1| LIM domain-containing protein [Medicago truncatula]
 gb|AES71099.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=149

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = +2

Query  323  LKLSNYSSMEGVLYCKPHFEQLFKESGNF--NKNFQSPAKSADKLTPELTRSPSKAASMF  496
             +LS+YSSMEGVLYCKPHFEQLFKE GNF  NKNFQSPAK AD  TP LTR+PSKAA MF
Sbjct  2    FQLSSYSSMEGVLYCKPHFEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMF  61

Query  497  SGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SGTQEKCATCGKTAYPLEKVTVE+Q+YHKSCFKCSHGGC +TPS
Sbjct  62   SGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPS  105


 Score = 58.2 bits (139),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  460
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  91   SCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  148


 Score = 39.3 bits (90),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KT YP+E ++ +   YHKS  
Sbjct  61   FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCF  93



>ref|XP_002269537.1| PREDICTED: LIM domain-containing protein PLIM2c [Vitis vinifera]
 emb|CAN74803.1| hypothetical protein VITISV_006290 [Vitis vinifera]
Length=220

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AK ADKL  EL+R
Sbjct  33   TCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTSAKPADKLN-ELSR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KC+ C KT YPLEKVT+E +SYHKSCFKC+HGGC LT S
Sbjct  92   APSKLSSMFSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHS  144


 Score = 50.4 bits (119),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+C+H    L  S+Y+++ GVLYCK HF QLF E GN++
Sbjct  130  SCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNYS  170


 Score = 45.4 bits (106),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G +YHKS  
Sbjct  100  FSGTQDKCSACRKTVYPLEKVTLEGESYHKSCF  132


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG +YHK+  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCF  35



>ref|XP_010690195.1| PREDICTED: LIM domain-containing protein WLIM2b [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score =   181 bits (459),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            SCF+C+HCK  L+L ++SSM+G LYCKPHFEQLFKE+GNFNKNFQSP    A+ +  + P
Sbjct  33   SCFKCNHCKNKLQLHSFSSMDGALYCKPHFEQLFKETGNFNKNFQSPTRLLAEKSPDVKP  92

Query  458  ELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            ELTRSPSKAA MFSGTQEKC TC KT YP+EKVTVEN  YHK CFKCSHGGCS+TPS
Sbjct  93   ELTRSPSKAARMFSGTQEKCTTCSKTVYPIEKVTVENLFYHKFCFKCSHGGCSITPS  149


 Score = 55.1 bits (131),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCK C+KTVY ++ LSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKVCDKTVYLMDQLSADGVAYHKSCF  35


 Score = 51.6 bits (122),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            CF+CSH   ++  SNY++++G+LYCK HF QLF+E G++
Sbjct  136  CFKCSHGGCSITPSNYAALDGILYCKHHFSQLFREKGSY  174


 Score = 41.6 bits (96),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +1

Query  175  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            S   RM F GTQ+KC  C KTVYP+E ++ + + YHK
Sbjct  99   SKAARM-FSGTQEKCTTCSKTVYPIEKVTVENLFYHK  134


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +++++ +  +YHKSCFKC+H
Sbjct  3    FTGTQQKCKVCDKTVYLMDQLSADGVAYHKSCFKCNH  39



>ref|XP_006291888.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
 gb|EOA24786.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
Length=190

 Score =   169 bits (428),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 9/113 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKES          AK ADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESA---------AKPADKSTPELTR  83

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ A  FSGTQEKCATC KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  84   TPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  136


 Score = 65.5 bits (158),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 57.4 bits (137),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  122  SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  167


 Score = 42.7 bits (99),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  92   FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  124


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   177 bits (448),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKE+G+F+KNFQ+    ++K   +L R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKETGSFSKNFQT--GKSEKQNDQLAR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KTAYPLEKVT+E +SYHKSCFKCSHGGC LTPS
Sbjct  91   APSKLSSMFSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHGGCPLTPS  143


 Score = 57.4 bits (137),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT QKCKAC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MSFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCF  35


 Score = 55.8 bits (133),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S Y++++G+LYCK HF QLFKE GN+N
Sbjct  129  SCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYN  169


 Score = 43.9 bits (102),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KT YP+E ++ +G +YHKS  
Sbjct  99   FSGTQDKCAACKKTAYPLEKVTLEGESYHKSCF  131



>ref|XP_003558280.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=195

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA-DKLTPELT  466
            +CF+C HCK TL  S+YSS EGV YCKPHF QLFKE+G++NK+FQSPAKSA +KLTPELT
Sbjct  32   ACFKCHHCKSTLSFSSYSSFEGVPYCKPHFAQLFKETGSYNKSFQSPAKSALEKLTPELT  91

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            RSPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE +SYHKSCFKCSHGGC+L+PS
Sbjct  92   RSPSKAAGMFSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCFKCSHGGCALSPS  145


 Score = 58.2 bits (139),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  131  SCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSYN  171


 Score = 38.5 bits (88),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCF  133


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H++CFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGAVFHRACFKCHH  38



>ref|XP_010273176.1| PREDICTED: LIM domain-containing protein PLIM2c [Nelumbo nucifera]
Length=200

 Score =   174 bits (440),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSS++GVLYCKPHFEQLFKESGNF+KNFQ+      +   + ++
Sbjct  33   SCFKCSHCKGTLVMSNYSSLDGVLYCKPHFEQLFKESGNFSKNFQT---GKSEKPSDGSK  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMF GTQ+KCATC KTAYPLEKVTVE +SYHKSCFKCSHGGCSLTPS
Sbjct  90   APSKLSSMFCGTQDKCATCHKTAYPLEKVTVEGESYHKSCFKCSHGGCSLTPS  142


 Score = 56.2 bits (134),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT QKCKAC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MAFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCF  35


 Score = 57.0 bits (136),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH   +L  SNY++++G+LYCK HF QLFKE G++N
Sbjct  128  SCFKCSHGGCSLTPSNYAALDGILYCKHHFAQLFKEKGSYN  168


 Score = 43.1 bits (100),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +G +YHKS  
Sbjct  98   FCGTQDKCATCHKTAYPLEKVTVEGESYHKSCF  130



>ref|XP_006339787.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=221

 Score =   176 bits (445),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHC+GTL +SNYSSM+G+LYCK HFEQLFKESGNF+KNFQ+PAKS  +    LTR
Sbjct  33   SCFKCSHCRGTLVMSNYSSMDGILYCKTHFEQLFKESGNFSKNFQNPAKSERQ--NSLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC+LT
Sbjct  91   APSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALT  141


 Score = 53.5 bits (127),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KC AC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCF  35


 Score = 49.7 bits (117),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP--AKSADKLTP  457
            SCF+C+H    L  + Y+S++G LYCK HF QLF E GN+    ++    K++  +TP
Sbjct  129  SCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAANNKKNSAAITP  186


 Score = 45.1 bits (105),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCF  131



>ref|XP_006438563.1| hypothetical protein CICLE_v10033840mg, partial [Citrus clementina]
 gb|ESR51803.1| hypothetical protein CICLE_v10033840mg, partial [Citrus clementina]
Length=160

 Score =   174 bits (440),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 12/118 (10%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGN NKNFQSPA+  +K T
Sbjct  27   VVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNINKNFQSPARLVEKST  86

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAAS+            KT  PLEKV VE+Q+YHK+CFKCSHGGCS++PS
Sbjct  87   PELTRSPSKAASI------------KTVCPLEKVAVESQAYHKTCFKCSHGGCSISPS  132


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SFIGTQQK K  EKTVYPVE LS DG+ YHKS  
Sbjct  1    SFIGTQQKYKVYEKTVYPVEQLSDDGVVYHKSCF  34



>gb|KDO39245.1| hypothetical protein CISIN_1g040725mg, partial [Citrus sinensis]
Length=164

 Score =   174 bits (440),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 12/118 (10%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGN NKNFQSPA+  +K T
Sbjct  31   VVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNINKNFQSPARLVEKST  90

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PELTRSPSKAAS+            KT  PLEKV VE+Q+YHK+CFKCSHGGCS++PS
Sbjct  91   PELTRSPSKAASI------------KTVCPLEKVAVESQAYHKTCFKCSHGGCSISPS  136


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  184  KRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            K  SFIGTQQK K  EKTVYPVE LS DG+ YHKS  
Sbjct  2    KAKSFIGTQQKYKVYEKTVYPVEQLSDDGVVYHKSCF  38



>ref|XP_009397610.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   174 bits (442),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 101/113 (89%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+G+LYCKPHFEQLFKE+G+F+K F + +KS +K   EL+R
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGILYCKPHFEQLFKETGSFSKKFPTSSKSGEK---ELSR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA+C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  90   TPSKVSSMFSGTQDKCASCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTPS  142


 Score = 53.1 bits (126),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 55.1 bits (131),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   TL  S+Y++++G+LYCK HF QLFKE G++N
Sbjct  128  TCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYN  168


 Score = 43.5 bits (101),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KT YP+E L+ +G +YHK+  
Sbjct  98   FSGTQDKCASCKKTAYPLEKLTVEGESYHKTCF  130



>gb|EMT19855.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=223

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 104/135 (77%), Gaps = 22/135 (16%)
 Frame = +2

Query  290  SCFRCSHCKGTLK-------------------LSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+C HCK TL                     S+YSS EGV YCKPHF QLFKE+G++N
Sbjct  32   ACFKCHHCKSTLSNRVPRIGDHDFVQFAFSGLFSSYSSFEGVPYCKPHFAQLFKETGSYN  91

Query  413  KNFQS--PAKSA-DKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHK  583
            K+FQS  PAKSA +KLTPELTRSPSKAA MFSGTQ+KCATCGKTAYPLEKVTVE +SYHK
Sbjct  92   KSFQSQSPAKSATEKLTPELTRSPSKAAGMFSGTQDKCATCGKTAYPLEKVTVEEKSYHK  151

Query  584  SCFKCSHGGCSLTPS  628
            SCFKCSHGGC+L+PS
Sbjct  152  SCFKCSHGGCALSPS  166


 Score = 57.8 bits (138),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  152  SCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSYN  192


 Score = 38.5 bits (88),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E ++ +  +YHKS  
Sbjct  122  FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCF  154


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  491  MFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            MFSGTQ+KC  C KT YP+++++ +   +H++CFKC H
Sbjct  1    MFSGTQQKCKVCTKTVYPMDQLSTDGAVFHRACFKCHH  38



>ref|XP_008796793.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=205

 Score =   173 bits (439),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCKPHFEQLFKE+G+F K F + AKS DK   EL R
Sbjct  33   TCFKCSHCKGNLTMCSYSSMDGVLYCKPHFEQLFKETGSFTKKFPTGAKSGDK--NELNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK + MFSGTQ+KCA+C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  91   TPSKVSYMFSGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPS  143


 Score = 53.1 bits (126),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 56.2 bits (134),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK-NFQSPAKSADKLTPELT  466
            +CF+CSH   TL  S+Y++++G+LYCK HF QLFKE G++N  N  +  K +  +  E  
Sbjct  129  TCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYNHLNKAASMKRSAAIEQEQE  188

Query  467  RSPSKAASMFSGTQEK  514
            ++ ++ A      QE+
Sbjct  189  QALAETAPELEQDQEQ  204


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C KT YP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCASCNKTAYPLEKITVEGESYHKTCF  131



>ref|NP_001288583.1| uncharacterized protein LOC101266456 [Solanum lycopersicum]
 gb|AGV29549.1| PLIM2a [Solanum lycopersicum]
Length=223

 Score =   172 bits (437),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+G+LYCK HFEQLFKESGNF+KNFQ+ AKS  +    LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGILYCKTHFEQLFKESGNFSKNFQNSAKS--ERQNSLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK +++FSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC+LT
Sbjct  91   APSKLSALFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALT  141


 Score = 53.9 bits (128),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KC AC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  + Y+S++G LYCK HF QLF E GN+
Sbjct  129  SCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNY  168


 Score = 45.4 bits (106),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCF  131



>ref|XP_011469034.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=217

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNF   AKSA+K    L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGVLYCKPHFEQLFKESGNFSKNF--AAKSAEKQNEVLNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCATC KT YPLEKVT+E +SYHKSCF+C+HGGC LT S
Sbjct  91   APSKLSSMFSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHS  143


 Score = 54.7 bits (130),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK  448
            SCFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+  K   K
Sbjct  129  SCFRCAHGGCPLTHSSYAALDGILYCKVHFAQLFMEKGNYSHVLQAAKKHQPK  181


 Score = 43.5 bits (101),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G +YHKS  
Sbjct  99   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCF  131


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKACEKTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCF  35



>ref|XP_004306805.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=216

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNF   AKSA+K    L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGVLYCKPHFEQLFKESGNFSKNF---AKSAEKQNEVLNR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCATC KT YPLEKVT+E +SYHKSCF+C+HGGC LT S
Sbjct  90   APSKLSSMFSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHS  142


 Score = 54.7 bits (130),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK  448
            SCFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+  K   K
Sbjct  128  SCFRCAHGGCPLTHSSYAALDGILYCKVHFAQLFMEKGNYSHVLQAAKKHQPK  180


 Score = 43.5 bits (101),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G +YHKS  
Sbjct  98   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCF  130


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKACEKTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCF  35



>ref|XP_010905119.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=208

 Score =   172 bits (437),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCKPHFEQLFKE+G+F K F + AKS DK   EL R
Sbjct  33   TCFKCSHCKGNLTMCSYSSMDGVLYCKPHFEQLFKETGSFTKKFPTGAKSGDK--NELNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK + MFSGTQ+KCA+C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  91   TPSKVSYMFSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPS  143


 Score = 53.1 bits (126),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 55.1 bits (131),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   TL  S+Y++++G+LYCK HF QLFKE G++N
Sbjct  129  TCFKCSHGGCTLTPSSYAAIDGILYCKHHFAQLFKEKGSYN  169


 Score = 42.4 bits (98),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KT YP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCF  131



>gb|AAK49580.1|AF370574_1 transcription factor L2 [Arabidopsis thaliana]
Length=148

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  347  MEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCATC  526
            MEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCATC
Sbjct  1    MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC  60

Query  527  GKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             KT YP+EKVTVE+Q+YHKSCFKCSHGGC ++PS
Sbjct  61   SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPS  94


 Score = 56.6 bits (135),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N
Sbjct  80   SCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN  120


 Score = 42.7 bits (99),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC  C KTVYP+E ++ +   YHKS  
Sbjct  50   FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCF  82



>ref|XP_009762122.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|ACB05475.1| LIM domain protein 2b [Nicotiana tabacum]
Length=216

 Score =   171 bits (432),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKE GNF+KNFQ+ AK   +  
Sbjct  28   ITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKECGNFSKNFQTSAKPEREHA  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
              LTR+PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  88   --LTRTPSKLSAMFSGTQDKCAACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  141


 Score = 54.3 bits (129),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCF  35


 Score = 48.5 bits (114),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  + Y+S++GVLYCK HF QLF E G +
Sbjct  129  SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTY  168


 Score = 44.3 bits (103),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGESFHKSCF  131



>ref|XP_009624528.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=207

 Score =   170 bits (431),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKE GNF+KNFQ+ AK   +  
Sbjct  28   ITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKECGNFSKNFQTTAKPERE--  85

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
              LTR+PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  86   HALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  141


 Score = 54.3 bits (129),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+H    L  + Y+S++GVLYCK HF QLF E G +    +  A +  K+  E T 
Sbjct  129  SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLE--AANHKKINNEATN  186

Query  470  SPS  478
              +
Sbjct  187  KET  189


 Score = 44.3 bits (103),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCF  131



>emb|CDX71757.1| BnaC08g31170D [Brassica napus]
Length=216

 Score =   172 bits (437),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+  K+ DK + E+TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTAGKT-DK-SNEMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHS  143


 Score = 50.1 bits (118),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            +CFRC+H    L  S+Y+++ G+LYCK HF QLF E GN+
Sbjct  129  TCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNY  168


 Score = 45.1 bits (105),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score =   166 bits (421),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   +CF+CSHC G L +S+YSSM+GVLYCKPHFEQLFKE+G+F K FQS     D   
Sbjct  245  VVYHKTCFKCSHCNGLLVISSYSSMDGVLYCKPHFEQLFKETGSFTKKFQSGKPQND---  301

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             +LTR+PSK +S+FSGTQ+KCA C KT YPLEKVTVE + YHKSCF+CSHGGC LTPS
Sbjct  302  -QLTRAPSKLSSLFSGTQDKCAVCTKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPS  358


 Score = 57.0 bits (136),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  157  LLRDFRSTKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKS  288
            LLR F   +++MSF GTQQKCKAC+KTV+ ++ LSADG+ YHK+
Sbjct  208  LLRCF-GQERKMSFSGTQQKCKACDKTVHFIDALSADGVVYHKT  250


 Score = 54.3 bits (129),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    L  S+Y+++EG+LYCK HF QLF E G++N
Sbjct  344  SCFRCSHGGCFLTPSSYAALEGILYCKHHFAQLFMEKGSYN  384


 Score = 42.4 bits (98),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKS  288
            F GTQ KC  C KTVYP+E ++ +G  YHKS
Sbjct  314  FSGTQDKCAVCTKTVYPLEKVTVEGEFYHKS  344



>ref|NP_001154680.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79439.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=127

 Score =   158 bits (399),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS+YSSMEGVLYCKPHFEQLFKESG+FNKNFQSPAKSADK TPELTR
Sbjct  33   SCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTV  562
            +PS+ A  FSGTQEKCATC KT YP+EKV V
Sbjct  93   TPSRVAGRFSGTQEKCATCSKTVYPIEKVYV  123


 Score = 65.5 bits (158),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKACEKTVY VELLSADG+ YHKS  
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCF  35


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT Y +E ++ +   YHKSCFKC+H
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTH  39



>ref|XP_008232792.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
Length=217

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNFQ   KSA+K   +L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQ--PKSAEKQNEQLNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGT +KCATC KT YPLEKVT+E +SYHKSCF+C+HGGC LT S
Sbjct  91   APSKLSSMFSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHS  143


 Score = 54.7 bits (130),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            SCFRC+H    L  S+Y++++GVLYCK HF QLF E GN++   Q+ A
Sbjct  129  SCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA  176


 Score = 40.4 bits (93),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KTVYP+E ++ +G +YHKS  
Sbjct  99   FSGTLDKCATCSKTVYPLEKVTLEGESYHKSCF  131


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCF  35



>ref|XP_008777895.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=204

 Score =   169 bits (429),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + NYSSM+GVLYCKPHFEQLFKE+G+F K F + AK  +    EL R
Sbjct  33   TCFKCSHCKGNLTMCNYSSMDGVLYCKPHFEQLFKETGSFTKKFPTGAKDKN----ELNR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK + MFSGTQ+KCA+C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  89   TPSKVSYMFSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPS  141


 Score = 53.1 bits (126),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 55.1 bits (131),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   TL  S+Y++++G+LYCK HF QLFKE G++N
Sbjct  127  TCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYN  167


 Score = 42.4 bits (98),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KT YP+E ++ +G +YHK+  
Sbjct  97   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCF  129



>ref|XP_011093154.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=218

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  278  ITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            I   SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AKS  + + 
Sbjct  30   IFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTGAKSERENS-  88

Query  458  ELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             LTR+PSK +++FSGTQ+KC  C KT YPLEKVT+E +S+H+SCFKC+HGGC LT S
Sbjct  89   -LTRTPSKLSALFSGTQDKCPACNKTVYPLEKVTMEGESFHRSCFKCAHGGCPLTHS  144


 Score = 53.1 bits (126),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+    ++     + + P
Sbjct  130  SCFKCAHGGCPLTHSSYAALDGILYCKHHFQQLFMEKGNYQHVLKAANNKKNAVEP  185


 Score = 43.9 bits (102),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 6/60 (10%)
 Frame = +1

Query  121  FLQGLKGQIWTLLLRDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F  G K +    L R    T  ++S  F GTQ KC AC KTVYP+E ++ +G ++H+S  
Sbjct  77   FQTGAKSERENSLTR----TPSKLSALFSGTQDKCPACNKTVYPLEKVTMEGESFHRSCF  132



>emb|CDY56926.1| BnaAnng14450D [Brassica napus]
Length=212

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQS  K+  + T ++TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQSAGKT--EKTNDVTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KC  C KT YPLEK+T+E +SYHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSFFSGTQDKCPACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHS  143


 Score = 55.8 bits (133),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPE  460
            +CFRC+H    L  S+Y+++ GVLYCK HF QLF E GN+N   Q+   + ++ TPE
Sbjct  129  TCFRCAHGGCPLTHSSYAALNGVLYCKVHFSQLFLEKGNYNHVLQA---ANNRRTPE  182


 Score = 45.1 bits (105),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCPACKKTVYPLEKITMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMRYHKSCFRCSH  39



>ref|XP_009391810.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   168 bits (426),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG+L + NYSSM+G+LYCKPHFEQLFKESG+F K F + AKS ++   EL++
Sbjct  33   TCFKCSHCKGSLSMCNYSSMDGILYCKPHFEQLFKESGSFTKKFPTGAKSGER--NELSK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            SPSK + MF+GTQ+KC +C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  91   SPSKISYMFTGTQDKCVSCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTPS  143


 Score = 53.5 bits (127),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 55.1 bits (131),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   TL  S+Y+++EG++YCK HF QLFKE G++N
Sbjct  129  TCFKCSHGGCTLTPSSYAALEGIIYCKHHFAQLFKEKGSYN  169


 Score = 43.1 bits (100),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KT YP+E L+ +G +YHK+  
Sbjct  99   FTGTQDKCVSCKKTAYPLEKLTVEGESYHKTCF  131



>ref|XP_009779198.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=217

 Score =   170 bits (430),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ +K   + +  LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTASKPERENS--LTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK +++FSGTQ+KCA C KT YPLEKVT+E +++HKSCFKC+HGGC LT
Sbjct  91   APSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLT  141


 Score = 52.0 bits (123),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCF  35


 Score = 50.4 bits (119),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 6/59 (10%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN------KNFQSPAKSADK  448
            SCF+C+H    L  + Y++++GVLYCK HF QLF E GN+        N ++ A+ AD+
Sbjct  129  SCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLKAANNKKNSAEKADE  187


 Score = 43.5 bits (101),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  +HKS  
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCF  131



>ref|XP_009762983.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=212

 Score =   168 bits (426),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSMEGVLYCK HFEQLFKESGNF KNFQ+   S  +    LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMEGVLYCKTHFEQLFKESGNFTKNFQN---SKAERQNSLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  90   APSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  140


 Score = 53.1 bits (126),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KC AC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--PAKSADKLTP  457
            SCF+C+H    L  + Y+S++G LYCK HF QLF E GN+    ++    KS+  +TP
Sbjct  128  SCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAVNNKKSSAAVTP  185


 Score = 45.1 bits (105),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCF  130



>ref|XP_008337059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008343387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=219

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF KNF   AKSA+K   +L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGVLYCKPHFEQLFKESGNFGKNF---AKSAEKQGEQLNR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMF GTQ+KCATC KT YPLEKVT+E +SYHKSCF+C+HGGC LT S
Sbjct  90   APSKLSSMFCGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHS  142


 Score = 54.7 bits (130),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            SCFRC+H    L  S+Y++++GVLYCK HF QLF E GN++   Q+ A
Sbjct  128  SCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA  175


 Score = 43.9 bits (102),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G +YHKS  
Sbjct  98   FCGTQDKCATCSKTVYPLEKVTLEGESYHKSCF  130



>ref|XP_008376025.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=221

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+G+LYCKPHFEQLFKESGNF+KNF   AKSA+K   +L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGILYCKPHFEQLFKESGNFSKNF---AKSAEKQGEQLNR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK +++FSGTQ+KCATC KT YPLEKVT+E +SYHKSCF+C HGGC+LT S
Sbjct  90   VPSKLSALFSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCXHGGCALTHS  142


 Score = 55.1 bits (131),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            SCFRC H    L  S+Y++++GVLYCK HF QLF E GN++   Q+ A
Sbjct  128  SCFRCXHGGCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA  175


 Score = 43.5 bits (101),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G +YHKS  
Sbjct  98   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCF  130


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY  E+LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCF  35



>ref|XP_009624529.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=206

 Score =   167 bits (423),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKE GNF+KNFQ+     +   
Sbjct  28   ITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKECGNFSKNFQTTKPEREH--  85

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
              LTR+PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  86   -ALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  140


 Score = 54.3 bits (129),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+H    L  + Y+S++GVLYCK HF QLF E G +    +  A +  K+  E T 
Sbjct  128  SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLE--AANHKKINNEATN  185

Query  470  SPS  478
              +
Sbjct  186  KET  188


 Score = 44.3 bits (103),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  98   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCF  130



>ref|XP_002882034.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58293.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ+     +K    LTR
Sbjct  33   SCFRCSHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQT--GKTEKPNDHLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E +SYHK+CF+CSH GC LT S
Sbjct  91   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCSHSGCPLTHS  143


 Score = 58.5 bits (140),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK------NFQSPAKSADKL  451
            +CFRCSH    L  S+Y+S+ GVLYCK HF QLF E G++N       N +  A S    
Sbjct  129  TCFRCSHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGAS  188

Query  452  TPELTRSPSKAASMFSGTQEK  514
             P     P  +AS+  G +++
Sbjct  189  PPSDDHKPEDSASIPEGKEDE  209


 Score = 42.7 bits (99),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCATCKKTVYPLEKVTMEGESYHKTCF  131


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSH  39



>gb|KFK37370.1| hypothetical protein AALP_AA4G247900 [Arabis alpina]
Length=232

 Score =   171 bits (432),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+     +K   +LTR
Sbjct  33   SCFKCSHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQN--GKTEKTNDQLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E +SYHK+CF+C+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHS  143


 Score = 53.9 bits (128),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  129  TCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  176


 Score = 42.7 bits (99),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC  C KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ + +E  +YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLNLEGNTYHKSCFKCSH  39



>ref|NP_182104.1| protein PLIM2A [Arabidopsis thaliana]
 sp|O80839.1|PLI2A_ARATH RecName: Full=LIM domain-containing protein PLIM2a; AltName: 
Full=Pollen-expressed LIM protein 2; Short=AtPLIM2 [Arabidopsis 
thaliana]
 gb|AAC28544.1| putative LIM-domain protein [Arabidopsis thaliana]
 dbj|BAC42675.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAO64006.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AEC10602.1| protein PLIM2A [Arabidopsis thaliana]
Length=226

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ  A   +K    LTR
Sbjct  33   SCFRCTHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQ--AGKTEKPNDHLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E +SYHK+CF+C+H GC LT S
Sbjct  91   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHS  143


 Score = 55.1 bits (131),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 6/74 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK------NFQSPAKSADKL  451
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N       N +  A S    
Sbjct  129  TCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGAS  188

Query  452  TPELTRSPSKAASM  493
             P     P   AS+
Sbjct  189  PPSDDHKPDDTASI  202


 Score = 42.7 bits (99),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCATCKKTVYPLEKVTMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+C+H
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTH  39



>ref|XP_009601147.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF75828.1|AF116851_1 LIM domain protein PLIM-2 [Nicotiana tabacum]
Length=212

 Score =   167 bits (424),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSMEGVLYCK HFEQLFKESGNF KNFQ+   S  +    LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMEGVLYCKHHFEQLFKESGNFTKNFQN---SKAERQNSLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  90   APSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  140


 Score = 53.1 bits (126),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KC AC+KTVY V+LLSADG+ YHKS  
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCF  35


 Score = 49.7 bits (117),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP--AKSADKLTP  457
            SCF+C+H    L  + Y+S++G LYCK HF QLF E GN+    ++    KS+  +TP
Sbjct  128  SCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAANNKKSSAAVTP  185


 Score = 45.1 bits (105),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G ++HKS  
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCF  130



>ref|XP_010907367.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=200

 Score =   167 bits (424),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + NYSSM+GVLYCKPHFEQLFKE+G+F K F + AK  +    EL R
Sbjct  33   TCFKCSHCKGNLTMCNYSSMDGVLYCKPHFEQLFKETGSFTKKFPTGAKDKN----ELNR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK + MF GTQ+KCA+C KTAYPLEK+TVE +SYHK+CFKCSHGGC+LTPS
Sbjct  89   TPSKVSYMFCGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPS  141


 Score = 53.1 bits (126),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 55.1 bits (131),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   TL  S+Y++++G+LYCK HF QLFKE G++N
Sbjct  127  TCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYN  167


 Score = 43.1 bits (100),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C KT YP+E ++ +G +YHK+  
Sbjct  97   FCGTQDKCASCNKTAYPLEKITVEGESYHKTCF  129



>ref|XP_009138785.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Brassica 
rapa]
 emb|CDX89105.1| BnaA04g00810D [Brassica napus]
Length=211

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQS  K+  + + ++TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQSAGKT--EKSNDVTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+ +E +SYHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHS  143


 Score = 54.7 bits (130),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H    L  S+Y+++ G+LYCK HF QLF E GN+N   ++         DK+ P
Sbjct  129  TCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHRRTSEEDKIEP  188

Query  458  ELTRSPSK  481
             +  +  K
Sbjct  189  NVNDASPK  196


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_006397773.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
 gb|ESQ39226.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
Length=228

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+     +K    LTR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTG--KTEKPNDHLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E +SYHK+CF+C+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHS  143


 Score = 53.9 bits (128),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  129  TCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  176


 Score = 42.7 bits (99),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC  C KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCF  131


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH   +L  S
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVIS  47



>ref|XP_004248581.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Solanum 
lycopersicum]
Length=212

 Score =   163 bits (413),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+C+HCKGTL +SNYSSM+GVLYCK HFEQLFKE GNF+KNFQ+  K  DK  
Sbjct  28   ITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKECGNFSKNFQTSPK-PDKEN  86

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
              L R+PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  87   A-LARTPSKLSAMFSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  141


 Score = 56.6 bits (135),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LLSADGI YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP--AKSADK  448
            SCF+C+H    L  + Y+S++G+LYCK HF QLF E G +    ++    K+AD+
Sbjct  129  SCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQHVLEAANNKKNADQ  183


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCF  131



>ref|XP_009116783.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDY48936.1| BnaA09g39010D [Brassica napus]
Length=218

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNF +  K+  + + ++TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFHTAGKT--EKSNDVTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHS  143


 Score = 52.4 bits (124),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CFRC+H    L  S+Y+++ G+LYCK HF QLF E GN+N
Sbjct  129  TCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYN  169


 Score = 45.1 bits (105),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_006431569.1| hypothetical protein CICLE_v10003359mg [Citrus clementina]
 gb|ESR44809.1| hypothetical protein CICLE_v10003359mg [Citrus clementina]
Length=167

 Score =   160 bits (405),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 91/118 (77%), Gaps = 12/118 (10%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHCKGTLKLSNYSS+EGVLYCKPHFEQL KES NFNKNFQ PAKSA+KLT
Sbjct  28   VVYHKSCFKCSHCKGTLKLSNYSSLEGVLYCKPHFEQLLKESSNFNKNFQLPAKSAEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PEL RSPSK AS+            KT  P EKV  ENQ+ HK+CFKCSHGG S++PS
Sbjct  88   PELRRSPSKVASI------------KTVCPWEKVAAENQASHKTCFKCSHGGYSISPS  133


 Score = 59.3 bits (142),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCK CEKTV PVE LS DG+ YHKS  
Sbjct  1    MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCF  35


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   ++  SNY+++EG+LYCK +F QLFKE G++N
Sbjct  119  TCFKCSHGGYSISPSNYAALEGILYCKHNFSQLFKEKGSYN  159


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT  P+E+++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSH  39



>ref|XP_006341718.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=212

 Score =   163 bits (412),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    SCF+C+HCKGTL +SNYSSM+GVLYCK HFEQLFKE GNF+KNFQ+  K  DK  
Sbjct  28   ITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKECGNFSKNFQTSPK-PDKEN  86

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
              L R+PSK ++MFSGTQ+KCA C KT YPLEKVT+E +S+HKSCFKC+HGGC LT
Sbjct  87   A-LARTPSKLSAMFSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLT  141


 Score = 56.6 bits (135),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LLSADGI YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCF  35


 Score = 48.9 bits (115),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP--AKSADK  448
            SCF+C+H    L  + Y+S++G+LYCK HF QLF E G +    ++    K+AD+
Sbjct  129  SCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQHVLEAANNKKNADQ  183


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G ++HKS  
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCF  131



>emb|CDP08845.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   168 bits (426),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNF +     +     LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFNTGKHEREN---SLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +++FSGTQ+KCA C KT YPLEKVT+E +SYHKSCFKC+HGGC LT S
Sbjct  90   APSKLSALFSGTQDKCAACSKTVYPLEKVTMEGESYHKSCFKCAHGGCPLTHS  142


 Score = 50.8 bits (120),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +H+S  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHRSCF  35


 Score = 52.4 bits (124),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            SCF+C+H    L  S+Y++++G+LYCK HF QLF E GN+    ++       + P
Sbjct  128  SCFKCAHGGCPLTHSSYAALDGILYCKHHFAQLFMEKGNYQHVLKAATHKKSAVAP  183


 Score = 45.4 bits (106),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G +YHKS  
Sbjct  98   FSGTQDKCAACSKTVYPLEKVTMEGESYHKSCF  130



>ref|XP_009629648.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   167 bits (423),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+ +K   + +  LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTASKPERENS--LTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK +++FSGTQ+KCA C KT YPLEKVT+E +++HKSCFKC+HGGC LT
Sbjct  91   APSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLT  141


 Score = 52.0 bits (123),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCF  35


 Score = 50.4 bits (119),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  + Y++++GVLYCK HF QLF E GN+
Sbjct  129  SCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNY  168


 Score = 43.5 bits (101),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  +HKS  
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCF  131



>ref|XP_009629647.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=218

 Score =   167 bits (422),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+ +   ++    LTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTASAKPERENS-LTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK +++FSGTQ+KCA C KT YPLEKVT+E +++HKSCFKC+HGGC LT
Sbjct  92   APSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLT  142


 Score = 52.0 bits (123),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCF  35


 Score = 50.4 bits (119),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  + Y++++GVLYCK HF QLF E GN+
Sbjct  130  SCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNY  169


 Score = 43.5 bits (101),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  +HKS  
Sbjct  100  FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCF  132



>gb|EPS71497.1| hypothetical protein M569_03263, partial [Genlisea aurea]
Length=215

 Score =   168 bits (425),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+     DK     ++
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTSKHVVDKEN-YGSK  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P+K ++MFSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKC+HGGC LT S
Sbjct  92   APNKVSAMFSGTQDKCAACSKTVYPLEKMTMEGESYHKSCFKCAHGGCPLTHS  144


 Score = 50.8 bits (120),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +F GT  KCKAC+KTVY V+LLSADG  YHKS  
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCF  35


 Score = 52.0 bits (123),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+
Sbjct  130  SCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNY  169


 Score = 46.2 bits (108),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G +YHKS  
Sbjct  100  FSGTQDKCAACSKTVYPLEKMTMEGESYHKSCF  132



>ref|XP_009369042.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
 ref|XP_009350652.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=219

 Score =   164 bits (415),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    +CF+CSHC G L +S+YSSM+GVLYCKPHFEQLFKE+GNF+K FQ+  KS +   
Sbjct  28   IAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKPHFEQLFKETGNFSKKFQTSGKSQN---  84

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             ELTR+PSK +SMFSGT +KCA C KT YPLEKVT+E   YHKSCF+C+HGGC L+PS
Sbjct  85   -ELTRTPSKLSSMFSGTVDKCAVCNKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPS  141


 Score = 54.7 bits (130),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+  
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCF  35


 Score = 49.7 bits (117),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRC+H    L  SN ++++G+LYCK HF QLFKE G+++
Sbjct  127  SCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYS  167


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KTVYP+E ++ +G  YHKS  
Sbjct  97   FSGTVDKCAVCNKTVYPLEKVTMEGDFYHKSCF  129


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT + +++++ +  +YHK+CFKCSH
Sbjct  3    FSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSH  39



>ref|XP_009387955.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=186

 Score =   166 bits (419),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            +I   SCFRCSHC GTL + NYSSMEGVLYCKPHFEQLFKE+G F K F +  K+ ++  
Sbjct  28   VIYHKSCFRCSHCNGTLSMCNYSSMEGVLYCKPHFEQLFKETGTFTKKFPTGIKAGER--  85

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             EL+++PSK +SMFSGTQ+KCA+C KTAYPLE +T+E +SYHK+CFKCS GGC+LTPS
Sbjct  86   NELSKTPSKFSSMFSGTQDKCASCKKTAYPLETLTMEGESYHKTCFKCSVGGCTLTPS  143


 Score = 52.8 bits (125),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKACEKTV+ ++LLSADG+ YHKS  
Sbjct  1    MSFSGTLDKCKACEKTVHFIDLLSADGVIYHKSCF  35


 Score = 43.5 bits (101),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KT YP+E L+ +G +YHK+  
Sbjct  99   FSGTQDKCASCKKTAYPLETLTMEGESYHKTCF  131


 Score = 41.2 bits (95),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CF+CS    TL  S+ +++ G+LYCK HF +LF E G+++   Q+
Sbjct  129  TCFKCSVGGCTLTPSSCAALNGILYCKHHFARLFMEKGSYSHVIQA  174



>ref|XP_004240106.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Solanum 
lycopersicum]
Length=228

 Score =   166 bits (419),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ +KS       L +
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTSSKSE--KESSLAK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK ++MFSGTQ+KCA C KT YPLEKV +E +++HKSCFKC+HGGC+LT
Sbjct  91   APSKVSAMFSGTQDKCAACSKTVYPLEKVILEGEAFHKSCFKCAHGGCALT  141


 Score = 52.0 bits (123),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCF  35


 Score = 51.2 bits (121),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            SCF+C+H    L  + Y++++GVLYCK HF QLF E G++    ++       +TP
Sbjct  129  SCFKCAHGGCALTHATYAALDGVLYCKHHFAQLFMEKGSYQHVLKATTNKKSTVTP  184


 Score = 41.6 bits (96),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E +  +G  +HKS  
Sbjct  99   FSGTQDKCAACSKTVYPLEKVILEGEAFHKSCF  131



>ref|XP_006402504.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
 gb|ESQ43957.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
Length=214

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+  K+  +   E+TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTAGKT--EKPNEMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  143


 Score = 56.6 bits (135),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS-----ADKLT  454
            +CFRC+H    L  S+Y+++ G+LYCK HF QLF E GN+N   Q+ A        DK+ 
Sbjct  129  TCFRCAHSGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLQAAANQRRTPVEDKIE  188

Query  455  PELTRS-PSKAASMFSGTQ  508
            P    + PS+  +  +G +
Sbjct  189  PNGNEANPSEEKASDAGPE  207


 Score = 45.4 bits (106),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_002965335.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
 ref|XP_002977179.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ21788.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ34173.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
Length=185

 Score =   164 bits (415),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   +CFRC HCKGTLKLSNY+S+EGVLYCKPHF+QLFK +G+F+K+F+S       + 
Sbjct  31   VVYHKACFRCHHCKGTLKLSNYASLEGVLYCKPHFDQLFKLTGSFDKSFES-GLLHKPVG  89

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             E +++PSK + +FSGTQEKC  CGKT YP+EKVTVEN SYHKSCFKCSHGGC+++PS
Sbjct  90   EEASKTPSKTSLLFSGTQEKCFACGKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPS  147


 Score = 53.1 bits (126),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             SF GTQQKCKAC+KTVY V+ L+ADG+ YHK+  
Sbjct  4    FSFAGTQQKCKACDKTVYLVDQLTADGVVYHKACF  38


 Score = 55.8 bits (133),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADK  448
            SCF+CSH   T+  SNY + EG LYC+ H+ QL KE G+F+   ++P K+A K
Sbjct  133  SCFKCSHGGCTISPSNYQAHEGRLYCRHHYAQLVKEKGDFSNLSKTPGKAAAK  185


 Score = 45.1 bits (105),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K  + F GTQ+KC AC KTVYP+E ++ +  +YHKS  
Sbjct  97   SKTSLLFSGTQEKCFACGKTVYPIEKVTVENTSYHKSCF  135



>ref|XP_010523732.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Tarenaya 
hassleriana]
Length=234

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSMEGVLYCKPHFEQLFKESGNF+KNFQ+  K+        TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMEGVLYCKPHFEQLFKESGNFSKNFQTAGKTEKSSDAPQTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  93   APNRLSSFFSGTQDKCAACQKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  145


 Score = 57.0 bits (136),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP-----AKSADKLT  454
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G++N   QS      A S+    
Sbjct  131  TCFRCAHSGCPLTHSSYAALDGVLYCKVHFNQLFLEKGSYNHVLQSANHRRTASSSSTPP  190

Query  455  PELT  466
            PELT
Sbjct  191  PELT  194


 Score = 45.8 bits (107),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTMEGESYHKTCF  133


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGMPYHKSCFRCSH  39



>ref|XP_009389159.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=200

 Score =   164 bits (416),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CS CKGTL + NYSS++G+LYCKPHFEQLFKE+G+F K F   AKS ++   EL R
Sbjct  33   TCFKCSRCKGTLSMCNYSSLDGILYCKPHFEQLFKETGSFTKKFPIGAKSGER--NELAR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
              S+ +SMFSGTQ+KCATC KTAYPLEK+TVE +SYHK+CFKCSHGGC LTPS
Sbjct  91   PASRVSSMFSGTQDKCATCHKTAYPLEKLTVEGESYHKTCFKCSHGGCKLTPS  143


 Score = 51.6 bits (122),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ +HK+  
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPFHKTCF  35


 Score = 53.5 bits (127),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH    L  S+Y+++EG++YCK HF QLFKE G++N
Sbjct  129  TCFKCSHGGCKLTPSSYAALEGIIYCKHHFAQLFKEKGSYN  169


 Score = 43.1 bits (100),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E L+ +G +YHK+  
Sbjct  99   FSGTQDKCATCHKTAYPLEKLTVEGESYHKTCF  131



>ref|XP_006431570.1| hypothetical protein CICLE_v10003747mg [Citrus clementina]
 gb|ESR44810.1| hypothetical protein CICLE_v10003747mg [Citrus clementina]
Length=162

 Score =   157 bits (396),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 12/118 (10%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   SCF+CSHCKGTLKLSNYSS+EG LYCKPHFEQL KES NFNKNFQ PAKSA+KLT
Sbjct  28   VVYHKSCFKCSHCKGTLKLSNYSSLEGALYCKPHFEQLLKESSNFNKNFQLPAKSAEKLT  87

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PEL RSPSK AS+            KT  P E V  ENQ+ HK+CFKCSHGG S++PS
Sbjct  88   PELRRSPSKVASI------------KTVCPWENVAAENQASHKTCFKCSHGGYSISPS  133


 Score = 59.3 bits (142),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSFIGTQQKCK CEKTV PVE LS DG+ YHKS  
Sbjct  1    MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCF  35


 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CF+CSH   ++  SNY+++EG+LYCK +F QLFKE G++N
Sbjct  119  TCFKCSHGGYSISPSNYAALEGILYCKHNFSQLFKEKGSYN  159


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F GTQ+KC  C KT  P+E+++ +   YHKSCFKCSH
Sbjct  3    FIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSH  39



>ref|XP_010474800.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
 ref|XP_010474801.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
Length=205

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELTR
Sbjct  33   SCFRCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKV +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 52.8 bits (125),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H   TL  S+Y+S++ VLYC+ HF QLF E GN+    Q+
Sbjct  127  TCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQA  172


 Score = 43.9 bits (102),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCF  129


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KC AC+KTVY V++LS +G+ YHKS  
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCF  35



>ref|XP_002283482.1| PREDICTED: LIM domain-containing protein WLIM2a [Vitis vinifera]
 emb|CBI34710.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   164 bits (415),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHC G L +SNYSSM+GVLYCKPHFEQLF+ESG+ +K FQS  K+      +L+R
Sbjct  33   TCFRCSHCNGPLVMSNYSSMDGVLYCKPHFEQLFRESGSLSKKFQSSGKA------DLSR  86

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KC+ C KT YPLEKVTVE + YHKSCF+CSHGGC LTPS
Sbjct  87   TPSKLSSMFSGTQDKCSLCKKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPS  139


 Score = 52.0 bits (123),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT QKCKAC+KTV+ ++ +SADGI YHK+  
Sbjct  1    MSFSGTTQKCKACDKTVHIIDTISADGIAYHKTCF  35


 Score = 56.2 bits (134),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    L  S+Y++++G+LYCKPHF QLF+E G+++
Sbjct  125  SCFRCSHGGCFLTPSSYAALDGILYCKPHFTQLFRERGSYS  165


 Score = 43.5 bits (101),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +1

Query  166  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHKS  
Sbjct  83   DLSRTPSKLSSMFSGTQDKCSLCKKTVYPLEKVTVEGEFYHKSCF  127



>ref|XP_011023373.1| PREDICTED: LIM domain-containing protein PLIM2b [Populus euphratica]
Length=203

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F+KNFQ   K   + T ELTR
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSKNFQ---KGKPERTHELTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KC+TCGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   TPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 50.8 bits (120),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA--KSADKLTPEL  463
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++         +S     PEL
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKRSTSTPPPEL  187

Query  464  TRSPSKAAS  490
                ++ A+
Sbjct  188  AEPNTEEAA  196


 Score = 41.6 bits (96),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCF  130


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+++S +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCF  35



>ref|XP_010544716.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Tarenaya hassleriana]
Length=234

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+  K+        TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQASGKTDKPNDAPPTR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GCSLT S
Sbjct  93   APNRLSSFFSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHS  145


 Score = 54.7 bits (130),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H   +L  S+Y+++ GVLYCK HF QLF E G++N   QS
Sbjct  131  TCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYNHVLQS  176


 Score = 45.8 bits (107),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCF  133


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSH  39



>ref|NP_171683.1| LIM family protein [Arabidopsis thaliana]
 sp|Q1ECF5.1|PLI2B_ARATH RecName: Full=LIM domain-containing protein PLIM2b; AltName: 
Full=Pollen-expressed LIM protein 2B [Arabidopsis thaliana]
 gb|ABF83669.1| At1g01780 [Arabidopsis thaliana]
 dbj|BAH20039.1| AT1G01780 [Arabidopsis thaliana]
 gb|AEE27334.1| LIM domain-containing protein [Arabidopsis thaliana]
Length=205

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL++SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELTR
Sbjct  33   SCFRCTHCKGTLQMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEK+ +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 57.4 bits (137),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++ VLYC+ HF QLF E GN+    Q+       S + L P
Sbjct  127  TCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPP  186

Query  458  ELTRSPSKAASMFSGTQE  511
            E T   +  A   +G  E
Sbjct  187  EPTEDVAVEAKEENGVSE  204


 Score = 43.9 bits (102),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCF  129



>ref|XP_009138786.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Brassica 
rapa]
Length=210

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQS      + + ++TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQS---GKTEKSNDVTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+ +E +SYHK+CF+C+HGGC LT S
Sbjct  90   APSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHS  142


 Score = 54.3 bits (129),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H    L  S+Y+++ G+LYCK HF QLF E GN+N   ++         DK+ P
Sbjct  128  TCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHRRTSEEDKIEP  187

Query  458  ELTRSPSK  481
             +  +  K
Sbjct  188  NVNDASPK  195


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  89   RAPSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCF  130


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_008374043.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=213

 Score =   160 bits (406),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    +CF+CSHC G L +S+YSSM+GVLYCKPHFEQLFKE+G+F+K FQ+  KS +   
Sbjct  28   IAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKPHFEQLFKETGSFSKKFQTSGKSQN---  84

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             ELTR+PSK +SMFSGT +KCA C KT YPLEKVT+E   YHKSCF+C+HGGC L+PS
Sbjct  85   -ELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPS  141


 Score = 54.7 bits (130),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+  
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCF  35


 Score = 49.7 bits (117),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRC+H    L  SN ++++G+LYCK HF QLFKE G+++
Sbjct  127  SCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYS  167


 Score = 38.9 bits (89),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KTVYP+E ++ +G  YHKS  
Sbjct  97   FSGTVDKCAVCTKTVYPLEKVTMEGDFYHKSCF  129



>gb|AAF78411.1|AC009273_17 Contains similarity to mRNA for transcription factor L2 from 
Arabidopsis thaliana gb|X91398. It contains LIM domain containing 
proteins PF|00412. ESTs gb|T13084 and gb|T42925 come from 
this gene [Arabidopsis thaliana]
Length=261

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL++SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELTR
Sbjct  89   SCFRCTHCKGTLQMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTR  144

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEK+ +E + +HK+CF+C+HGGC+LT S
Sbjct  145  TPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHS  197


 Score = 58.2 bits (139),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++ VLYC+ HF QLF E GN+    Q+       S + L P
Sbjct  183  TCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPP  242

Query  458  ELTRSPSKAASMFSGTQE  511
            E T   +  A   +G  E
Sbjct  243  EPTEDVAVEAKEENGVSE  260


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  153  FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCF  185



>ref|XP_010479778.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
 ref|XP_010457082.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
Length=205

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELTR
Sbjct  33   SCFRCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKV +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 55.5 bits (132),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++ VLYC+ HF QLF E GN+    Q+       S + L P
Sbjct  127  TCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPP  186

Query  458  ELTRS  472
            E T  
Sbjct  187  EATED  191


 Score = 43.9 bits (102),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCF  129


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KC AC+KTVY V++LS +G+ YHKS  
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCF  35



>gb|ABL74496.1| LIM domain protein PLIM2b [Populus tremula x Populus alba]
Length=173

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F+KNFQ   K   + T EL R
Sbjct  27   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSKNFQ---KGKPERTHELIR  83

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KC+TCGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  84   TPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  136


 Score = 49.7 bits (117),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++
Sbjct  122  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYS  162


 Score = 41.6 bits (96),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  92   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCF  124



>gb|EYU32092.1| hypothetical protein MIMGU_mgv1a013269mg [Erythranthe guttata]
Length=225

 Score =   164 bits (415),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +S+YSSM+GVLYCKPHFEQLFKESGNF+KNFQ+  +  D       R
Sbjct  34   SCFKCSHCKGTLVMSSYSSMDGVLYCKPHFEQLFKESGNFSKNFQASKQERDHNNNLQAR  93

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK ++MF GTQ+KC  C KT YPLEKVT+E +S+HKSCFKC+HGGC LT S
Sbjct  94   GPSKHSAMFCGTQDKCPACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHS  146


 Score = 50.1 bits (118),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  3    SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCF  36


 Score = 51.6 bits (122),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+
Sbjct  132  SCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNY  171


 Score = 45.4 bits (106),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K    F GTQ KC AC KTVYP+E ++ +G ++HKS  
Sbjct  96   SKHSAMFCGTQDKCPACNKTVYPLEKVTMEGESFHKSCF  134



>ref|XP_009118149.1| PREDICTED: pollen-specific protein SF3-like, partial [Brassica 
rapa]
Length=120

 Score =   147 bits (370),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCK  L+LS YSSMEGVLYCKPH+EQLFKESG+F KNFQSPAK A+K +PELTR
Sbjct  34   SCFKCTHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTR  93

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLE  550
            +PS+ A MFSGTQEKCATC KT YP+E
Sbjct  94   TPSRVAGMFSGTQEKCATCSKTVYPIE  120


 Score = 67.0 bits (162),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            SF GTQQKCKACEKTVYPVELLSADG++YHKS  
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCF  36


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KC  C KT YP+E ++ +  SYHKSCFKC+H
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTH  40



>ref|XP_002302574.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE81847.1| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F+KNFQ   K   + T EL R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSKNFQ---KGKPERTHELIR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KC+TCGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   TPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 52.8 bits (125),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA--KSADKLTPEL  463
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++         +S     PEL
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKRSTSTPPPEL  187

Query  464  TRSPSKAASMFSGTQEK  514
              S ++ A+      E+
Sbjct  188  AESNTEEAAAAEDKSEE  204


 Score = 41.6 bits (96),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCF  130


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+++S +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCF  35



>ref|XP_003623892.1| LIM domain protein 2b [Medicago truncatula]
 gb|AES80110.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=212

 Score =   161 bits (408),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SC +C+HCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNFQ  AKS++K+   + R
Sbjct  33   SCLKCTHCKGNLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQ--AKSSEKINELMNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ +SMFSGT +KCA C KT YPLEK+++E + YHK+CF+C+HGGC LT S
Sbjct  91   TPSRLSSMFSGTLDKCAVCTKTVYPLEKMSLEGECYHKNCFRCAHGGCHLTHS  143


 Score = 52.0 bits (123),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LL+ +GI YHKS L
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKSCL  35


 Score = 57.8 bits (138),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYCK HF+QLF E GN+N   Q+ A
Sbjct  129  NCFRCAHGGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYNHVLQAAA  176


 Score = 40.0 bits (92),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 2/41 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            T  R+S  F GT  KC  C KTVYP+E +S +G  YHK+  
Sbjct  91   TPSRLSSMFSGTLDKCAVCTKTVYPLEKMSLEGECYHKNCF  131



>ref|XP_009402055.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   158 bits (400),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+GVLYCKPHFEQLFKE+G F + F +  KS ++   E ++
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGVLYCKPHFEQLFKETGTFTRKFPTGTKSGER--NEQSK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P+K +SMF GTQ+KCATC KTAYPLE +T+E +SYHK+CFKCS GGC LTPS
Sbjct  91   APTKISSMFCGTQDKCATCKKTAYPLETMTMEGESYHKTCFKCSVGGCMLTPS  143


 Score = 55.1 bits (131),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKACEKTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFSGTQDKCKACEKTVHFIDLLTADGVTYHKTCF  35


 Score = 48.1 bits (113),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CF+CS     L  S+Y++++G+LYCK HF QLF E G++N   Q+
Sbjct  129  TCFKCSVGGCMLTPSSYAALDGILYCKHHFAQLFMEKGSYNHVIQA  174


 Score = 43.5 bits (101),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            TK    F GTQ KC  C+KT YP+E ++ +G +YHK+  
Sbjct  93   TKISSMFCGTQDKCATCKKTAYPLETMTMEGESYHKTCF  131



>ref|XP_006647592.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=206

 Score =   159 bits (401),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+GVLYCK HFEQLFKE+G+F+K F    KS+DK   +  +
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGVLYCKTHFEQLFKETGSFSKKFSQGGKSSDK--NDQGK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  91   APSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  143


 Score = 55.1 bits (131),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCF  35


 Score = 54.7 bits (130),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP  430
            SCF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N   Q+ 
Sbjct  129  SCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTA  175


 Score = 47.8 bits (112),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  131


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|NP_001047550.1| Os02g0641000 [Oryza sativa Japonica Group]
 dbj|BAD25223.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAD25371.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAF09464.1| Os02g0641000 [Oryza sativa Japonica Group]
 gb|EAY86851.1| hypothetical protein OsI_08235 [Oryza sativa Indica Group]
 gb|EAZ23959.1| hypothetical protein OsJ_07685 [Oryza sativa Japonica Group]
 gb|AEJ08684.1| PLIM [Oryza sativa]
Length=206

 Score =   159 bits (401),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+GVLYCK HFEQLFKE+G+F+K F    KS++K   +  R
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGVLYCKTHFEQLFKETGSFSKKFSQGGKSSEK--SDQGR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  91   APSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  143


 Score = 54.7 bits (130),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCF  35


 Score = 56.6 bits (135),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN---KNFQSPAKSADKLTP  457
            SCF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N   +  QS  K +++  P
Sbjct  129  SCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQSKQKESEEAAP  187


 Score = 48.1 bits (113),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|NP_001140551.1| uncharacterized LOC100272616 [Zea mays]
 gb|ACF84061.1| unknown [Zea mays]
 gb|AFW58965.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05143.1| LIM transcription factor, partial [Zea mays]
Length=205

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+KNF    KS+DK   ELTR
Sbjct  34   TCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKNFTPGGKSSDK--GELTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  92   APSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  144


 Score = 50.1 bits (118),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G+++
Sbjct  130  SCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSYS  170


 Score = 47.8 bits (112),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  94   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  132


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            S F+GTQ+KCA C KT + ++ +T +  +YHK+CFKCSH
Sbjct  2    SSFTGTQDKCAECDKTVHFIDLLTADGVTYHKTCFKCSH  40



>ref|NP_001132843.1| uncharacterized LOC100194335 [Zea mays]
 gb|ACF81859.1| unknown [Zea mays]
 tpg|DAA36695.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB04292.1| LIM transcription factor, partial [Zea mays]
Length=204

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+KNF    KS+DK   ELTR
Sbjct  33   TCFKCSHCKGVLSMCSYSSMDGVLYCKTHFEQLFKETGSFSKNFTPGGKSSDK--GELTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  91   APSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  143


 Score = 53.5 bits (127),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK-NFQSPAK  436
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G++N  N +SP++
Sbjct  129  SCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSYNHMNKKSPSQ  178


 Score = 47.8 bits (112),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  131


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC AC+KTV+ ++LL+ADG  YHK+  
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGAIYHKTCF  35



>ref|XP_010506557.1| PREDICTED: LIM domain-containing protein PLIM2a [Camelina sativa]
Length=228

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ+     DK   +LTR
Sbjct  33   SCFKCSHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQT--GKTDKPN-DLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E + YHK+CF+C+H GC LT S
Sbjct  90   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHS  142


 Score = 53.9 bits (128),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  128  NCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175


 Score = 42.4 bits (98),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 2/46 (4%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+  
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCF  130


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSH  39



>ref|XP_002892043.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68302.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELT+
Sbjct  33   SCFRCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTK  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEK+ +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 57.8 bits (138),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++ VLYC+ HF QLF E GN+    Q+       S + LTP
Sbjct  127  TCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNTLTP  186

Query  458  ELTRSPSKAASMFSGTQE  511
            E T   +  A   +G  +
Sbjct  187  EPTEDIAVEAKEENGVSQ  204


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCF  129



>ref|XP_008438078.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cucumis 
melo]
Length=208

 Score =   162 bits (410),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +S+YS M+GVLYCK HFEQLFKESGNF+KNFQ+ AK ++K   +L+R
Sbjct  33   SCFKCSHCKGTLSMSSYSWMDGVLYCKTHFEQLFKESGNFSKNFQN-AKPSEKQN-DLSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSMFSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHS  143


 Score = 50.4 bits (119),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY VELLS +G  YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCF  35


 Score = 52.4 bits (124),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYCK HF QLF   GN+N   ++ A
Sbjct  129  NCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAA  176


 Score = 42.4 bits (98),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHK+  
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCF  131


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y +E +++E   YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSH  39



>ref|XP_004134333.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
Length=210

 Score =   162 bits (411),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +S+YS M+GVLYCK HFEQLFKESGNF+KNFQ+ AK ++K     +R
Sbjct  33   SCFKCSHCKGTLSMSSYSWMDGVLYCKTHFEQLFKESGNFSKNFQN-AKPSEKQNDLQSR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  92   APSKLSSMFSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHS  144


 Score = 50.4 bits (119),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY VELLS +G  YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCF  35


 Score = 52.0 bits (123),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYCK HF QLF   GN+N   ++ A
Sbjct  130  NCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAA  177


 Score = 42.7 bits (99),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHK+  
Sbjct  100  FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCF  132


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y +E +++E   YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSH  39



>ref|XP_006296425.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
 gb|EOA29323.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
Length=225

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ+     +K    LTR
Sbjct  33   SCFKCTHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQN--GKTEKPNDHLTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E + YHK+CF+C+H GC LT S
Sbjct  91   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCTHSGCPLTHS  143


 Score = 59.7 bits (143),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 6/81 (7%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK------NFQSPAKSADKL  451
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N       N +  A S    
Sbjct  129  NCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGAS  188

Query  452  TPELTRSPSKAASMFSGTQEK  514
             P   + PS +AS+  G  E+
Sbjct  189  PPSDDQKPSDSASIPEGKDEE  209


 Score = 41.2 bits (95),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC  C+KTVYP+E ++ +G  YHK+  
Sbjct  90   RTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCF  131


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCFKC+H
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCTH  39



>ref|XP_010508108.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=230

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ+     DK   +LTR
Sbjct  33   SCFKCSHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQT--GKTDKPN-DLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E + YHK+CF+C+H GC LT S
Sbjct  90   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHS  142


 Score = 53.9 bits (128),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  128  NCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175


 Score = 42.4 bits (98),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 2/46 (4%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+  
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCF  130


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSH  39



>ref|XP_008438077.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=209

 Score =   162 bits (410),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +S+YS M+GVLYCK HFEQLFKESGNF+KNFQ+ AK ++K     +R
Sbjct  33   SCFKCSHCKGTLSMSSYSWMDGVLYCKTHFEQLFKESGNFSKNFQN-AKPSEKQNDLQSR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  92   APSKLSSMFSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHS  144


 Score = 50.4 bits (119),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY VELLS +G  YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCF  35


 Score = 52.4 bits (124),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYCK HF QLF   GN+N   ++ A
Sbjct  130  NCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAA  177


 Score = 42.4 bits (98),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHK+  
Sbjct  100  FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCF  132


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y +E +++E   YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSH  39



>ref|XP_010107618.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC16357.1| Pollen-specific protein SF3 [Morus notabilis]
Length=213

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 19/132 (14%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS--------------  427
            SCF+CSHCKGTL +S+YS M+GVLYCKPHFEQLFKESGNF+KNFQ+              
Sbjct  33   SCFKCSHCKGTLSMSSYSWMDGVLYCKPHFEQLFKESGNFSKNFQTVFLLGLFANNNKRV  92

Query  428  -----PAKSADKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCF  592
                  AKS+++   +L R+PSK +S+FSGTQ+KCATC KT YPLEKV++E + YHKSCF
Sbjct  93   GEKFVTAKSSERQNDQLARAPSKLSSLFSGTQDKCATCSKTVYPLEKVSLEGECYHKSCF  152

Query  593  KCSHGGCSLTPS  628
            +C+HGGC LT S
Sbjct  153  RCAHGGCPLTHS  164


 Score = 57.0 bits (136),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+H    L  S+Y++++GVLYCK HF+QLF E GN++   ++ A   +   P  T 
Sbjct  150  SCFRCAHGGCPLTHSSYAALDGVLYCKHHFQQLFMEKGNYSHVLKAAANKKNATPPPETA  209

Query  470  SPS  478
              S
Sbjct  210  DQS  212


 Score = 43.5 bits (101),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E +S +G  YHKS  
Sbjct  120  FSGTQDKCATCSKTVYPLEKVSLEGECYHKSCF  152



>ref|XP_010518219.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=229

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGN++KNFQ+     DK   +LTR
Sbjct  33   SCFKCSHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSKNFQN--GKTDKPN-DLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKVT+E + YHK+CF+C+H GC LT S
Sbjct  90   TPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHS  142


 Score = 53.9 bits (128),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  128  NCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175


 Score = 42.4 bits (98),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 2/46 (4%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+  
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCF  130


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSH  39



>ref|XP_010544715.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Tarenaya hassleriana]
Length=235

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA---DKLTPE  460
            SCFRCSHC GTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+  K+    D   P 
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKPHFEQLFKESGNFSKNFQASGKTDKPNDAQPP-  91

Query  461  LTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             TR+P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GCSLT S
Sbjct  92   -TRAPNRLSSFFSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHS  146


 Score = 54.7 bits (130),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H   +L  S+Y+++ GVLYCK HF QLF E G++N   QS
Sbjct  132  TCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYNHVLQS  177


 Score = 45.8 bits (107),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  102  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCF  134


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSH  39



>ref|XP_004976341.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Setaria 
italica]
Length=204

 Score =   160 bits (406),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+K F    KSADK   EL R
Sbjct  33   TCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKKFTPGGKSADK--GELAR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  91   APSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  143


 Score = 51.6 bits (122),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 52.0 bits (123),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G++N
Sbjct  129  SCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYN  169


 Score = 47.8 bits (112),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  131



>ref|XP_011091917.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=223

 Score =   161 bits (407),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+     +  +    +
Sbjct  34   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTTKHDKENSS---NK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P+K ++MFSGTQ+KC  C KT YPLEKV +E +S+HKSCFKC+HGGC LT S
Sbjct  91   APNKLSAMFSGTQDKCPACHKTVYPLEKVIMEGESFHKSCFKCAHGGCPLTHS  143


 Score = 51.2 bits (121),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +F GT  KCKAC+KTVY V+LLSADG  YHKS  
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCF  36


 Score = 54.3 bits (129),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA--KSA-DKLTPE  460
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+    ++    KSA +   PE
Sbjct  129  SCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLEAATNRKSAVETPEPE  188

Query  461  LTRSPSKAASMFSGTQEKCA  520
              ++  KA      T+E+ A
Sbjct  189  SDQAEEKADDDQEKTEEEEA  208


 Score = 42.7 bits (99),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E +  +G ++HKS  
Sbjct  99   FSGTQDKCPACHKTVYPLEKVIMEGESFHKSCF  131



>gb|KGN56538.1| hypothetical protein Csa_3G122620 [Cucumis sativus]
Length=209

 Score =   160 bits (405),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SC +CSHCKGTL +S+YS M+GVLYCK HFEQLFKESGNF+KNFQ+ AK ++K   +L+R
Sbjct  33   SCLKCSHCKGTLSMSSYSWMDGVLYCKTHFEQLFKESGNFSKNFQN-AKPSEKQN-DLSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSMFSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHS  143


 Score = 51.6 bits (122),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY VELLS +G  YHKS L
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCL  35


 Score = 52.4 bits (124),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYCK HF QLF   GN+N   ++ A
Sbjct  129  NCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAA  176


 Score = 42.7 bits (99),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHK+  
Sbjct  99   FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCF  131



>gb|EMT25782.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=213

 Score =   159 bits (402),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+GVLYCK HFEQLFKE+GNF+KNF    KSA+K      +
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGVLYCKTHFEQLFKETGNFSKNFTPGGKSAEKGEA---K  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E + YHKSCFKCSHGGC LT S
Sbjct  90   APSKMSSAFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSHGGCILTTS  142


 Score = 53.1 bits (126),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCF  35


 Score = 54.3 bits (129),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N
Sbjct  128  SCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYN  168


 Score = 47.0 bits (110),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G  YHKS  
Sbjct  92   SKMSSAFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCF  130


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC TC KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|XP_001765937.1| predicted protein [Physcomitrella patens]
 gb|EDQ69258.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   157 bits (396),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKL  451
            ++   SCFRC+HCKGTLKL+NY+S+EGVLYCKPHFEQL K +G+F+K+F+  P++   K 
Sbjct  28   VVYHKSCFRCNHCKGTLKLANYASLEGVLYCKPHFEQLLKVTGSFDKSFEHKPSEGLKKA  87

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
                 ++PSKA+ MFSGTQEKC  C KT YP+EK TVE   YHK CFKC HGGC+++PS
Sbjct  88   EKGENKAPSKASLMFSGTQEKCIACSKTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPS  146


 Score = 55.1 bits (131),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT QKCKACEKTVY VE L+ADG+ YHKS  
Sbjct  1    MAFSGTTQKCKACEKTVYLVEQLTADGVVYHKSCF  35


 Score = 60.1 bits (144),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            CF+C H   T+  SNY+++EG LYCKPH+ QLFKE GN+++  ++PA
Sbjct  133  CFKCVHGGCTISPSNYAALEGRLYCKPHYSQLFKEKGNYSQLTKAPA  179


 Score = 46.2 bits (108),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            +K  + F GTQ+KC AC KTVYP+E  + +G+ YHK
Sbjct  96   SKASLMFSGTQEKCIACSKTVYPIEKTTVEGLPYHK  131



>ref|XP_008392559.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=222

 Score =   157 bits (396),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            I    +CF+CSHC G L +S+YSSM+ VLYCKPHFEQLFKE+G+F+K FQ+  KS     
Sbjct  28   IAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKPHFEQLFKETGSFSKKFQTSGKS----Q  83

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             ELTR+PSK +SMFSGT +KCA C KT YPLEKVT+E   YHKSCF+C+HGGC L+PS
Sbjct  84   TELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGGCFLSPS  141


 Score = 54.7 bits (130),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+  
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCF  35


 Score = 52.4 bits (124),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRC+H    L  SN ++++G+LYCK HF QLFKE G++N
Sbjct  127  SCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYN  167


 Score = 40.0 bits (92),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 6/54 (11%)
 Frame = +1

Query  139  GQIWTLLLRDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            G+  T L R    T  ++S  F GT  KC  C KTVYP+E ++ +G  YHKS  
Sbjct  80   GKSQTELTR----TPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCF  129



>dbj|BAK04207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score =   159 bits (402),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            +I   +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+K F    KS DK  
Sbjct  28   VIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKKFTPGNKSGDK--  85

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             ELTR+PSK ++ FSGTQ+KCA C KT YPLEK+T+E  +YHKSCFKCSHGGC LT S
Sbjct  86   SELTRAPSKLSAAFSGTQDKCAACTKTVYPLEKMTLEGDAYHKSCFKCSHGGCILTTS  143


 Score = 52.4 bits (124),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC ACEKTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCSACEKTVHFIDLLTADGVIYHKTCF  35


 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G+++
Sbjct  129  SCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMERGSYS  169


 Score = 45.8 bits (107),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC KTVYP+E ++ +G  YHKS  
Sbjct  93   SKLSAAFSGTQDKCAACTKTVYPLEKMTLEGDAYHKSCF  131



>ref|XP_006304383.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
 gb|EOA37281.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
Length=205

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K      PELT+
Sbjct  33   SCFRCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKIEK---PELTK  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKV +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 58.9 bits (141),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++GVLYC+ HF QLF E GN+    Q+       S + L P
Sbjct  127  TCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPP  186

Query  458  ELTRSPSKAASMFSGTQE  511
            E T   +  A   +G  +
Sbjct  187  EATEEIAVEAKEENGDSQ  204


 Score = 43.9 bits (102),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCF  129


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KC AC+KTVY V++LS +G+ YHKS  
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCF  35



>gb|EPS59684.1| hypothetical protein M569_15118, partial [Genlisea aurea]
Length=180

 Score =   160 bits (404),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ  A  A+K       
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQPSA--ANKENSASKA  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ ++MFSGTQ+KC  C K  YPLEKVT+E +S H+SCFKC+HGGC LT S
Sbjct  91   APNRMSAMFSGTQDKCPACNKIVYPLEKVTMEGESVHRSCFKCAHGGCPLTHS  143


 Score = 51.6 bits (122),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LL+ADG  +HKS  
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLTADGATFHKSCF  35


 Score = 53.1 bits (126),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+    Q+
Sbjct  129  SCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLQA  174


 Score = 41.2 bits (95),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = +1

Query  172  RSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            ++   RMS  F GTQ KC AC K VYP+E ++ +G + H+S  
Sbjct  89   KAAPNRMSAMFSGTQDKCPACNKIVYPLEKVTMEGESVHRSCF  131



>gb|ACN26203.1| unknown [Zea mays]
 gb|ADX60140.1| LIM transcription factor [Zea mays]
 gb|AFW72521.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=204

 Score =   156 bits (395),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L +S+YSSM+GVLYCK HFEQLFKE+G F+KNFQ  A S      +  +
Sbjct  33   TCFKCSHCKGVLSISSYSSMDGVLYCKTHFEQLFKETGTFSKNFQGGASSNKN---DQAK  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  90   APSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTS  142


 Score = 55.1 bits (131),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKACDKTVHIIDLLTADGVSYHKTCF  35


 Score = 55.5 bits (132),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN---KNFQSPAKSADKLTPE  460
            SCF+CSH    L  S+Y+++ GVLYCK HF QLFKE G++N   +  Q+    A +  PE
Sbjct  128  SCFKCSHGGCILTTSSYAALNGVLYCKIHFSQLFKEKGSYNHLIETAQTKKNEAAEAGPE  187


 Score = 47.4 bits (111),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHKS  
Sbjct  92   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCF  130


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKACDKTVHIIDLLTADGVSYHKTCFKCSH  39



>ref|XP_010523025.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523026.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523027.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
Length=208

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  KS     PEL R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT-GKSE---KPELNR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+FSGT +KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  89   TPSKLSSLFSGTLDKCAACEKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  141


 Score = 53.1 bits (126),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H    L  S+Y++++GVLYC+ HF QLF E GN++   QS
Sbjct  127  TCFRCAHGGCPLTHSSYAALDGVLYCRHHFNQLFLEKGNYSHVLQS  172


 Score = 42.0 bits (97),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC ACEKTVYP+E ++ +G  YHK+  
Sbjct  97   FSGTLDKCAACEKTVYPLEKVTMEGECYHKTCF  129


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCFKCSH
Sbjct  3    FTGTLDKCNACDKTVYVVDMLTLEGMPYHKSCFKCSH  39



>ref|XP_007218397.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
 gb|EMJ19596.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
Length=212

 Score =   162 bits (409),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 91/113 (81%), Gaps = 7/113 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF K       SA+K   +L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGVLYCKPHFEQLFKESGNFTK-------SAEKQNEQLNR  85

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGT +KCATC KT YPLEKVT+E +SYHKSCF+C+HGGC LT S
Sbjct  86   APSKLSSMFSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHS  138


 Score = 49.3 bits (116),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCF  35


 Score = 56.2 bits (134),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKL  451
            SCFRC+H    L  S+Y++++GVLYCK HF QLF E GN++   Q+ A   + L
Sbjct  124  SCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAANRKNAL  177


 Score = 40.4 bits (93),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KTVYP+E ++ +G +YHKS  
Sbjct  94   FSGTLDKCATCSKTVYPLEKVTLEGESYHKSCF  126



>gb|EYU35073.1| hypothetical protein MIMGU_mgv1a013171mg [Erythranthe guttata]
Length=229

 Score =   161 bits (407),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFK+S +F KNFQ+ AK   +    LTR
Sbjct  34   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKDSAHFTKNFQTSAKP--ERENSLTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P+K ++MFSGTQ+KC  C K  YPLEKVT+E +S+HKSCFKC+HGGC LT S
Sbjct  92   APNKLSAMFSGTQDKCPACDKIVYPLEKVTMEGESFHKSCFKCAHGGCPLTHS  144


 Score = 50.1 bits (118),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  SFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCF  36


 Score = 52.0 bits (123),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            SCF+C+H    L  S+Y++++G+LYCK HF+QLF E GN+
Sbjct  130  SCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNY  169


 Score = 43.1 bits (100),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+K VYP+E ++ +G ++HKS  
Sbjct  100  FSGTQDKCPACDKIVYPLEKVTMEGESFHKSCF  132



>gb|KDP25467.1| hypothetical protein JCGZ_20623 [Jatropha curcas]
Length=212

 Score =   158 bits (400),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHC G L + +YSSMEGVLYCKPHFEQLF+E+G++ K F S  +  + LT    R
Sbjct  33   TCFKCSHCNGLLVMGSYSSMEGVLYCKPHFEQLFRETGSYAKKFPSSGEKKNALT----R  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGTQ+KCA C KTAYPLEKV+VE +SYHKSCF+CSHGGC ++PS
Sbjct  89   TPSKFSSMFSGTQDKCARCNKTAYPLEKVSVEGESYHKSCFRCSHGGCYISPS  141


 Score = 52.4 bits (124),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M F GT +KCKAC+KTV+ +E+++ADGINYHK+  
Sbjct  1    MGFSGTLEKCKACDKTVHFIEMVTADGINYHKTCF  35


 Score = 61.2 bits (147),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK------NFQSPAKSADKL  451
            SCFRCSH    +  S+Y++++GVLYCKPHF QLFKE G++N         Q  A    K 
Sbjct  127  SCFRCSHGGCYISPSSYAALDGVLYCKPHFAQLFKEKGSYNHIRKSNSQHQIDASEETKA  186

Query  452  TPELTRS  472
             PE T++
Sbjct  187  VPEETKA  193


 Score = 43.1 bits (100),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E +S +G +YHKS  
Sbjct  97   FSGTQDKCARCNKTAYPLEKVSVEGESYHKSCF  129


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGT EKC  C KT + +E VT +  +YHK+CFKCSH
Sbjct  3    FSGTLEKCKACDKTVHFIEMVTADGINYHKTCFKCSH  39



>emb|CDY18899.1| BnaC04g04510D [Brassica napus]
Length=227

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+     +K   ++TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT--GKTEKSNDQMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKV +E + YHK+CFKC+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHS  143


 Score = 54.3 bits (129),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK  436
            +CF+C+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ AK
Sbjct  129  TCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAK  177


 Score = 41.6 bits (96),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCF  131


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSH  39



>ref|XP_009143175.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX74767.1| BnaA05g05130D [Brassica napus]
Length=229

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+     +K    +TR
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTG--KTEKSNDHMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCATC KT YPLEKV +E + YHK+CFKC+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHS  143


 Score = 54.3 bits (129),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK  436
            +CF+C+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ AK
Sbjct  129  TCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAK  177


 Score = 41.6 bits (96),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCF  131


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH   +L  S
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVIS  47



>ref|XP_002452860.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
 gb|EES05836.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
Length=200

 Score =   157 bits (397),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL +S+YSSM+GVLYCK HFEQLFKE+G F+K FQ  A S      +  +
Sbjct  33   TCFKCSHCKGTLSISSYSSMDGVLYCKTHFEQLFKETGTFSKKFQGGASSTK---TDQAK  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  90   APSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTS  142


 Score = 53.5 bits (127),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCF  35


 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP  430
            SCF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N   Q+ 
Sbjct  128  SCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTA  174


 Score = 47.4 bits (111),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHKS  
Sbjct  92   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCF  130


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC TC KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|XP_003569963.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=210

 Score =   156 bits (394),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL + NYSSM+GVLYCK HFEQLFKE+G+F+K F    KS+DK   +  +
Sbjct  33   TCFKCSHCKGTLSMCNYSSMDGVLYCKTHFEQLFKETGSFSKKFTPGGKSSDK--NDQAK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P+K +S+FSGTQ+KCA C KT YPLEK+T+E + YHKSCFKCSHGGC+LT S
Sbjct  91   APNKLSSVFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSHGGCTLTTS  143


 Score = 54.3 bits (129),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCK C+KTV+ ++LLSADGI+YHK+  
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLSADGISYHKTCF  35


 Score = 55.8 bits (133),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH   TL  S+Y+++ G+LYCK HF QLFKE G++N
Sbjct  129  SCFKCSHGGCTLTTSSYAALNGILYCKIHFSQLFKEKGSYN  169


 Score = 45.8 bits (107),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E L+ +G  YHKS  
Sbjct  99   FSGTQDKCAACQKTVYPLEKLTLEGECYHKSCF  131


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC TC KT + ++ ++ +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKTCDKTVHFIDLLSADGISYHKTCFKCSH  39



>ref|XP_011035878.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Populus 
euphratica]
Length=206

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F+KNFQ   K   + T +L+R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSKNFQ---KGKPERTHDLSR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK +S+F GTQ+KC+TCGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   IPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 56.2 bits (134),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPELT  466
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++    S A K ++   PEL 
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNSTPPELA  187

Query  467  RS-PSKAASM  493
             S P + A++
Sbjct  188  ESNPEEGAAV  197


 Score = 41.6 bits (96),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCF  130



>ref|XP_009375790.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=222

 Score =   155 bits (393),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHC G L +S+YSSM+ VLYCKPHFEQLFKE+G+F+K FQ     + KL  ELTR
Sbjct  33   TCFKCSHCNGQLSMSSYSSMDEVLYCKPHFEQLFKETGSFSKKFQI----SGKLQTELTR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGT +KCA C KT YPLEKVT+E   YHKSCF+C+HGGC L+PS
Sbjct  89   TPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGGCFLSPS  141


 Score = 54.3 bits (129),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+  
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCF  35


 Score = 52.0 bits (123),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRC+H    L  SN ++++G+LYCK HF QLFKE G++N
Sbjct  127  SCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYN  167


 Score = 41.6 bits (96),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 6/56 (11%)
 Frame = +1

Query  133  LKGQIWTLLLRDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            + G++ T L R    T  ++S  F GT  KC  C KTVYP+E ++ +G  YHKS  
Sbjct  78   ISGKLQTELTR----TPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCF  129


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT + +++++ +  +YHK+CFKCSH
Sbjct  3    FSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSH  39



>ref|XP_010512456.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=219

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  K+  + + E +R
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTAGKT--EKSNETSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  91   APNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  143


 Score = 54.7 bits (130),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+ A +      E   
Sbjct  129  TCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNRRTGADEDKA  188

Query  470  SP  475
             P
Sbjct  189  EP  190


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  131


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_006418457.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
 gb|ESQ36810.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
Length=205

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRC+HC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PELT+
Sbjct  33   SCFRCTHCNGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PELTK  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKV +E + +HK+CF+C+HGGC+LT S
Sbjct  89   TPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHS  141


 Score = 57.0 bits (136),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CFRC+H   TL  S+Y+S++GVLYC+ HF QLF E GN+    Q+       S + L P
Sbjct  127  TCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNTLPP  186

Query  458  ELTRS  472
            E T  
Sbjct  187  EPTED  191


 Score = 43.5 bits (101),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCF  129


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KC AC+KTVY V++LS +G+ YHKS  
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCF  35



>ref|XP_010671960.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   159 bits (403),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +2

Query  278  ITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  457
            I   SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF KNFQS  K+      
Sbjct  29   IFHKSCFRCSHCNGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFRKNFQSGQKTDRPY--  86

Query  458  ELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            E  R+P+K +S FSGTQEKC  C KT YPLEK+T+E +SYHKSCFKC+ GGC LT S
Sbjct  87   EQNRAPNKLSSFFSGTQEKCPGCHKTVYPLEKITMEGESYHKSCFKCAVGGCPLTHS  143


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+LLSADG  +HKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGAIFHKSCF  35


 Score = 49.3 bits (116),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN-------KNFQSPAKSAD  445
            SCF+C+     L  S+Y++++G+LYCK HF+QLF E G++N       KN  S A++ D
Sbjct  129  SCFKCAVGGCPLTHSSYAALDGILYCKHHFQQLFMEKGSYNHVKNAAKKNASSSAEAGD  187


 Score = 45.8 bits (107),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ+KC  C KTVYP+E ++ +G +YHKS  
Sbjct  90   RAPNKLSSFFSGTQEKCPGCHKTVYPLEKITMEGESYHKSCF  131



>gb|ABK58466.1| LIM domain protein PLIM2a [Populus tremula x Populus alba]
Length=206

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F++NFQ   K   + T +L+R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSRNFQ---KGKPERTHDLSR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK +S+F GTQ+KC+TCGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   IPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 57.0 bits (136),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPELT  466
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++    S A K ++  TPEL 
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNSTTPELA  187

Query  467  RS  472
             S
Sbjct  188  GS  189


 Score = 41.6 bits (96),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KTVYP+E ++ +G  YHK+  
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCF  130


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V+++S +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCF  35



>gb|KEH18910.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=205

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+G+LYCK HFEQLFKESGNF+KNF   AKS+DK   EL R
Sbjct  33   SCFKCSHCKGNLTMSTYSSMDGILYCKTHFEQLFKESGNFSKNF---AKSSDKAN-ELNR  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ +SMFSGT +KCATC KT YPLEKVT+E + YHK+CF+C+H GC LT S
Sbjct  89   TPSRLSSMFSGTLDKCATCSKTVYPLEKVTLEGEIYHKTCFRCAHAGCPLTHS  141


 Score = 55.8 bits (133),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  278  ITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK  436
            I   +CFRC+H    L  SNY++++GVLYC+ HF QLF E GN++   +S  K
Sbjct  123  IYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYSHVLKSAHK  175


 Score = 38.9 bits (89),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (57%), Gaps = 2/46 (4%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             +   T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+  
Sbjct  84   NELNRTPSRLSSMFSGTLDKCATCSKTVYPLEKVTLEGEIYHKTCF  129


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            F+GT +KC  C KT Y ++ +T+EN  YHKSCFKCSH   +LT S
Sbjct  3    FTGTLDKCKACDKTVYVVDLLTLENIPYHKSCFKCSHCKGNLTMS  47


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LL+ + I YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLENIPYHKSCF  35



>ref|XP_010055180.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW71657.1| hypothetical protein EUGRSUZ_E00179 [Eucalyptus grandis]
Length=218

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHC G L +SNYSSM+GVLYCK HFEQL+KESGNF+KNFQ+ AKS+++   +L R
Sbjct  33   NCFRCSHCNGHLVMSNYSSMDGVLYCKTHFEQLYKESGNFSKNFQT-AKSSER-QHDLNR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PS+ +S+FSGT +KC TCGKT YPLEKVT+E + +HK+CF+C+HGGC+LT S
Sbjct  91   TPSRLSSLFSGTLDKCTTCGKTVYPLEKVTLEGECFHKNCFRCAHGGCALTHS  143


 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            +CFRC+H    L  S+Y++++GV YCK HF +LF E GN+
Sbjct  129  NCFRCAHGGCALTHSSYAALDGVFYCKHHFARLFMEKGNY  168


 Score = 38.9 bits (89),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (57%), Gaps = 2/46 (4%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
             D   T  R+S  F GT  KC  C KTVYP+E ++ +G  +HK+  
Sbjct  86   HDLNRTPSRLSSLFSGTLDKCTTCGKTVYPLEKVTLEGECFHKNCF  131



>ref|XP_010054850.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW78044.1| hypothetical protein EUGRSUZ_D02268 [Eucalyptus grandis]
Length=208

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESG+F KNF S AKS DK   E+TR
Sbjct  33   TCFRCSHCNGTLVMSNYSSMDGVLYCKTHFEQLFKESGDFRKNFHS-AKS-DKPN-EMTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +SMFSGT +KC++C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   TPSKLSSMFSGTLDKCSSCNKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 50.1 bits (118),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA--KSADKLTPEL  463
            +CFRC+H    L  S+Y++++GVLYC+ HF +LF E G+F     S    ++A   TP  
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCRHHFARLFMEKGDFKHVLDSATHRRNASSGTP--  185

Query  464  TRSPSKAASMFSGTQ  508
               P + A + + T 
Sbjct  186  ---PPEPAELVTETD  197


 Score = 39.3 bits (90),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC +C KTVYP+E ++ +G  YHK+  
Sbjct  98   FSGTLDKCSSCNKTVYPLEKVTMEGECYHKTCF  130



>ref|XP_010469046.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=217

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  K+  + + E +R
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTAGKT--EKSNETSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  91   APNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  143


 Score = 53.9 bits (128),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS  439
            +CFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+ A +
Sbjct  129  TCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANN  178


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>gb|KFK35321.1| hypothetical protein AALP_AA5G269200 [Arabis alpina]
Length=214

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC  TL +SNYSSM+GVLYCK HFEQLFKESGN++KNF +  K+  + + E+T+
Sbjct  33   SCFRCSHCNHTLVISNYSSMDGVLYCKTHFEQLFKESGNYSKNFHTAGKT--EKSNEVTK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+HGGC LT S
Sbjct  91   APSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKNCFRCAHGGCHLTHS  143


 Score = 50.4 bits (119),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRC+H    L  S+Y+++ GVLYCK HF QLF E GN++    S          E T 
Sbjct  129  NCFRCAHGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNYSHVLASANNHRRTTEEEKTE  188

Query  470  SPSKAA  487
            +    A
Sbjct  189  ANENEA  194


 Score = 45.4 bits (106),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKNCF  131


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_010413441.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X1 [Camelina 
sativa]
 ref|XP_010413442.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X2 [Camelina 
sativa]
Length=217

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  K+  + + E +R
Sbjct  33   SCFRCSHCNGTLVISNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTAGKT--EKSNETSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  91   APNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  143


 Score = 53.9 bits (128),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKS  439
            +CFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+ A +
Sbjct  129  TCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANN  178


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_001771340.1| predicted protein [Physcomitrella patens]
 gb|EDQ63900.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   153 bits (387),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQ-SPAKSADKL  451
            ++   SCFRC+HCKGTLKL++Y+S+EGVLYCKPHFEQL K +G+F+K+F+  P++   KL
Sbjct  28   VVYHKSCFRCNHCKGTLKLASYASLEGVLYCKPHFEQLLKLTGSFDKSFEHKPSEGLKKL  87

Query  452  TPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
              +  + PSKA+ MFSGTQ+KC  C KT YP++K TVE   YHK CFKC HGGC+++PS
Sbjct  88   PEKGEKVPSKASLMFSGTQDKCIACSKTVYPIDKTTVEGLPYHKHCFKCVHGGCTISPS  146


 Score = 55.8 bits (133),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKAC+KTVY VE L+ADG+ YHKS  
Sbjct  1    MAFSGTQQKCKACDKTVYLVEQLTADGVVYHKSCF  35


 Score = 56.6 bits (135),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK  415
            CF+C H   T+  SNY+++EG LYCKPH+ QLFKE GN+++
Sbjct  133  CFKCVHGGCTISPSNYAALEGRLYCKPHYSQLFKEKGNYSQ  173


 Score = 43.9 bits (102),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            +K  + F GTQ KC AC KTVYP++  + +G+ YHK
Sbjct  96   SKASLMFSGTQDKCIACSKTVYPIDKTTVEGLPYHK  131


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT Y +E++T +   YHKSCF+C+H
Sbjct  3    FSGTQQKCKACDKTVYLVEQLTADGVVYHKSCFRCNH  39



>ref|XP_010053293.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 ref|XP_010053294.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 ref|XP_010053295.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
Length=219

 Score =   155 bits (393),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHC G L +S++SSM+G LYCKPHFEQLFKE+G+++K F    KS+++    L+R
Sbjct  33   TCFKCSHCNGKLVISSFSSMDGALYCKPHFEQLFKETGSYSKKFHQLGKSSNQQQNLLSR  92

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +  FSGTQ+KCA C KTAYP+EK+TVE +SYHKSCF+CSHGGC LTPS
Sbjct  93   TPSKLSHRFSGTQDKCALCLKTAYPIEKLTVEGESYHKSCFRCSHGGCFLTPS  145


 Score = 53.1 bits (126),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M F GTQ KCKAC+KTV+ +EL+SADG+ YHK+  
Sbjct  1    MGFSGTQDKCKACDKTVHLIELVSADGVPYHKTCF  35


 Score = 58.9 bits (141),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    L  S Y++++G+LYCKPHF QLFKE G++N
Sbjct  131  SCFRCSHGGCFLTPSTYAALDGILYCKPHFSQLFKEKGSYN  171


 Score = 42.4 bits (98),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C KT YP+E L+ +G +YHKS  
Sbjct  101  FSGTQDKCALCLKTAYPIEKLTVEGESYHKSCF  133


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGTQ+KC  C KT + +E V+ +   YHK+CFKCSH
Sbjct  3    FSGTQDKCKACDKTVHLIELVSADGVPYHKTCFKCSH  39



>ref|XP_008677533.1| PREDICTED: uncharacterized LOC100381874 isoform X1 [Zea mays]
 gb|AFW63175.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB04943.1| LIM transcription factor, partial [Zea mays]
Length=207

 Score =   154 bits (389),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPELT  466
            +CF+CSHCKG L +S+YSSM+GVLYCK HFEQLFKE+GNF+K FQ     S++K  P   
Sbjct  33   TCFKCSHCKGVLSISSYSSMDGVLYCKTHFEQLFKETGNFSKKFQGGGGASSNKNDP--A  90

Query  467  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            ++PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHK CFKCSHGGC LT S
Sbjct  91   KAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKGCFKCSHGGCILTTS  144


 Score = 54.7 bits (130),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCF  35


 Score = 52.8 bits (125),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            CF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N
Sbjct  131  CFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYN  170


 Score = 45.4 bits (106),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHK   
Sbjct  94   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKGCF  132


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC  C KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|XP_007051870.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX96027.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=276

 Score =   159 bits (402),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNF +          EL+R
Sbjct  101  TCFKCSHCKGNLVMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFHTVKSERQN---ELSR  157

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  158  TPSKVSSLFCGTQDKCAACQKTVYPLEKVTMEGECYHKNCFRCAHGGCHLTHS  210


 Score = 49.7 bits (117),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +KK M+F GT  KCKAC++TV+ V++LS +G+ YHK+  
Sbjct  65   SKKEMAFTGTLDKCKACDRTVHVVDMLSLEGVPYHKTCF  103


 Score = 54.3 bits (129),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H    L  S+Y+++ GVLYCK HF QLF E GN+N   Q+
Sbjct  196  NCFRCAHGGCHLTHSSYAALNGVLYCKHHFAQLFMEKGNYNHVLQA  241


 Score = 44.3 bits (103),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G  YHK+  
Sbjct  166  FCGTQDKCAACQKTVYPLEKVTMEGECYHKNCF  198



>ref|XP_004133874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155817.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN56534.1| hypothetical protein Csa_3G122580 [Cucumis sativus]
Length=205

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL +S+YS M+GVLYCK HFEQLFKESGNF+KNFQ+  KS+DK   +LTR
Sbjct  33   NCFKCSHCKGTLSMSSYSWMDGVLYCKTHFEQLFKESGNFSKNFQT--KSSDKPN-DLTR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLT  622
            +PSK +SMFSGTQ+KC+ C KT YPLEKV++E + YHK CF+C+HGGC LT
Sbjct  90   TPSKLSSMFSGTQDKCSVCTKTVYPLEKVSLEGECYHKKCFRCAHGGCHLT  140


 Score = 51.6 bits (122),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 36/72 (50%), Gaps = 0/72 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  472
            CFRC+H    L   +Y++++GVLYCK HF QLF   GN+N   ++ A       P     
Sbjct  129  CFRCAHGGCHLTHCSYAALDGVLYCKHHFAQLFMVKGNYNHVLEAAANKKTTTPPADHTD  188

Query  473  PSKAASMFSGTQ  508
                 S  SG Q
Sbjct  189  EDAEPSPRSGEQ  200


 Score = 42.4 bits (98),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 26/43 (60%), Gaps = 2/43 (5%)
 Frame = +1

Query  163  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHK  285
             D   T  ++S  F GTQ KC  C KTVYP+E +S +G  YHK
Sbjct  85   NDLTRTPSKLSSMFSGTQDKCSVCTKTVYPLEKVSLEGECYHK  127


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHK+CFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSH  39



>ref|XP_002878372.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54631.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL + NYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  K+  + + E TR
Sbjct  34   SCFRCSHCNGTLVICNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTAGKT--EKSNETTR  91

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  92   APNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  144


 Score = 56.6 bits (135),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRC+H    L  S+Y++++G+LYCK HF QLF E GN+N   Q+ A        E   
Sbjct  130  TCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYNHVLQAAANHRRTAAEEDKT  189

Query  470  SPSK  481
             P +
Sbjct  190  EPKE  193


 Score = 45.4 bits (106),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  100  FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  132


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  488  SMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            + F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  2    AAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  40



>ref|XP_009340168.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3 [Pyrus 
x bretschneideri]
Length=243

 Score =   159 bits (402),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 25/135 (19%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKG L +S YSSM+G+LYCKPHFEQLFKESGNF+KNF   AKSA+K   +L R
Sbjct  33   SCFKCSHCKGFLSMSTYSSMDGILYCKPHFEQLFKESGNFSKNF---AKSAEKQGEQLNR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEK----------------------VTVENQSYHK  583
             PSK +++FSGTQ+KCATC KT YPLEK                      VT+E +SYHK
Sbjct  90   VPSKLSALFSGTQDKCATCSKTVYPLEKVSNIIKGINLISMSPCFSXQTIVTLEGESYHK  149

Query  584  SCFKCSHGGCSLTPS  628
            SCF+C+HGGC+LT S
Sbjct  150  SCFRCAHGGCALTHS  164


 Score = 49.3 bits (116),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY  E+LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCF  35


 Score = 55.8 bits (133),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            SCFRC+H    L  S+Y++++GVLYCK HF QLF E GN++   Q+ A
Sbjct  150  SCFRCAHGGCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA  197


 Score = 36.6 bits (83),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (58%), Gaps = 7/40 (18%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSA--DGINYHKSVLLQMQP  309
            F GTQ KC  C KTVYP+E +S    GIN     L+ M P
Sbjct  98   FSGTQDKCATCSKTVYPLEKVSNIIKGIN-----LISMSP  132



>ref|XP_011022732.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=212

 Score =   156 bits (394),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  472
            CF+CSHC G L +S+YSS++GVLYCKPH++QLFKE+GNF K  QS  +  + LT    ++
Sbjct  34   CFKCSHCNGLLVMSSYSSIDGVLYCKPHYDQLFKETGNFTKKLQSSGEKKNGLT----KA  89

Query  473  PSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PSK +SMFSGTQ+KCA+C KT YPLEKVTVE + +HKSCF+CSHGGC +TPS
Sbjct  90   PSKLSSMFSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFITPS  141


 Score = 52.4 bits (124),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            M F GT +KCKAC+KTVY +EL+SADG+ YHK
Sbjct  1    MGFTGTLEKCKACDKTVYFIELVSADGVPYHK  32


 Score = 51.2 bits (121),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    +  S+Y++++G+LYCK HF QLFK+ G+++
Sbjct  127  SCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSYS  167


 Score = 41.6 bits (96),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KTVYP+E ++ +G  +HKS  
Sbjct  97   FSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCF  129



>ref|XP_002320783.2| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE99098.2| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKE G+F+KNFQ   K   + T +L+R
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKEGGDFSKNFQ---KGKPERTHDLSR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK +S+F GTQ+KC+ CGKT YPLEKVT+E + YHK+CF+C+HGGC LT S
Sbjct  90   IPSKLSSVFCGTQDKCSACGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHS  142


 Score = 55.5 bits (132),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPELT  466
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E G ++    S A K ++   PEL 
Sbjct  128  TCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNSTPPELA  187

Query  467  RS-PSKAASM  493
             S P + A++
Sbjct  188  GSNPEEGAAV  197


 Score = 43.1 bits (100),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHK+  
Sbjct  98   FCGTQDKCSACGKTVYPLEKVTMEGECYHKTCF  130



>ref|XP_004953255.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=197

 Score =   155 bits (391),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKGTL +S+YSSM+GVLYCK HFEQLFKE+G F+K FQ    S      +  +
Sbjct  33   TCFKCSHCKGTLSISSYSSMDGVLYCKTHFEQLFKETGTFSKKFQGGGSSNK---SDQAK  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  90   APSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTS  142


 Score = 53.1 bits (126),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+  
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCF  35


 Score = 55.5 bits (132),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP  430
            SCF+CSH    L  S+Y+++ G+LYCK HF QLFKE G++N   Q+ 
Sbjct  128  SCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTA  174


 Score = 47.0 bits (110),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHKS  
Sbjct  92   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCF  130


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GTQ+KC TC KT + ++ +T +  SYHK+CFKCSH
Sbjct  3    FTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSH  39



>ref|XP_006652565.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=200

 Score =   157 bits (396),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+K F    +S+DK   EL R
Sbjct  33   TCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKKFTPGCRSSDK---ELAR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  90   APSKISSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  142


 Score = 51.6 bits (122),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 51.6 bits (122),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G++N
Sbjct  128  SCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYN  168


 Score = 47.8 bits (112),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  92   SKISSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  130



>ref|NP_001053405.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAE04568.1| OSJNBb0039L24.7 [Oryza sativa Japonica Group]
 emb|CAE54551.1| OSJNBa0081C01.26 [Oryza sativa Japonica Group]
 dbj|BAF15319.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAJ86411.1| OSIGBa0125M19.14 [Oryza sativa Indica Group]
 gb|EAY94955.1| hypothetical protein OsI_16763 [Oryza sativa Indica Group]
 gb|EAZ31441.1| hypothetical protein OsJ_15578 [Oryza sativa Japonica Group]
 dbj|BAG91667.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEJ08685.1| PLIM2 [Oryza sativa]
Length=201

 Score =   156 bits (395),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+K F    +S DK   EL R
Sbjct  33   TCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKKFAPGCRSTDK---ELAR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK  S FSGTQ+KCA C KT YPLEK+T+E +SYHKSCFKCSHGGC LT S
Sbjct  90   APSKICSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTS  142


 Score = 51.6 bits (122),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCF  35


 Score = 51.6 bits (122),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G++N
Sbjct  128  SCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYN  168


 Score = 47.4 bits (111),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 9/50 (18%)
 Frame = +1

Query  172  RSTKKRMS---------FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            RST K ++         F GTQ KC AC+KTVYP+E L+ +G +YHKS  
Sbjct  81   RSTDKELARAPSKICSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCF  130



>ref|XP_006491462.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|KDO86087.1| hypothetical protein CISIN_1g040947mg [Citrus sinensis]
Length=210

 Score =   159 bits (402),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS---PAKSADKLTPE  460
            SCF+CSHCKGTL +SNYSSM+GVLYCKPHFEQLFKESGNF+KNFQ+   P+  +++    
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKPHFEQLFKESGNFSKNFQTGKNPSSCSNQ----  88

Query  461  LTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
              R+PSK +S+FSGTQ+KCA C KT YPLEKVT+E   +HK+CF+C+HGGC LT S
Sbjct  89   -NRTPSKLSSLFSGTQDKCAACEKTVYPLEKVTMEGDCFHKTCFRCAHGGCPLTHS  143


 Score = 48.9 bits (115),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCF  35


 Score = 51.6 bits (122),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNF  409
            +CFRC+H    L  S+Y++++GVLYCK HF QLF E GN+
Sbjct  129  TCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGNY  168


 Score = 43.9 bits (102),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC ACEKTVYP+E ++ +G  +HK+  
Sbjct  99   FSGTQDKCAACEKTVYPLEKVTMEGDCFHKTCF  131


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +++E   YHKSCFKCSH
Sbjct  3    FTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSH  39



>ref|XP_002511828.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF50497.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=210

 Score =   157 bits (398),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+CSHCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ  A   +K       
Sbjct  33   SCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ--AGKTEKQNDSSRA  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             PSK +S+F GTQ+KC+ CGKT YPLEKVT+E + +HKSCF+C+HGGC LT S
Sbjct  91   PPSKVSSLFCGTQDKCSACGKTVYPLEKVTMEGECFHKSCFRCAHGGCPLTHS  143


 Score = 49.7 bits (117),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GT  KCKAC+KTVY V++LS +G+ YHKS  
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGVPYHKSCF  35


 Score = 53.1 bits (126),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAK----SADKLTP  457
            SCFRC+H    L  S+Y++++GVLYCK HF QLF E G++    Q+ +     S+    P
Sbjct  129  SCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGSYTHVLQAASHKRSTSSTTPPP  188

Query  458  ELTRSPSKAAS  490
            EL   P++ AS
Sbjct  189  ELAE-PTEDAS  198


 Score = 43.1 bits (100),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  +HKS  
Sbjct  99   FCGTQDKCSACGKTVYPLEKVTMEGECFHKSCF  131



>emb|CDY27358.1| BnaC04g50470D [Brassica napus]
Length=230

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL++S YSSM+GVLYCK HFEQLFKESGNF+KNFQ+     +K   ++TR
Sbjct  33   SCFRCSHCNGTLQMSTYSSMDGVLYCKTHFEQLFKESGNFSKNFQT--GKTEKSNDQMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA+C KT YPLEKV +E + YHK+CFKC+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHS  143


 Score = 52.4 bits (124),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CF+C+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  129  TCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  176


 Score = 42.0 bits (97),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC +C KTVYP+E ++ +G  YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCF  131


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSH  39



>gb|KHN29376.1| Pollen-specific protein SF3 [Glycine soja]
Length=219

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AKS+DK   E  +
Sbjct  33   NCFRCSHCKGCLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQT-AKSSDKQN-ETHK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +SMFSGT +KC+ C KT YPLEK+T+E + YHK+CF+C+H GC LT S
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHS  143


 Score = 49.7 bits (117),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+  
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCF  35


 Score = 54.7 bits (130),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H    L  S+Y++++GVLYC+ HF+QLF E GN++   QS
Sbjct  129  NCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQS  174


 Score = 39.7 bits (91),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+  
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCF  131



>ref|XP_002969252.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
 gb|EFJ29340.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
Length=194

 Score =   157 bits (398),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 7/125 (6%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            ++   +CFRC HCKGTLKLSNY+S+EGVLYCKPH EQLF+++G+F+K+F S     + L 
Sbjct  28   VLYHKACFRCQHCKGTLKLSNYASLEGVLYCKPHLEQLFRKTGSFDKSFDSVGTPKNSLK  87

Query  455  PELTRSP-------SKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGC  613
             E  R         SK + +FSGTQEKC +C KT YPLEKV+VE QSYHKSCFKC+HGGC
Sbjct  88   QERERETVPSKPVVSKLSRLFSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGC  147

Query  614  SLTPS  628
             ++PS
Sbjct  148  VISPS  152


 Score = 48.9 bits (115),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F   QQKCK+CEKTVY V+ LSADG+ YHK+  
Sbjct  1    MAFAVRQQKCKSCEKTVYLVDQLSADGVLYHKACF  35


 Score = 52.8 bits (125),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 5/55 (9%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK-----NFQSPAKS  439
            SCF+C+H    +  SNY+++EG+LYCK H+ QLF E GN+++     + + PAK+
Sbjct  138  SCFKCTHGGCVISPSNYAALEGMLYCKHHYSQLFMEKGNYSQLTKAASMKLPAKT  192


 Score = 45.8 bits (107),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ+KC +C KTVYP+E +S +G +YHKS  
Sbjct  108  FSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCF  140



>ref|XP_003533616.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=219

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AKS+DK   E  +
Sbjct  33   NCFRCSHCKGCLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQT-AKSSDKQN-ETHK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +SMFSGT +KC+ C KT YPLEK+T+E + YHK+CF+C+H GC LT S
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHS  143


 Score = 49.7 bits (117),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+  
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCF  35


 Score = 54.7 bits (130),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  427
            +CFRC+H    L  S+Y++++GVLYC+ HF+QLF E GN++   QS
Sbjct  129  NCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQS  174


 Score = 39.3 bits (90),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+  
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCF  131



>ref|XP_003580212.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Brachypodium 
distachyon]
Length=205

 Score =   156 bits (394),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = +2

Query  275  IITSLSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLT  454
            +I   +CF+CSHCKG L + +YSSM+GVLYCK HFEQLFKE+G+F+K F +P   +D+  
Sbjct  28   VIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHFEQLFKETGSFSKKF-TPGTKSDR--  84

Query  455  PELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             EL+R+PSK +S+FSGTQ+KC  C KT YPLEK+T+E ++YHKSCFKCSHGGC LT S
Sbjct  85   GELSRAPSKLSSIFSGTQDKCTACTKTVYPLEKMTLEGEAYHKSCFKCSHGGCILTTS  142


 Score = 50.4 bits (119),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+  
Sbjct  1    MSFTGTQDKCFACDKTVHFIDLLTADGVIYHKTCF  35


 Score = 50.1 bits (118),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELT  466
            SCF+CSH    L  S+Y+++ GVLYCK HF QLF E G+++ + +  + S + L P++T
Sbjct  128  SCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYS-HMKKKSDSQEVL-PDVT  184


 Score = 44.7 bits (104),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC KTVYP+E ++ +G  YHKS  
Sbjct  98   FSGTQDKCTACTKTVYPLEKMTLEGEAYHKSCF  130



>ref|XP_006292212.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
 gb|EOA25110.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
Length=216

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL + NYSSM+GVLYCK HFEQLFKESGNF+KNFQ+  K+  + + E +R
Sbjct  33   SCFRCSHCNGTLVICNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTAGKT--EKSNETSR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +S FSGTQ+KCA C KT YPLEK+T+E +SYHK+CF+C+H GC LT S
Sbjct  91   APNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHS  143


 Score = 55.1 bits (131),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRC+H    L  S+Y++++G+LYCK HF QLF E GN++   Q+ A        E   
Sbjct  129  TCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANHRRSGAEEDKA  188

Query  470  SPSKAASMFSGTQEK  514
             P       + T+E+
Sbjct  189  EPKDEDEANNPTEEE  203


 Score = 45.4 bits (106),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E ++ +G +YHK+  
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCF  131


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E   YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSH  39



>ref|XP_009142366.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=229

 Score =   159 bits (402),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL+++ YSSM+GVLYCK HFEQLFKESGNF+KNFQ+     +K   ++TR
Sbjct  33   SCFRCSHCNGTLQMTTYSSMDGVLYCKTHFEQLFKESGNFSKNFQT--GKTEKSNDQMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA+C KT YPLEKV +E + YHK+CFKC+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHS  143


 Score = 47.4 bits (111),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCF  35


 Score = 52.4 bits (124),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CF+C+H    L  S+Y+S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  129  TCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  176


 Score = 42.4 bits (98),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC +C KTVYP+E ++ +G  YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCF  131


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSH  39



>emb|CDY37066.1| BnaA04g26440D [Brassica napus]
Length=229

 Score =   159 bits (401),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCFRCSHC GTL+++ YSSM+GVLYCK HFEQLFKESGNF+KNFQ+     +K   ++TR
Sbjct  33   SCFRCSHCNGTLQMTTYSSMDGVLYCKTHFEQLFKESGNFSKNFQT--GKTEKSNDQMTR  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S FSGTQ+KCA+C KT YPLEKV +E + YHK+CFKC+H GC LT S
Sbjct  91   APSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHS  143


 Score = 47.4 bits (111),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKS  
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCF  35


 Score = 53.1 bits (126),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 6/77 (8%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNK------NFQSPAKSADKL  451
            +CF+C+H    L  S+Y+S+ GVLYCK HF QLF E G++N       N +  A S    
Sbjct  129  TCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRTASSGAST  188

Query  452  TPELTRSPSKAASMFSG  502
             P     P   A++  G
Sbjct  189  PPSDDHKPEDNAAIPEG  205


 Score = 42.4 bits (98),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query  172  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            R+  K  SF  GTQ KC +C KTVYP+E ++ +G  YHK+  
Sbjct  90   RAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCF  131


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +T+E  +YHKSCF+CSH
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSH  39



>ref|XP_007139894.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
 gb|ESW11888.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
Length=208

 Score =   158 bits (400),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ A+S+DK   E+ +
Sbjct  33   NCFRCSHCKGCLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQT-ARSSDK-QNEVNK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +SMFSGT +KC+ C KT YPLEK+T+E + YHK+CF+C+H GC LT S
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHS  143


 Score = 47.8 bits (112),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V+LL+ +G  YHK+  
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGTPYHKNCF  35


 Score = 55.8 bits (133),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            +CFRC+H    L  S+Y++++GVLYC+ HF+QLF E GN++   Q+ A
Sbjct  129  NCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQAAA  176


 Score = 39.7 bits (91),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+  
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCF  131



>ref|XP_002509768.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF51155.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=215

 Score =   155 bits (391),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+CSHC G L +S+YSSMEGVLYCKPHFEQLF+E+G+F K F S  +  + L     +
Sbjct  33   TCFKCSHCDGRLVMSSYSSMEGVLYCKPHFEQLFRETGSFGKKFPSSVEKKNGLV----K  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+FSGTQ+KCA C KTAYPLEK++VE + YHKSCF+CSHGGC LTPS
Sbjct  89   TPSKLSSLFSGTQDKCAKCKKTAYPLEKLSVEGEFYHKSCFRCSHGGCYLTPS  141


 Score = 51.2 bits (121),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M F GT +KCKAC+KTV+ +E+++ADGI+YHK+  
Sbjct  1    MGFSGTTEKCKACDKTVHFIEMITADGISYHKTCF  35


 Score = 54.3 bits (129),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    L  S Y++++G +YCKPHF QLFKE G+++
Sbjct  127  SCFRCSHGGCYLTPSTYAALDGFIYCKPHFAQLFKEKGSYS  167


 Score = 43.1 bits (100),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC  C+KT YP+E LS +G  YHKS  
Sbjct  97   FSGTQDKCAKCKKTAYPLEKLSVEGEFYHKSCF  129


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            FSGT EKC  C KT + +E +T +  SYHK+CFKCSH
Sbjct  3    FSGTTEKCKACDKTVHFIEMITADGISYHKTCFKCSH  39



>gb|ABK22236.1| unknown [Picea sitchensis]
Length=187

 Score =   154 bits (388),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSA--DKLTPEL  463
            +CFRC HC GTLKLSNYSS EGVLYCKPHF+QLFK +G+ +K+F+   K+   +KL    
Sbjct  33   ACFRCHHCNGTLKLSNYSSFEGVLYCKPHFDQLFKRTGSLDKSFEGTPKAVKNEKLNDGE  92

Query  464  TRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
             ++PS+ +++FSGTQEKC  CG T YP+EKV+VE   YHK CFKC HGGC ++PS
Sbjct  93   IKTPSRVSALFSGTQEKCLACGNTVYPIEKVSVEGVGYHKQCFKCIHGGCVISPS  147


 Score = 52.0 bits (123),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            M+F GTQQKCKACEKTVY V+ L+ADG  +HK+  
Sbjct  1    MAFAGTQQKCKACEKTVYVVDQLTADGSVFHKACF  35


 Score = 50.4 bits (119),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  433
            CF+C H    +  SNY ++EG LYCK H  QLFKE GN+++  ++P+
Sbjct  134  CFKCIHGGCVISPSNYIAIEGRLYCKHHHAQLFKEKGNYSQLIKTPS  180


 Score = 46.2 bits (108),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHK  285
            T  R+S  F GTQ+KC AC  TVYP+E +S +G+ YHK
Sbjct  95   TPSRVSALFSGTQEKCLACGNTVYPIEKVSVEGVGYHK  132



>emb|CDY38028.1| BnaCnng08890D [Brassica napus]
Length=205

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            SCF+C+HCKGTL +SNYSSM+GVLYCK HFEQLFKESGNF+KNFQ P K+     PE ++
Sbjct  33   SCFKCTHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ-PGKTEK---PEQSK  88

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +PSK +S+F GTQ+KCA C KT YPLEKV +E + +HK+CFKC+HGGC LT S
Sbjct  89   TPSKISSIFCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHS  141


 Score = 54.7 bits (130),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSP----AKSADKLTP  457
            +CF+C+H    L  S+Y+S++GVLYC+ HF QLF E GN+    QS       S + L P
Sbjct  127  TCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHRRTASGNTLPP  186

Query  458  ELT  466
            E T
Sbjct  187  ETT  189


 Score = 42.4 bits (98),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC AC+KTVYP+E +  +G  +HK+  
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCF  129


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  494  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSH  604
            F+GT +KC  C KT Y ++ +++E   YHKSCFKC+H
Sbjct  3    FTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTH  39



>gb|KJB52067.1| hypothetical protein B456_008G245300 [Gossypium raimondii]
Length=217

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CF+C+HC G L +SNY SMEGVLYCKPHFEQLFKE+G + KNFQS  K +DK   + TR
Sbjct  33   TCFKCTHCNGLLVMSNYCSMEGVLYCKPHFEQLFKETGTYTKNFQS--KKSDKPNGQ-TR  89

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ A+ FSGTQ+KC  C KTAYPLEKVTVE ++YHKSCF+CS GGC LTPS
Sbjct  90   TPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVEGENYHKSCFRCSPGGCLLTPS  142


 Score = 47.0 bits (110),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESG  403
            SCFRCS     L  S Y++M+G+LYCK HF QLF E G
Sbjct  128  SCFRCSPGGCLLTPSTYAAMDGILYCKHHFAQLFMEKG  165


 Score = 44.7 bits (104),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 2/41 (5%)
 Frame = +1

Query  178  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            T  R++  F GTQ KC  C KT YP+E ++ +G NYHKS  
Sbjct  90   TPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVEGENYHKSCF  130



>ref|XP_002304483.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
 gb|EEE79462.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
Length=210

 Score =   153 bits (387),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 6/112 (5%)
 Frame = +2

Query  293  CFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  472
            CF+CSHC G L +S+YSS++GVLYC+PH++QLFKE+GNF K  QS         P  T++
Sbjct  34   CFKCSHCNGLLVMSSYSSIDGVLYCRPHYDQLFKETGNFTKKLQSCE------IPLFTKA  87

Query  473  PSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            PSK +SMFSGTQ+KCA+C KT YPLEKVTVE + +HKSCF+CSHGGC +TPS
Sbjct  88   PSKLSSMFSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFITPS  139


 Score = 52.4 bits (124),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHK  285
            M F GT +KCKAC+KTVY +EL+SADG+ YHK
Sbjct  1    MGFTGTLEKCKACDKTVYFIELVSADGVPYHK  32


 Score = 51.2 bits (121),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  412
            SCFRCSH    +  S+Y++++G+LYCK HF QLFK+ G+++
Sbjct  125  SCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSYS  165


 Score = 41.6 bits (96),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GTQ KC +C+KTVYP+E ++ +G  +HKS  
Sbjct  95   FSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCF  127



>ref|XP_003551659.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHM99398.1| Pollen-specific protein SF3 [Glycine soja]
Length=216

 Score =   156 bits (394),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTR  469
            +CFRCSHCKG L ++ YSSM+GVLYCKPHFEQLFKESGNF+KNFQ+ AKS+DK   E  +
Sbjct  33   NCFRCSHCKGYLTMNTYSSMDGVLYCKPHFEQLFKESGNFSKNFQT-AKSSDKQN-ETNK  90

Query  470  SPSKAASMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPS  628
            +P++ +SMFSGT +KC+ C KT YPLEK+T+E + YHK+CF+C+H GC LT S
Sbjct  91   APNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHS  143


 Score = 49.3 bits (116),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+  
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCF  35


 Score = 57.4 bits (137),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  290  SCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPE  460
            +CFRC+H    L  S+Y++++GVLYC+ HF+QLF E GN++   QS A     +TPE
Sbjct  129  NCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQS-ANHKKNVTPE  184


 Score = 38.1 bits (87),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  FIGTQQKCKACEKTVYPVELLSADGINYHKSVL  294
            F GT  KC  C KTVYP+E ++ +G  YHK+  
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCF  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250