BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006D06 634 bp,

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758839.1|  PREDICTED: universal stress protein A-like p...    270   1e-88   Nicotiana sylvestris
ref|XP_009606023.1|  PREDICTED: universal stress protein A-like p...    266   3e-87   Nicotiana tomentosiformis
ref|XP_009783752.1|  PREDICTED: uncharacterized protein C167.05-like    266   4e-87   Nicotiana sylvestris
ref|XP_009606017.1|  PREDICTED: uncharacterized protein C167.05-like    266   5e-87   Nicotiana tomentosiformis
ref|XP_004246377.1|  PREDICTED: universal stress protein A-like p...    264   2e-86   Solanum lycopersicum
gb|AGT78204.1|  universal stress protein                                261   3e-85   Solanum torvum [berenjena cimarrona]
gb|AID16042.1|  putative universal stress protein                       261   4e-85   Catharanthus roseus [chatas]
ref|XP_006357577.1|  PREDICTED: universal stress protein A-like p...    260   6e-85   Solanum tuberosum [potatoes]
ref|XP_006357578.1|  PREDICTED: universal stress protein A-like p...    257   1e-83   Solanum tuberosum [potatoes]
ref|XP_004246376.1|  PREDICTED: uncharacterized protein C167.05-like    255   8e-83   Solanum lycopersicum
gb|EYU41796.1|  hypothetical protein MIMGU_mgv1a015230mg                253   4e-82   Erythranthe guttata [common monkey flower]
emb|CDP06551.1|  unnamed protein product                                251   2e-81   Coffea canephora [robusta coffee]
gb|AHL20266.1|  universal stress protein                                246   2e-79   Olea europaea
ref|XP_011077614.1|  PREDICTED: universal stress protein A-like p...    245   4e-79   Sesamum indicum [beniseed]
ref|XP_009602951.1|  PREDICTED: universal stress protein A-like p...    241   2e-77   Nicotiana tomentosiformis
gb|KHN15657.1|  Universal stress protein A-like protein                 241   4e-77   Glycine soja [wild soybean]
gb|KHN06032.1|  Universal stress protein                                239   1e-76   Glycine soja [wild soybean]
ref|XP_009776099.1|  PREDICTED: universal stress protein A-like p...    239   1e-76   Nicotiana sylvestris
ref|NP_001238489.1|  uncharacterized protein LOC100499951               239   1e-76   Glycine max [soybeans]
ref|NP_001236136.1|  uncharacterized protein LOC100306513               239   1e-76   Glycine max [soybeans]
ref|XP_010044014.1|  PREDICTED: universal stress protein A-like p...    236   2e-75   Eucalyptus grandis [rose gum]
ref|XP_002275745.1|  PREDICTED: universal stress protein A-like p...    236   3e-75   Vitis vinifera
ref|XP_010101861.1|  hypothetical protein L484_023651                   234   1e-74   Morus notabilis
ref|XP_008442491.1|  PREDICTED: uncharacterized protein C167.05         234   2e-74   Cucumis melo [Oriental melon]
ref|XP_007206040.1|  hypothetical protein PRUPE_ppa012560mg             233   2e-74   Prunus persica
ref|XP_006349538.1|  PREDICTED: universal stress protein A-like p...    233   3e-74   Solanum tuberosum [potatoes]
ref|XP_011094934.1|  PREDICTED: universal stress protein A-like p...    233   4e-74   Sesamum indicum [beniseed]
ref|XP_004163858.1|  PREDICTED: uncharacterized protein C167.05-l...    233   5e-74   
gb|KHG25151.1|  hypothetical protein F383_09728                         233   6e-74   Gossypium arboreum [tree cotton]
gb|AFK43920.1|  unknown                                                 232   7e-74   Lotus japonicus
ref|XP_010671709.1|  PREDICTED: uncharacterized protein C167.05         232   1e-73   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006429235.1|  hypothetical protein CICLE_v10012955mg             231   1e-73   Citrus clementina
ref|XP_008240065.1|  PREDICTED: uncharacterized protein C167.05-like    231   1e-73   Prunus mume [ume]
ref|XP_006850424.1|  hypothetical protein AMTR_s00165p00044350          231   1e-73   Amborella trichopoda
ref|XP_004249840.1|  PREDICTED: universal stress protein A-like p...    231   2e-73   Solanum lycopersicum
ref|XP_007026861.1|  Adenine nucleotide alpha hydrolases-like sup...    231   2e-73   Theobroma cacao [chocolate]
ref|XP_008350501.1|  PREDICTED: uncharacterized protein C167.05-like    230   5e-73   Malus domestica [apple tree]
ref|XP_009358793.1|  PREDICTED: uncharacterized protein C167.05         229   7e-73   Pyrus x bretschneideri [bai li]
ref|XP_007133981.1|  hypothetical protein PHAVU_010G008900g             229   1e-72   Phaseolus vulgaris [French bean]
ref|XP_008370018.1|  PREDICTED: uncharacterized protein C167.05         229   1e-72   Malus domestica [apple tree]
ref|XP_008359768.1|  PREDICTED: uncharacterized protein C167.05-like    229   1e-72   Malus domestica [apple tree]
ref|XP_007026862.1|  Adenine nucleotide alpha hydrolases-like sup...    226   9e-72   Theobroma cacao [chocolate]
ref|XP_009378881.1|  PREDICTED: uncharacterized protein C167.05-like    226   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_004507182.1|  PREDICTED: universal stress protein A-like p...    226   2e-71   Cicer arietinum [garbanzo]
gb|ACJ83924.1|  unknown                                                 225   3e-71   Medicago truncatula
gb|ACJ84043.1|  unknown                                                 225   4e-71   Medicago truncatula
gb|KJB11222.1|  hypothetical protein B456_001G247900                    224   8e-71   Gossypium raimondii
ref|XP_004302689.1|  PREDICTED: uncharacterized protein C167.05         224   1e-70   Fragaria vesca subsp. vesca
ref|XP_011000055.1|  PREDICTED: uncharacterized protein LOC105107721    223   2e-70   Populus euphratica
ref|XP_007140453.1|  hypothetical protein PHAVU_008G113500g             222   5e-70   Phaseolus vulgaris [French bean]
ref|XP_004137751.1|  PREDICTED: uncharacterized protein C167.05-l...    222   5e-70   
ref|XP_010256749.1|  PREDICTED: uncharacterized protein C167.05         222   7e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002877951.1|  universal stress protein family protein            221   1e-69   Arabidopsis lyrata subsp. lyrata
ref|NP_566991.2|  Adenine nucleotide alpha hydrolases-like superf...    221   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529788.1|  PREDICTED: uncharacterized protein C167.05         221   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_002534082.1|  conserved hypothetical protein                     220   4e-69   Ricinus communis
gb|KJB17332.1|  hypothetical protein B456_003G127300                    220   4e-69   Gossypium raimondii
gb|KHG13508.1|  hypothetical protein F383_20265                         220   5e-69   Gossypium arboreum [tree cotton]
gb|KHG19158.1|  hypothetical protein F383_06056                         219   1e-68   Gossypium arboreum [tree cotton]
gb|KFK34646.1|  hypothetical protein AALP_AA5G172700                    219   1e-68   Arabis alpina [alpine rockcress]
ref|XP_006291961.1|  hypothetical protein CARUB_v10018150mg             219   1e-68   Capsella rubella
ref|XP_007016274.1|  Adenine nucleotide alpha hydrolases-like sup...    218   2e-68   Theobroma cacao [chocolate]
ref|XP_010553266.1|  PREDICTED: universal stress protein A-like p...    218   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_006403631.1|  hypothetical protein EUTSA_v10010778mg             218   4e-68   Eutrema salsugineum
ref|XP_006373900.1|  ENOD18 family protein                              217   5e-68   Populus trichocarpa [western balsam poplar]
gb|KHG19157.1|  hypothetical protein F383_06055                         217   7e-68   Gossypium arboreum [tree cotton]
ref|XP_010515911.1|  PREDICTED: universal stress protein A family...    217   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_004492382.1|  PREDICTED: uncharacterized protein C167.05-like    216   1e-67   Cicer arietinum [garbanzo]
ref|NP_001142159.1|  USP family protein                                 216   1e-67   Zea mays [maize]
gb|ACG42306.1|  USP family protein                                      216   1e-67   Zea mays [maize]
ref|XP_010427062.1|  PREDICTED: universal stress protein A family...    216   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009116089.1|  PREDICTED: uncharacterized protein LOC103841315    216   1e-67   Brassica rapa
ref|XP_002323532.2|  hypothetical protein POPTR_0016s10110g             218   2e-67   Populus trichocarpa [western balsam poplar]
gb|KHN05122.1|  Universal stress protein A-like protein                 215   3e-67   Glycine soja [wild soybean]
gb|KJB19521.1|  hypothetical protein B456_003G127400                    215   3e-67   Gossypium raimondii
emb|CDX73512.1|  BnaC08g24910D                                          215   3e-67   Brassica napus [oilseed rape]
gb|ABY84681.1|  universal stress protein 1                              215   4e-67   Gossypium arboreum [tree cotton]
ref|XP_002439902.1|  hypothetical protein SORBIDRAFT_09g022230          215   4e-67   Sorghum bicolor [broomcorn]
ref|XP_010504187.1|  PREDICTED: uncharacterized protein LOC104781260    215   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_004961892.1|  PREDICTED: universal stress protein A-like p...    215   4e-67   Setaria italica
ref|XP_010905389.1|  PREDICTED: universal stress protein A-like p...    214   1e-66   Elaeis guineensis
ref|NP_001236285.1|  uncharacterized protein LOC100527197               213   1e-66   Glycine max [soybeans]
emb|CAC18558.1|  ENOD18 protein                                         213   2e-66   Vicia faba [broad bean]
gb|ABK22721.1|  unknown                                                 212   4e-66   Picea sitchensis
ref|XP_009139276.1|  PREDICTED: universal stress protein A-like p...    211   8e-66   Brassica rapa
ref|XP_010043475.1|  PREDICTED: universal stress protein A-like p...    211   8e-66   Eucalyptus grandis [rose gum]
emb|CDY13163.1|  BnaC04g26720D                                          211   9e-66   Brassica napus [oilseed rape]
emb|CAC18556.1|  early nodulin ENOD18                                   211   1e-65   Vicia faba [broad bean]
ref|XP_010905911.1|  PREDICTED: universal stress protein A-like p...    211   1e-65   Elaeis guineensis
ref|NP_001288953.1|  uncharacterized protein C167.05-like               210   2e-65   Brassica rapa
gb|AFK49059.1|  unknown                                                 211   2e-65   Lotus japonicus
ref|XP_003623213.1|  Early nodulin ENOD18                               211   2e-65   Medicago truncatula
ref|XP_006424952.1|  hypothetical protein CICLE_v10029414mg             211   2e-65   Citrus clementina
ref|XP_002309096.1|  ENOD18 family protein                              210   3e-65   Populus trichocarpa [western balsam poplar]
gb|ABK22475.1|  unknown                                                 210   3e-65   Picea sitchensis
gb|KDO66689.1|  hypothetical protein CISIN_1g041485mg                   210   4e-65   Citrus sinensis [Valencia orange]
ref|XP_011019203.1|  PREDICTED: universal stress protein A-like p...    209   5e-65   Populus euphratica
ref|XP_009405844.1|  PREDICTED: universal stress protein A-like p...    209   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK43282.1|  unknown                                                 209   8e-65   Lotus japonicus
ref|XP_010923192.1|  PREDICTED: universal stress protein A-like p...    209   1e-64   Elaeis guineensis
ref|XP_008811502.1|  PREDICTED: uncharacterized protein C167.05         208   2e-64   Phoenix dactylifera
gb|AFK47553.1|  unknown                                                 207   4e-64   Medicago truncatula
emb|CDY07565.1|  BnaC06g14990D                                          207   5e-64   Brassica napus [oilseed rape]
emb|CAC18557.1|  early nodulin ENOD18                                   207   5e-64   Vicia faba [broad bean]
gb|KDP24530.1|  hypothetical protein JCGZ_25094                         207   6e-64   Jatropha curcas
ref|NP_001236015.1|  uncharacterized protein LOC100306505               207   6e-64   Glycine max [soybeans]
ref|XP_004507155.1|  PREDICTED: uncharacterized protein C167.05-like    206   8e-64   Cicer arietinum [garbanzo]
ref|NP_001235190.1|  uncharacterized protein LOC100499728               206   1e-63   Glycine max [soybeans]
gb|EMT01474.1|  Universal stress protein A-like protein                 206   1e-63   Aegilops tauschii
ref|XP_009392694.1|  PREDICTED: uncharacterized protein C167.05         206   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007132029.1|  hypothetical protein PHAVU_011G060700g             204   6e-63   Phaseolus vulgaris [French bean]
gb|AFK45410.1|  unknown                                                 203   1e-62   Medicago truncatula
ref|XP_002520471.1|  conserved hypothetical protein                     203   2e-62   Ricinus communis
gb|EPS57397.1|  hypothetical protein M569_17421                         204   2e-62   Genlisea aurea
ref|XP_008221790.1|  PREDICTED: uncharacterized protein LOC103321737    202   5e-62   Prunus mume [ume]
gb|AFK37746.1|  unknown                                                 201   7e-62   Lotus japonicus
ref|XP_007206045.1|  hypothetical protein PRUPE_ppa012585mg             201   7e-62   Prunus persica
ref|XP_003568332.1|  PREDICTED: universal stress protein A-like p...    201   8e-62   Brachypodium distachyon [annual false brome]
ref|XP_008386015.1|  PREDICTED: uncharacterized protein LOC103448528    201   1e-61   Malus domestica [apple tree]
ref|XP_008384901.1|  PREDICTED: universal stress protein A-like p...    200   2e-61   Malus domestica [apple tree]
ref|XP_009350161.1|  PREDICTED: universal stress protein A-like p...    199   4e-61   Pyrus x bretschneideri [bai li]
ref|XP_002281607.1|  PREDICTED: uncharacterized protein C167.05         199   6e-61   Vitis vinifera
ref|XP_008657063.1|  PREDICTED: universal stress protein A-like p...    198   1e-60   Zea mays [maize]
ref|XP_004137752.1|  PREDICTED: uncharacterized protein C167.05-l...    196   5e-60   
ref|XP_004291522.1|  PREDICTED: universal stress protein A-like p...    196   1e-59   Fragaria vesca subsp. vesca
ref|XP_006654496.1|  PREDICTED: universal stress protein A-like p...    194   4e-59   Oryza brachyantha
ref|XP_008791855.1|  PREDICTED: universal stress protein A-like p...    193   1e-58   Phoenix dactylifera
ref|NP_001055716.1|  Os05g0453700                                       193   2e-58   
ref|XP_010917276.1|  PREDICTED: universal stress protein A-like p...    193   2e-58   Elaeis guineensis
ref|XP_002458767.1|  hypothetical protein SORBIDRAFT_03g039910          192   2e-58   Sorghum bicolor [broomcorn]
ref|XP_010262906.1|  PREDICTED: uncharacterized protein C167.05-like    192   1e-57   Nelumbo nucifera [Indian lotus]
dbj|BAK06554.1|  predicted protein                                      190   3e-57   Hordeum vulgare subsp. vulgare [barley]
gb|KJB17335.1|  hypothetical protein B456_003G127300                    189   3e-57   Gossypium raimondii
ref|XP_006373899.1|  hypothetical protein POPTR_0016s10110g             188   6e-56   Populus trichocarpa [western balsam poplar]
ref|NP_001044810.1|  Os01g0849600                                       186   6e-56   
ref|XP_003567271.1|  PREDICTED: universal stress protein A-like p...    186   9e-56   
ref|XP_004970581.1|  PREDICTED: uncharacterized protein C167.05-like    186   1e-55   Setaria italica
ref|XP_010685657.1|  PREDICTED: universal stress protein A-like p...    185   2e-55   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008811359.1|  PREDICTED: uncharacterized protein C167.05-l...    184   3e-55   
ref|XP_010062315.1|  PREDICTED: universal stress protein A-like p...    184   3e-55   Eucalyptus grandis [rose gum]
gb|KJB19522.1|  hypothetical protein B456_003G127400                    182   8e-55   Gossypium raimondii
ref|XP_006645015.1|  PREDICTED: uncharacterized protein C167.05-like    183   1e-54   Oryza brachyantha
gb|KCW69440.1|  hypothetical protein EUGRSUZ_F02899                     185   1e-54   Eucalyptus grandis [rose gum]
gb|EEE63940.1|  hypothetical protein OsJ_18765                          183   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010276270.1|  PREDICTED: universal stress protein A-like p...    182   2e-54   Nelumbo nucifera [Indian lotus]
gb|KJB17333.1|  hypothetical protein B456_003G127300                    181   3e-54   Gossypium raimondii
ref|XP_011085896.1|  PREDICTED: universal stress protein A-like p...    181   7e-54   Sesamum indicum [beniseed]
ref|XP_006432876.1|  hypothetical protein CICLE_v10002725mg             181   1e-53   Citrus clementina
ref|XP_008811357.1|  PREDICTED: uncharacterized protein LOC103722...    180   1e-53   Phoenix dactylifera
ref|XP_008227919.1|  PREDICTED: universal stress protein A-like p...    179   6e-53   Prunus mume [ume]
ref|XP_009602053.1|  PREDICTED: universal stress protein A-like p...    176   5e-52   Nicotiana tomentosiformis
ref|XP_011071386.1|  PREDICTED: uncharacterized protein C167.05-like    176   5e-52   Sesamum indicum [beniseed]
ref|XP_006384122.1|  hypothetical protein POPTR_0004s07380g             176   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010101064.1|  Universal stress protein A-like protein            176   8e-52   Morus notabilis
ref|XP_009761731.1|  PREDICTED: universal stress protein A-like p...    175   1e-51   Nicotiana sylvestris
gb|ABQ42110.1|  NOD18 protein                                           173   1e-51   Sonneratia caseolaris
ref|XP_010558670.1|  PREDICTED: universal stress protein A-like p...    175   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_002528512.1|  conserved hypothetical protein                     175   2e-51   Ricinus communis
ref|XP_006357579.1|  PREDICTED: uncharacterized protein LOC102602636    174   2e-51   
gb|ABQ42109.1|  NOD18 protein                                           172   2e-51   Sonneratia alba
ref|XP_010259285.1|  PREDICTED: uncharacterized protein C167.05         174   3e-51   Nelumbo nucifera [Indian lotus]
gb|AID16037.1|  putative universal stress protein                       174   4e-51   Catharanthus roseus [chatas]
ref|XP_011005923.1|  PREDICTED: universal stress protein A-like p...    174   4e-51   Populus euphratica
ref|XP_002305257.2|  hypothetical protein POPTR_0004s07380g             173   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006298705.1|  hypothetical protein CARUB_v10014810mg             172   1e-50   Capsella rubella
emb|CDP01682.1|  unnamed protein product                                172   1e-50   Coffea canephora [robusta coffee]
gb|KHG02876.1|  hypothetical protein F383_26328                         172   2e-50   Gossypium arboreum [tree cotton]
ref|XP_004236679.1|  PREDICTED: universal stress protein A-like p...    172   2e-50   Solanum lycopersicum
ref|XP_006346765.1|  PREDICTED: uncharacterized protein C167.05-like    172   3e-50   Solanum tuberosum [potatoes]
gb|KJB34724.1|  hypothetical protein B456_006G080000                    171   4e-50   Gossypium raimondii
ref|NP_850506.1|  adenine nucleotide alpha hydrolases-like protein      171   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797443.1|  PREDICTED: universal stress protein A-like p...    172   6e-50   Phoenix dactylifera
ref|XP_011005922.1|  PREDICTED: universal stress protein A-like p...    171   7e-50   Populus euphratica
ref|XP_002271154.1|  PREDICTED: universal stress protein A-like p...    170   1e-49   Vitis vinifera
ref|XP_011038407.1|  PREDICTED: universal stress protein A-like p...    170   1e-49   Populus euphratica
ref|XP_009381389.1|  PREDICTED: universal stress protein A-like p...    170   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487759.1|  PREDICTED: universal stress protein A-like p...    170   1e-49   Cicer arietinum [garbanzo]
dbj|BAJ86638.1|  predicted protein                                      170   1e-49   Hordeum vulgare subsp. vulgare [barley]
gb|AFK43932.1|  unknown                                                 170   2e-49   Lotus japonicus
gb|EYU41387.1|  hypothetical protein MIMGU_mgv1a015186mg                170   2e-49   Erythranthe guttata [common monkey flower]
gb|ACR38280.1|  unknown                                                 170   2e-49   Zea mays [maize]
ref|XP_003547361.1|  PREDICTED: universal stress protein A-like p...    170   2e-49   Glycine max [soybeans]
ref|XP_003570541.1|  PREDICTED: uncharacterized protein C167.05-like    169   2e-49   Brachypodium distachyon [annual false brome]
gb|KDP42177.1|  hypothetical protein JCGZ_02907                         170   3e-49   Jatropha curcas
ref|XP_009780200.1|  PREDICTED: uncharacterized protein C167.05         169   3e-49   Nicotiana sylvestris
ref|XP_002884367.1|  universal stress protein family protein            169   3e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002452902.1|  hypothetical protein SORBIDRAFT_04g034630          169   4e-49   Sorghum bicolor [broomcorn]
gb|KJB34720.1|  hypothetical protein B456_006G079900                    168   6e-49   Gossypium raimondii
ref|NP_001132238.1|  hypothetical protein                               168   6e-49   Zea mays [maize]
gb|AGT02387.1|  UspA-like protein                                       168   6e-49   Calotropis procera
ref|XP_002323966.2|  hypothetical protein POPTR_0017s01470g             168   6e-49   Populus trichocarpa [western balsam poplar]
ref|XP_003568882.1|  PREDICTED: universal stress protein A-like p...    168   7e-49   Brachypodium distachyon [annual false brome]
ref|XP_007147360.1|  hypothetical protein PHAVU_006G117600g             168   7e-49   Phaseolus vulgaris [French bean]
gb|EMT31927.1|  hypothetical protein F775_31141                         168   8e-49   Aegilops tauschii
ref|XP_007035783.1|  Adenine nucleotide alpha hydrolases-like sup...    168   1e-48   Theobroma cacao [chocolate]
ref|XP_006841013.1|  hypothetical protein AMTR_s00085p00099740          168   1e-48   Amborella trichopoda
ref|XP_006408321.1|  hypothetical protein EUTSA_v10021680mg             167   1e-48   Eutrema salsugineum
ref|XP_009630214.1|  PREDICTED: uncharacterized protein C167.05 i...    167   1e-48   Nicotiana tomentosiformis
ref|XP_007141947.1|  hypothetical protein PHAVU_008G239500g             167   1e-48   Phaseolus vulgaris [French bean]
ref|XP_004954077.1|  PREDICTED: uncharacterized protein C167.05-l...    167   1e-48   Setaria italica
ref|XP_004954078.1|  PREDICTED: uncharacterized protein C167.05-l...    167   2e-48   
ref|NP_001048266.1|  Os02g0773200                                       167   2e-48   
gb|EEC74090.1|  hypothetical protein OsI_09119                          167   2e-48   Oryza sativa Indica Group [Indian rice]
emb|CDY50688.1|  BnaC05g47950D                                          167   2e-48   Brassica napus [oilseed rape]
gb|KHG02877.1|  hypothetical protein F383_26329                         167   2e-48   Gossypium arboreum [tree cotton]
ref|XP_009370564.1|  PREDICTED: universal stress protein A-like p...    167   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_010508189.1|  PREDICTED: universal stress protein A-like p...    167   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_003616191.1|  Universal stress protein A-like protein            167   3e-48   Medicago truncatula
gb|KDP35746.1|  hypothetical protein JCGZ_10518                         167   3e-48   Jatropha curcas
ref|XP_010064666.1|  PREDICTED: uncharacterized protein C167.05         167   3e-48   Eucalyptus grandis [rose gum]
ref|XP_008797442.1|  PREDICTED: universal stress protein A-like p...    168   3e-48   Phoenix dactylifera
ref|XP_006654074.1|  PREDICTED: universal stress protein A-like p...    166   5e-48   Oryza brachyantha
ref|XP_010931741.1|  PREDICTED: universal stress protein A-like p...    166   5e-48   Elaeis guineensis
ref|XP_004137750.1|  PREDICTED: uncharacterized protein C167.05-l...    166   5e-48   
ref|XP_004163857.1|  PREDICTED: uncharacterized protein C167.05-l...    166   6e-48   
gb|EPS64036.1|  hypothetical protein M569_10742                         166   6e-48   Genlisea aurea
gb|KHN39491.1|  Universal stress protein A-like protein                 166   6e-48   Glycine soja [wild soybean]
gb|EEC78561.1|  hypothetical protein OsI_18538                          166   7e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006647984.1|  PREDICTED: uncharacterized protein C167.05-like    165   9e-48   Oryza brachyantha
emb|CDY43136.1|  BnaA05g32500D                                          165   9e-48   Brassica napus [oilseed rape]
ref|XP_009146047.1|  PREDICTED: universal stress protein A-like p...    165   9e-48   Brassica rapa
ref|XP_009367132.1|  PREDICTED: universal stress protein A-like p...    165   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_006298706.1|  hypothetical protein CARUB_v10014810mg             165   1e-47   Capsella rubella
ref|XP_008381381.1|  PREDICTED: universal stress protein A-like p...    165   1e-47   Malus domestica [apple tree]
gb|EYU29653.1|  hypothetical protein MIMGU_mgv1a015303mg                165   1e-47   Erythranthe guttata [common monkey flower]
gb|KFK37768.1|  hypothetical protein AALP_AA3G027100                    165   1e-47   Arabis alpina [alpine rockcress]
ref|NP_001288857.1|  universal stress protein A-like protein            165   1e-47   Brassica rapa
dbj|BAJ92234.1|  predicted protein                                      165   1e-47   Hordeum vulgare subsp. vulgare [barley]
emb|CDX75899.1|  BnaC03g39820D                                          165   1e-47   Brassica napus [oilseed rape]
gb|ADB54804.1|  universal stress protein 7364                           165   1e-47   Hordeum vulgare subsp. vulgare [barley]
gb|EMT05701.1|  Universal stress protein A-like protein                 165   2e-47   Aegilops tauschii
ref|NP_001288846.1|  universal stress protein A-like protein            164   2e-47   Brassica rapa
dbj|BAJ86930.1|  predicted protein                                      164   3e-47   Hordeum vulgare subsp. vulgare [barley]
emb|CDX82383.1|  BnaA03g34380D                                          164   3e-47   Brassica napus [oilseed rape]
ref|NP_001054704.1|  Os05g0157200                                       164   4e-47   
gb|AAQ02914.1|AF396464_1  C2.6 protein                                  164   4e-47   Pisum sativum [garden pea]
gb|AAX13276.1|  USP family protein                                      164   4e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010463777.1|  PREDICTED: universal stress protein A-like p...    163   4e-47   Camelina sativa [gold-of-pleasure]
gb|KEH28228.1|  adenine nucleotide alpha hydrolase superfamily pr...    164   4e-47   Medicago truncatula
gb|ABY84682.1|  universal stress protein 2                              164   5e-47   Gossypium arboreum [tree cotton]
gb|AID16043.1|  putative universal stress protein                       164   5e-47   Catharanthus roseus [chatas]
ref|XP_002885183.1|  universal stress protein family protein            163   5e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_009135511.1|  PREDICTED: universal stress protein A-like p...    163   6e-47   Brassica rapa
ref|XP_010485662.1|  PREDICTED: universal stress protein A-like p...    163   6e-47   Camelina sativa [gold-of-pleasure]
gb|ADB54803.1|  universal stress protein 7364                           163   6e-47   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008797478.1|  PREDICTED: uncharacterized protein LOC103712673    172   6e-47   
dbj|BAG74754.1|  universal stress protein                               163   8e-47   Hordeum bulbosum
ref|XP_006419393.1|  hypothetical protein CICLE_v10006081mg             163   8e-47   Citrus clementina
emb|CDY52729.1|  BnaC01g44140D                                          162   1e-46   Brassica napus [oilseed rape]
gb|ADB54802.1|  universal stress protein 3739                           162   1e-46   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002519217.1|  conserved hypothetical protein                     162   1e-46   Ricinus communis
ref|XP_010548996.1|  PREDICTED: universal stress protein A-like p...    162   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_008438946.1|  PREDICTED: uncharacterized protein C167.05         162   1e-46   Cucumis melo [Oriental melon]
ref|XP_008223352.1|  PREDICTED: universal stress protein A-like p...    162   2e-46   Prunus mume [ume]
gb|ADB54801.1|  universal stress protein 3739                           162   2e-46   Hordeum vulgare subsp. vulgare [barley]
gb|KDO71923.1|  hypothetical protein CISIN_1g031168mg                   162   2e-46   Citrus sinensis [Valencia orange]
ref|NP_001237890.1|  uncharacterized protein LOC100500682               162   2e-46   Glycine max [soybeans]
ref|XP_009416216.1|  PREDICTED: universal stress protein A-like p...    162   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223599.1|  hypothetical protein PRUPE_ppa012490mg             161   3e-46   Prunus persica
ref|XP_006298702.1|  hypothetical protein CARUB_v10014797mg             161   3e-46   Capsella rubella
ref|XP_004490794.1|  PREDICTED: universal stress protein A-like p...    161   3e-46   Cicer arietinum [garbanzo]
ref|XP_010504913.1|  PREDICTED: universal stress protein A-like p...    161   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010465732.1|  PREDICTED: universal stress protein A-like p...    160   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_004295087.1|  PREDICTED: universal stress protein A-like p...    160   6e-46   Fragaria vesca subsp. vesca
ref|XP_002277653.1|  PREDICTED: universal stress protein A-like p...    160   6e-46   Vitis vinifera
ref|NP_001148736.1|  LOC100282352                                       160   7e-46   Zea mays [maize]
emb|CDX95890.1|  BnaC05g36410D                                          161   1e-45   Brassica napus [oilseed rape]
ref|XP_002440642.1|  hypothetical protein SORBIDRAFT_09g004470          160   1e-45   Sorghum bicolor [broomcorn]
ref|XP_002973995.1|  hypothetical protein SELMODRAFT_267677             160   1e-45   Selaginella moellendorffii
ref|XP_011100770.1|  PREDICTED: uncharacterized protein LOC105178893    159   2e-45   Sesamum indicum [beniseed]
ref|XP_002316036.1|  universal stress family protein                    159   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004134244.1|  PREDICTED: uncharacterized protein C167.05-like    159   2e-45   Cucumis sativus [cucumbers]
ref|XP_009780825.1|  PREDICTED: universal stress protein A-like p...    159   2e-45   Nicotiana sylvestris
ref|XP_006406778.1|  hypothetical protein EUTSA_v10021673mg             159   3e-45   Eutrema salsugineum
gb|AFW77248.1|  USP family protein                                      159   3e-45   Zea mays [maize]
gb|KJB34721.1|  hypothetical protein B456_006G079900                    159   4e-45   Gossypium raimondii
ref|NP_566564.1|  Adenine nucleotide alpha hydrolases-like superf...    159   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097787.1|  Universal stress protein A-like protein            159   4e-45   Morus notabilis
ref|XP_008791856.1|  PREDICTED: universal stress protein A-like p...    157   5e-45   
ref|XP_011010266.1|  PREDICTED: universal stress protein A-like p...    158   5e-45   
ref|XP_004229006.1|  PREDICTED: uncharacterized protein C167.05         158   5e-45   
ref|XP_008340610.1|  PREDICTED: uncharacterized protein LOC103403544    158   7e-45   
gb|AFW82961.1|  putative USP family protein                             160   8e-45   
gb|ACG34645.1|  USP family protein                                      157   1e-44   
ref|XP_009383705.1|  PREDICTED: uncharacterized protein C167.05         157   2e-44   
ref|XP_006358203.1|  PREDICTED: uncharacterized protein LOC102605897    156   3e-44   
ref|XP_010267982.1|  PREDICTED: uncharacterized protein LOC104605065    156   4e-44   
gb|ADB93063.1|  universal stress protein                                156   4e-44   
ref|XP_008463151.1|  PREDICTED: universal stress protein A-like p...    156   5e-44   
gb|KDP27925.1|  hypothetical protein JCGZ_19005                         155   6e-44   
ref|NP_001132553.1|  uncharacterized protein LOC100194018               155   8e-44   
ref|XP_009369937.1|  PREDICTED: uncharacterized protein LOC103959310    154   2e-43   
dbj|BAG93543.1|  unnamed protein product                                155   2e-43   
gb|AFK33464.1|  unknown                                                 153   4e-43   
ref|XP_006840426.1|  hypothetical protein AMTR_s00045p00160510          152   9e-43   
gb|KFK39040.1|  hypothetical protein AALP_AA3G193100                    152   1e-42   
ref|XP_008390540.1|  PREDICTED: universal stress protein A-like p...    151   4e-42   
ref|XP_006849511.1|  hypothetical protein AMTR_s00024p00142420          150   7e-42   
ref|XP_007026864.1|  Adenine nucleotide alpha hydrolases-like sup...    156   2e-41   
ref|XP_003594749.1|  Universal stress protein A-like protein            149   2e-41   
ref|XP_006576091.1|  PREDICTED: universal stress protein A-like p...    150   3e-41   
ref|XP_010671711.1|  PREDICTED: universal stress protein A-like p...    148   3e-41   
gb|ABN07974.1|  Universal stress protein (Usp)                          148   4e-41   
gb|ADB54812.1|  universal stress protein 5327                           147   1e-40   
gb|EMT06684.1|  Universal stress protein A-like protein                 147   1e-40   
ref|NP_001042142.2|  Os01g0170600                                       145   6e-40   
ref|XP_003569311.1|  PREDICTED: universal stress protein A-like p...    145   7e-40   
emb|CDM81416.1|  unnamed protein product                                145   7e-40   
ref|XP_009631357.1|  PREDICTED: universal stress protein A-like p...    144   1e-39   
ref|XP_006643808.1|  PREDICTED: universal stress protein A-like p...    144   1e-39   
gb|EYU41393.1|  hypothetical protein MIMGU_mgv1a023533mg                143   2e-39   
gb|EYU41394.1|  hypothetical protein MIMGU_mgv1a020570mg                143   2e-39   
gb|ABK25105.1|  unknown                                                 143   4e-39   
ref|XP_007217382.1|  hypothetical protein PRUPE_ppa024511mg             141   1e-38   
ref|XP_010940209.1|  PREDICTED: uncharacterized protein C167.05-like    140   5e-38   
emb|CDO98772.1|  unnamed protein product                                139   5e-38   
ref|XP_001751293.1|  predicted protein                                  139   9e-38   
gb|EEE53950.1|  hypothetical protein OsJ_00543                          145   3e-37   
emb|CBI22890.3|  unnamed protein product                                136   4e-37   
gb|EEC70016.1|  hypothetical protein OsI_00575                          144   4e-37   
gb|ACZ74623.1|  cold stress protein-like protein                        137   9e-37   
gb|KJB34725.1|  hypothetical protein B456_006G080000                    135   2e-36   
ref|XP_002457269.1|  hypothetical protein SORBIDRAFT_03g004490          135   5e-36   
ref|XP_009630215.1|  PREDICTED: uncharacterized protein LOC104120...    134   6e-36   
ref|XP_004968344.1|  PREDICTED: universal stress protein A-like p...    134   8e-36   
gb|AAU44327.1|  unknown protein                                         135   8e-36   
ref|NP_001144087.1|  uncharacterized protein LOC100276920               134   1e-35   
ref|NP_566198.1|  adenine nucleotide alpha hydrolases-like protein      135   2e-35   
ref|XP_001763629.1|  predicted protein                                  133   3e-35   
ref|XP_008795999.1|  PREDICTED: universal stress protein A-like p...    132   7e-35   
ref|XP_001784304.1|  predicted protein                                  131   1e-34   
ref|XP_002439361.1|  hypothetical protein SORBIDRAFT_09g005140          131   2e-34   
ref|XP_008655671.1|  PREDICTED: universal stress protein A-like p...    130   2e-34   
gb|ACF81811.1|  unknown                                                 134   3e-34   
gb|KDO71924.1|  hypothetical protein CISIN_1g031168mg                   130   4e-34   
ref|XP_009390300.1|  PREDICTED: universal stress protein A-like p...    130   5e-34   
gb|EMS48553.1|  hypothetical protein TRIUR3_20184                       132   5e-34   
ref|XP_007223598.1|  hypothetical protein PRUPE_ppa012490mg             129   9e-34   
ref|XP_006373898.1|  hypothetical protein POPTR_0016s10110g             129   9e-34   
ref|XP_008388090.1|  PREDICTED: uncharacterized protein LOC103450503    127   1e-33   
ref|XP_002971813.1|  hypothetical protein SELMODRAFT_412437             128   2e-33   
gb|KJB28727.1|  hypothetical protein B456_005G066600                    127   4e-33   
ref|NP_001237724.1|  uncharacterized protein LOC100306368               127   5e-33   
ref|NP_974427.1|  Adenine nucleotide alpha hydrolases-like superf...    125   7e-33   
ref|XP_002972333.1|  hypothetical protein SELMODRAFT_97437              127   8e-33   
gb|AFG67363.1|  hypothetical protein 0_7326_01                          125   1e-32   
gb|AFG67365.1|  hypothetical protein 0_7326_01                          125   1e-32   
gb|AFG67370.1|  hypothetical protein 0_7326_01                          125   1e-32   
gb|AFG67369.1|  hypothetical protein 0_7326_01                          125   2e-32   
gb|AFG67364.1|  hypothetical protein 0_7326_01                          125   2e-32   
gb|AFG67362.1|  hypothetical protein 0_7326_01                          124   4e-32   
ref|XP_009780827.1|  PREDICTED: uncharacterized protein LOC104229...    123   1e-31   
gb|AFG67371.1|  hypothetical protein 0_7326_01                          122   3e-31   
gb|AFG46345.1|  hypothetical protein 2_896_01                           120   1e-30   
gb|AFG46339.1|  hypothetical protein 2_896_01                           120   1e-30   
gb|AFG46349.1|  hypothetical protein 2_896_01                           120   1e-30   
gb|AFG46346.1|  hypothetical protein 2_896_01                           120   2e-30   
ref|XP_003623214.1|  Early nodulin ENOD18                               114   1e-28   
ref|XP_004960811.1|  PREDICTED: universal stress protein A-like p...    115   3e-28   
gb|KJB17336.1|  hypothetical protein B456_003G127300                    113   4e-28   
ref|XP_001766198.1|  predicted protein                                  110   1e-26   
gb|KHN41040.1|  Hypothetical protein glysoja_013382                   92.0    2e-19   
ref|XP_001774448.1|  predicted protein                                89.7    7e-19   
gb|EEC78600.1|  hypothetical protein OsI_18625                        88.2    2e-18   
gb|ADB54816.1|  universal stress protein 9308                         88.6    4e-18   
gb|ADB54817.1|  universal stress protein 9308                         88.2    5e-18   
gb|EMT31582.1|  Universal stress protein A-like protein               86.3    3e-17   
gb|EMS48379.1|  Universal stress protein A-like protein               85.5    7e-17   
emb|CDP11494.1|  unnamed protein product                              84.0    1e-16   
ref|XP_010107691.1|  Universal stress protein A-like protein          84.0    1e-16   
emb|CDY69106.1|  BnaAnng29340D                                        81.6    1e-16   
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...  82.8    3e-16   
gb|EMS53028.1|  Universal stress protein A-like protein               83.2    8e-16   
ref|XP_009588034.1|  PREDICTED: universal stress protein A-like p...  82.0    8e-16   
ref|XP_006647942.1|  PREDICTED: uncharacterized protein C167.05-like  81.6    8e-16   
ref|XP_009770125.1|  PREDICTED: universal stress protein A-like p...  81.3    1e-15   
ref|XP_010916396.1|  PREDICTED: universal stress protein A-like p...  80.9    2e-15   
ref|NP_001048190.1|  Os02g0760500                                     80.5    2e-15   
ref|XP_010675243.1|  PREDICTED: universal stress protein A-like p...  79.3    7e-15   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg           79.0    9e-15   
ref|XP_006305720.1|  hypothetical protein CARUB_v10010470mg           79.0    9e-15   
gb|EYU18171.1|  hypothetical protein MIMGU_mgv1a026609mg              79.0    9e-15   
ref|XP_006486684.1|  PREDICTED: uncharacterized protein C167.05-like  79.0    1e-14   
ref|XP_010475820.1|  PREDICTED: universal stress protein A-like p...  78.6    1e-14   
ref|XP_006481853.1|  PREDICTED: universal stress protein A-like p...  79.0    1e-14   
ref|XP_011016913.1|  PREDICTED: uncharacterized protein LOC105120...  78.6    1e-14   
ref|XP_010060094.1|  PREDICTED: uncharacterized protein LOC104448021  78.2    2e-14   
ref|XP_002889767.1|  hypothetical protein ARALYDRAFT_471075           77.4    3e-14   
gb|AAR87267.1|  putative stress-related protein                       77.4    4e-14   
ref|XP_003570587.1|  PREDICTED: uncharacterized protein C167.05 i...  77.0    4e-14   
ref|XP_010490289.1|  PREDICTED: universal stress protein A-like p...  77.0    4e-14   
ref|XP_002463873.1|  hypothetical protein SORBIDRAFT_01g007990        77.0    5e-14   
ref|XP_006429979.1|  hypothetical protein CICLE_v10013408mg           77.4    5e-14   
ref|XP_007018204.1|  Adenine nucleotide alpha hydrolases-like sup...  76.3    8e-14   
gb|AID16041.1|  putative universal stress protein                     76.3    8e-14   
gb|EMT31581.1|  Universal stress protein A-like protein               76.3    8e-14   
ref|XP_010266116.1|  PREDICTED: uncharacterized protein C167.05       77.0    9e-14   
ref|XP_006417542.1|  hypothetical protein EUTSA_v10008924mg           76.3    9e-14   
ref|XP_006338073.1|  PREDICTED: universal stress protein A-like p...  75.9    9e-14   
gb|AFK43196.1|  unknown                                               76.3    1e-13   
ref|XP_004237985.1|  PREDICTED: universal stress protein A-like p...  75.9    1e-13   
ref|XP_004148419.1|  PREDICTED: universal stress protein A-like p...  75.9    1e-13   
gb|AAD46412.1|AF096262_1  ER6 protein                                 75.9    1e-13   
ref|XP_002285692.1|  PREDICTED: universal stress protein A-like p...  75.9    1e-13   
ref|NP_172445.2|  adenine nucleotide alpha hydrolases-like protein    75.9    1e-13   
ref|WP_023176082.1|  universal stress protein UspG                    75.1    1e-13   
ref|XP_010458272.1|  PREDICTED: universal stress protein A-like p...  75.5    1e-13   
ref|XP_003615270.1|  Universal stress protein A-like protein          75.5    1e-13   
ref|XP_002302337.2|  ethylene-responsive family protein               75.5    2e-13   
ref|XP_007141257.1|  hypothetical protein PHAVU_008G180800g           75.5    2e-13   
gb|EMS67984.1|  Universal stress protein A-like protein               73.9    2e-13   
ref|XP_008444941.1|  PREDICTED: uncharacterized protein LOC103488134  75.1    2e-13   
emb|CAC18559.1|  ENOD18 protein                                       72.4    2e-13   
ref|XP_004302196.2|  PREDICTED: two pore potassium channel a-like     76.6    2e-13   
ref|XP_004300460.1|  PREDICTED: uncharacterized protein LOC101301587  74.7    3e-13   
gb|KEH41788.1|  adenine nucleotide alpha hydrolase superfamily pr...  74.7    3e-13   
ref|XP_003615271.1|  Universal stress protein A-like protein          74.7    3e-13   
emb|CDY31068.1|  BnaA08g26180D                                        74.3    3e-13   
ref|XP_004299723.1|  PREDICTED: uncharacterized protein LOC101293000  74.3    4e-13   
ref|XP_002514027.1|  conserved hypothetical protein                   74.3    4e-13   
ref|XP_010544073.1|  PREDICTED: uncharacterized protein C167.05       73.9    5e-13   
ref|XP_008679881.1|  PREDICTED: ethylene-responsive protein isofo...  74.3    5e-13   
ref|XP_006444481.1|  hypothetical protein CICLE_v10022542mg           73.9    5e-13   
ref|XP_009758852.1|  PREDICTED: universal stress protein A-like p...  73.9    6e-13   
ref|XP_007223587.1|  hypothetical protein PRUPE_ppa012379mg           73.9    6e-13   
ref|XP_002454587.1|  hypothetical protein SORBIDRAFT_04g033920        73.6    7e-13   
ref|XP_003544826.1|  PREDICTED: uncharacterized protein LOC100805...  73.6    7e-13   
ref|XP_002467191.1|  hypothetical protein SORBIDRAFT_01g021200        73.6    7e-13   
ref|XP_004981765.1|  PREDICTED: universal stress protein A-like p...  73.6    8e-13   
ref|XP_004953997.1|  PREDICTED: uncharacterized protein C167.05-like  73.2    9e-13   
gb|KDP41468.1|  hypothetical protein JCGZ_15875                       73.2    1e-12   
ref|NP_001051280.1|  Os03g0750000                                     72.0    1e-12   
gb|ABR17632.1|  unknown                                               72.8    1e-12   
emb|CDY20676.1|  BnaC08g13820D                                        72.8    1e-12   
ref|XP_008454297.1|  PREDICTED: uncharacterized protein C167.05       72.4    1e-12   
ref|XP_009110805.1|  PREDICTED: universal stress protein A-like p...  72.4    2e-12   
ref|XP_006407394.1|  hypothetical protein EUTSA_v10021565mg           72.8    2e-12   
gb|EEC76183.1|  hypothetical protein OsI_13519                        72.4    2e-12   
gb|AGT17355.1|  hypothetical protein SHCRBa_260_G18_F_60              72.4    2e-12   
gb|AFW73547.1|  ER6 protein                                           72.0    2e-12   
gb|ABK21527.1|  unknown                                               72.0    2e-12   
ref|XP_006677779.1|  hypothetical protein BATDEDRAFT_16272            72.4    2e-12   
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...  72.4    3e-12   
gb|KDP29425.1|  hypothetical protein JCGZ_18346                       71.6    3e-12   
emb|CBI27004.3|  unnamed protein product                              71.6    3e-12   
ref|XP_004152228.1|  PREDICTED: universal stress protein MJ0531-like  71.6    3e-12   
ref|XP_011016909.1|  PREDICTED: uncharacterized protein LOC105120...  71.6    3e-12   
ref|XP_008352713.1|  PREDICTED: uncharacterized protein C167.05-like  71.6    3e-12   
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...  72.0    4e-12   
ref|XP_002283402.1|  PREDICTED: universal stress protein A-like p...  71.2    4e-12   
emb|CBI27006.3|  unnamed protein product                              70.9    4e-12   
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540        70.9    5e-12   
ref|XP_010264134.1|  PREDICTED: universal stress protein A-like p...  71.2    5e-12   
gb|ELT97708.1|  hypothetical protein CAPTEDRAFT_20968                 70.9    5e-12   
ref|WP_013623663.1|  universal stress protein UspA                    70.5    5e-12   
gb|ADE77419.1|  unknown                                               70.9    5e-12   
ref|XP_008219288.1|  PREDICTED: universal stress protein A-like p...  70.9    5e-12   
emb|CDY47907.1|  BnaAnng09390D                                        71.2    5e-12   
ref|XP_002283390.1|  PREDICTED: universal stress protein A-like p...  70.9    5e-12   
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg           71.2    5e-12   
ref|XP_007029145.1|  Adenine nucleotide alpha hydrolases-like sup...  70.9    5e-12   
ref|XP_009121027.1|  PREDICTED: uncharacterized protein LOC103845...  71.2    6e-12   
gb|AAB60745.1|  ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 ...  70.9    7e-12   
gb|KHG27977.1|  hypothetical protein F383_14126                       70.5    7e-12   
dbj|BAJ92093.1|  predicted protein                                    70.5    8e-12   
ref|XP_010264158.1|  PREDICTED: universal stress protein A-like p...  70.5    8e-12   
ref|XP_007044293.1|  Adenine nucleotide alpha hydrolases-like sup...  70.1    8e-12   
ref|XP_009393020.1|  PREDICTED: universal stress protein A-like p...  70.5    9e-12   
ref|XP_009588426.1|  PREDICTED: universal stress protein A-like p...  70.5    9e-12   
ref|XP_009121035.1|  PREDICTED: uncharacterized protein LOC103845...  70.5    1e-11   
ref|XP_010265106.1|  PREDICTED: universal stress protein A-like p...  70.1    1e-11   
ref|XP_008243247.1|  PREDICTED: uncharacterized protein C167.05-like  70.1    1e-11   
ref|XP_010668291.1|  PREDICTED: universal stress protein A-like p...  69.3    1e-11   
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg           70.5    1e-11   
ref|NP_001148900.1|  ER6 protein                                      69.7    1e-11   
ref|XP_004983044.1|  PREDICTED: universal stress protein A-like p...  69.7    1e-11   
ref|XP_008679887.1|  PREDICTED: ethylene-responsive protein isofo...  70.1    1e-11   
gb|KEH41787.1|  adenine nucleotide alpha hydrolase superfamily pr...  70.1    1e-11   
ref|XP_003559418.1|  PREDICTED: universal stress protein A-like p...  70.1    2e-11   
gb|KDP21924.1|  hypothetical protein JCGZ_03062                       69.7    2e-11   
gb|ABK23398.1|  unknown                                               68.9    2e-11   
tpg|DAA51379.1|  TPA: ethylene-responsive protein isoform 1           69.3    2e-11   
ref|XP_008679878.1|  PREDICTED: ethylene-responsive protein isofo...  69.3    2e-11   
gb|KJB77133.1|  hypothetical protein B456_012G122100                  68.9    2e-11   
ref|XP_007223620.1|  hypothetical protein PRUPE_ppa012591mg           68.9    2e-11   
emb|CDX94953.1|  BnaC05g07180D                                        69.3    2e-11   
ref|XP_008797807.1|  PREDICTED: universal stress protein A-like p...  69.3    2e-11   
ref|XP_011094182.1|  PREDICTED: universal stress protein A-like p...  69.3    2e-11   
ref|XP_002882756.1|  universal stress protein family protein          69.3    2e-11   
ref|XP_009148276.1|  PREDICTED: universal stress protein A-like p...  68.9    2e-11   
ref|XP_003519020.1|  PREDICTED: universal stress protein A-like p...  69.3    3e-11   
ref|XP_010464930.1|  PREDICTED: universal stress protein A-like p...  68.9    3e-11   
ref|NP_001148498.1|  ethylene-responsive protein                      68.9    3e-11   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg           69.3    3e-11   
ref|XP_010921785.1|  PREDICTED: universal stress protein A-like p...  68.6    3e-11   
ref|XP_006429977.1|  hypothetical protein CICLE_v10012833mg           68.9    4e-11   
ref|XP_010486864.1|  PREDICTED: uncharacterized protein LOC104764...  68.9    4e-11   
gb|KDO35866.1|  hypothetical protein CISIN_1g038513mg                 66.6    4e-11   
ref|XP_008774998.1|  PREDICTED: uncharacterized protein LOC103695...  68.6    4e-11   
ref|NP_850562.1|  universal stress protein-like protein               68.9    4e-11   



>ref|XP_009758839.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=164

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADKGDTFYIIHI TH+SDESRNKLW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKTALKWAIDNLADKGDTFYIIHIKTHSSDESRNKLWAQSGSPLIPLVEFREAEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L+KY+VK +++VLDLLDTATRQKEI VV KLYWGDAREKLCD+IEDLKLDSLVMGSRGL+
Sbjct  72   LEKYDVKTDIDVLDLLDTATRQKEINVVTKLYWGDAREKLCDAIEDLKLDSLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI +GSVTNYV++ ATCP+TVVK PDFHKH
Sbjct  132  TIQRIFLGSVTNYVMSNATCPVTVVKDPDFHKH  164



>ref|XP_009606023.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=164

 Score =   266 bits (680),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNLADK DTFYIIHI TH+SDESRNKLW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKTALQWAIDNLADKDDTFYIIHIKTHSSDESRNKLWAQSGSPLIPLVEFRELEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L+KY+VK +++VLDLLDTATRQKEI VVAKLYWGDAREKLCD+IEDLKLDSLVMGSRGL+
Sbjct  72   LEKYDVKTDIDVLDLLDTATRQKEINVVAKLYWGDAREKLCDAIEDLKLDSLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI +GSVTNYV++ ATCP+TVVK PDFHKH
Sbjct  132  TIQRIFLGSVTNYVMSNATCPVTVVKDPDFHKH  164



>ref|XP_009783752.1| PREDICTED: uncharacterized protein C167.05-like [Nicotiana sylvestris]
Length=164

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADKGDTFYIIHI TH+SDESRNKLW++SG PLIPL+EFREPE+
Sbjct  12   DFSKSSKTALKWAIDNLADKGDTFYIIHIKTHSSDESRNKLWAKSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ +++VLDLLDTATRQKEI VV KLYWGDAREKL D+  DLKLDSLVMGSRGL 
Sbjct  72   MKKYDVETDIDVLDLLDTATRQKEIKVVTKLYWGDAREKLIDATGDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRIIMGSVTNYVLT ATC +TVVK PDFHKH
Sbjct  132  TLQRIIMGSVTNYVLTNATCAVTVVKDPDFHKH  164



>ref|XP_009606017.1| PREDICTED: uncharacterized protein C167.05-like [Nicotiana tomentosiformis]
Length=164

 Score =   266 bits (679),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADK DTFYIIHI TH+SDESRNKLW++SG PLIPL+EFREPE+
Sbjct  12   DFSKSSKTALKWAIDNLADKDDTFYIIHIKTHSSDESRNKLWAKSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ +++VLDLLDTATRQKEI VV KLYWGDAREKL D+ EDLKLDSLVMGSRGL 
Sbjct  72   MKKYDVETDIDVLDLLDTATRQKEIKVVTKLYWGDAREKLIDATEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRIIMGSVTNYVLT ATC +TVVK PDFHKH
Sbjct  132  TLQRIIMGSVTNYVLTNATCAVTVVKDPDFHKH  164



>ref|XP_004246377.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
 ref|XP_010325820.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=164

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADKGDTFYIIHI TH+SDESRNKLW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKTALKWAIDNLADKGDTFYIIHIKTHSSDESRNKLWAQSGSPLIPLVEFREAEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+V+ ++E+LDLLDTATRQKEI +V KLYWGDAREKLC+++E LKL+SLVMGSRGLS
Sbjct  72   LKKYDVETDIELLDLLDTATRQKEIKIVIKLYWGDAREKLCEAVEHLKLNSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRI +GSVTNYVL+ ATCP+TVVK PDFHKH
Sbjct  132  TLQRIFLGSVTNYVLSVATCPVTVVKDPDFHKH  164



>gb|AGT78204.1| universal stress protein [Solanum torvum]
Length=164

 Score =   261 bits (667),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADKGDTFYIIHI  H SDESRNKLW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKAALKWAIDNLADKGDTFYIIHIKNHTSDESRNKLWAQSGSPLIPLVEFREAEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L+KY+V+ + EVLDLLDTATRQKEI VV KLYWGDAREKLC+++E+LKL+ LVMGSRGLS
Sbjct  72   LQKYDVETDAEVLDLLDTATRQKEIKVVIKLYWGDAREKLCEAVEELKLNCLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI +GSVTNYVL+ ATCP+TVVK PDFHKH
Sbjct  132  TIQRIFLGSVTNYVLSVATCPVTVVKDPDFHKH  164



>gb|AID16042.1| putative universal stress protein [Catharanthus roseus]
Length=164

 Score =   261 bits (666),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL WAI+NLADKGDTFYIIHI +H  DESRN+LW++SG PLIPL+EFR+PE+
Sbjct  12   DFSKSSKMALLWAIENLADKGDTFYIIHIKSHFLDESRNQLWAKSGSPLIPLAEFRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+VK ++EVLDLLDT++RQKEITVV KLYWGDAREKLC+ IEDLKLDSLVMGSRGL 
Sbjct  72   MKKYDVKTDIEVLDLLDTSSRQKEITVVTKLYWGDAREKLCECIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRII+GSVTNYV+T ATCP+TVVK PDFHKH
Sbjct  132  TLQRIILGSVTNYVITNATCPVTVVKDPDFHKH  164



>ref|XP_006357577.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=164

 Score =   260 bits (665),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADK DTFYIIHI TH+SDESRNKLW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKTALKWAIDNLADKDDTFYIIHIKTHSSDESRNKLWAQSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L+KY V+ ++E+LD+LDTA+RQKEI VV KLYWGDARE+LC+++EDLKL+ LVMGSRGL+
Sbjct  72   LEKYGVEIDIELLDMLDTASRQKEIKVVTKLYWGDARERLCEAVEDLKLNCLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRI MGSVTNYV++ ATCP+TVVK PDFHKH
Sbjct  132  TLQRIFMGSVTNYVMSHATCPVTVVKDPDFHKH  164



>ref|XP_006357578.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=164

 Score =   257 bits (656),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADK DTFYIIHI TH+SDESRNKLW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKTALKWAIDNLADKDDTFYIIHIKTHSSDESRNKLWAQSGSPLIPLVEFREAEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L KY+V+ ++E+LDLLDTA+RQKEI +V KLYWGDAREKLC+++EDLKL+SLVMGSRGLS
Sbjct  72   LHKYDVETDIELLDLLDTASRQKEIKIVIKLYWGDAREKLCEAVEDLKLNSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            ++QRI +GSVTNYVL+ ATCP+TVVK PDFHK
Sbjct  132  TIQRIFLGSVTNYVLSVATCPVTVVKDPDFHK  163



>ref|XP_004246376.1| PREDICTED: uncharacterized protein C167.05-like [Solanum lycopersicum]
Length=164

 Score =   255 bits (651),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADK D FYIIHI  H+SDESRNKLW++SG PLIPL+EFREPE+
Sbjct  12   DFSKSSKTALKWAIDNLADKDDIFYIIHIKNHSSDESRNKLWAKSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L+KY V+ ++E+LD+LDTA+RQKEI  V KLYWGDARE+LC+++EDLKL+SLVMGSRGL+
Sbjct  72   LEKYGVEIDIELLDMLDTASRQKEIKFVTKLYWGDARERLCEAVEDLKLNSLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRI MGSVTNYV++ ATCP+TVVK PDFHKH
Sbjct  132  TLQRIFMGSVTNYVMSHATCPVTVVKDPDFHKH  164



>gb|EYU41796.1| hypothetical protein MIMGU_mgv1a015230mg [Erythranthe guttata]
Length=164

 Score =   253 bits (647),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS  AL+W+IDNLAD GDTFYI+HI + + DESR+KLWS+SG PLIPL EFREPE+
Sbjct  12   DFSKSSRAALRWSIDNLADSGDTFYILHIKSSSHDESRSKLWSKSGSPLIPLVEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY V  ++EVLD+LDTA RQKEITVV KLYWGDAREKLC+++EDLKLDSLVMGSRGLS
Sbjct  72   MKKYEVPIDIEVLDILDTAARQKEITVVTKLYWGDAREKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            S++RII+GSVTNYV+T+A CP+T+VK PDFHK+
Sbjct  132  SIKRIILGSVTNYVMTSANCPVTIVKDPDFHKN  164



>emb|CDP06551.1| unnamed protein product [Coffea canephora]
Length=164

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI+NLADKGDTF++IH+N+H  DESRN+LWSQSG PLIPL EFREPE+
Sbjct  12   DFSKSSKLALQWAIENLADKGDTFFVIHVNSHPLDESRNQLWSQSGSPLIPLVEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y VK ++EVLD+LDTA RQKEI +V KLYWGDAREKLC ++EDLKLDS+VMGSRGLS
Sbjct  72   MKQYGVKTDIEVLDMLDTAARQKEIIIVWKLYWGDAREKLCQAVEDLKLDSVVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            S++RII+GSVT+Y+L  ATCP+TVVK PD H+H
Sbjct  132  SIRRIILGSVTDYLLANATCPVTVVKDPDLHRH  164



>gb|AHL20266.1| universal stress protein [Olea europaea]
Length=161

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNLADKGDTFYIIHI +H   ES NKL S+SG PLIPL+EFR PE+
Sbjct  12   DFSKSSKMALQWAIDNLADKGDTFYIIHIKSH---ESTNKLCSKSGSPLIPLAEFRVPEM  68

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+++ ++EVLD+LDTA RQKEI++V KLYWGDARE+LCD+IEDLKLDSLVMGSRGL 
Sbjct  69   MKKYDIQTDIEVLDMLDTAARQKEISIVTKLYWGDAREQLCDAIEDLKLDSLVMGSRGLG  128

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +LQRII+GSVTNY+++ A CP+T+VK PDFHKH
Sbjct  129  TLQRIILGSVTNYIISNAACPVTIVKDPDFHKH  161



>ref|XP_011077614.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=164

 Score =   245 bits (626),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WA++NLADKGDT YI+HI +H+ DES  K+WS+SG PLIPL+EFREPE+
Sbjct  12   DFSKSSKAALQWALENLADKGDTVYILHIKSHSLDESAQKIWSESGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY VK ++EVLD+LDTATRQKEI VV KLYWGDAR+KLC + +DLKLDSLVMGSRGLS
Sbjct  72   MNKYQVKTDIEVLDMLDTATRQKEIHVVTKLYWGDARDKLCQAADDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +L+RII+GSV+NYV+ TA+CP+T+VK PDFHK+
Sbjct  132  ALKRIILGSVSNYVIATASCPVTIVKDPDFHKN  164



>ref|XP_009602951.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=168

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKW I+NLA KGDT YIIHI TH   ESR++LW+++G PL+P  EFREP++
Sbjct  16   DFSKSSKAALKWTIENLAAKGDTIYIIHIKTHTLSESRDQLWAKTGSPLVPWVEFREPDV  75

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LK Y++K++++VLDLLDTA +QKEI ++AK+YWGDAREK+CDSIEDLKL+SLVMGSRGLS
Sbjct  76   LKYYDIKSDVQVLDLLDTAAKQKEINIMAKVYWGDAREKVCDSIEDLKLNSLVMGSRGLS  135

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI++GSVTNYVL  A CP+T+VK PDFHKH
Sbjct  136  TIQRIMLGSVTNYVLANAACPVTIVKDPDFHKH  168



>gb|KHN15657.1| Universal stress protein A-like protein [Glycine soja]
Length=167

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGDT Y+IHIN+++ DESRNKLW++SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHINSNSLDESRNKLWAESGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLDLLDTA+RQKEI +V K+YWGDAREKL D+IEDLKLDSLVMGSRGLS
Sbjct  72   MKKYDVQIDIEVLDLLDTASRQKEIHIVTKIYWGDAREKLLDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRII+GSV+N+V+T A+CP+T+VK
Sbjct  132  TIQRIILGSVSNFVMTHASCPVTIVK  157



>gb|KHN06032.1| Universal stress protein [Glycine soja]
Length=164

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA +NLADKGDT Y+IHIN ++ DESRNKLW++SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWAFENLADKGDTIYVIHINPNSLDESRNKLWAKSGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLD+LDTA+RQKEI +V K+YWGDAREKL D+IEDLKLDSLVMGSRGLS
Sbjct  72   MKKYDVEIDIEVLDMLDTASRQKEIHIVTKIYWGDAREKLLDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            ++QRII+GSV+N+V+T A CP+T+VK P
Sbjct  132  TIQRIILGSVSNFVMTNAPCPVTIVKEP  159



>ref|XP_009776099.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=164

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+W I+NLA KGDT YIIHI TH   ESR++LW+++G PL+P  EFREP++
Sbjct  12   DFSKSSKAALRWTIENLAAKGDTIYIIHIKTHTLGESRDQLWAKTGSPLVPWVEFREPDV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LK Y++K+++ VLDLLDTA +QKEI +VAK+YWGDAREK+CDSIEDLKL+SLVMGSRGLS
Sbjct  72   LKYYDIKSDVHVLDLLDTAAKQKEIKIVAKVYWGDAREKVCDSIEDLKLNSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI++GSVTNYVL  A CP+T+VK PDFHKH
Sbjct  132  TIQRIMLGSVTNYVLANAACPVTIVKDPDFHKH  164



>ref|NP_001238489.1| uncharacterized protein LOC100499951 [Glycine max]
 gb|ACU14311.1| unknown [Glycine max]
Length=164

 Score =   239 bits (610),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA +NLADKGDT Y+IHIN ++ DESRNKLW++SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWAFENLADKGDTIYVIHINPNSLDESRNKLWAKSGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLD+LDTA+RQKEI +V K+YWGDAREKL D+IEDLKLDSLVMGSRGLS
Sbjct  72   MKKYDVEIDIEVLDMLDTASRQKEIHIVTKIYWGDAREKLLDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            ++QRII+GSV+N+V+T A CP+T+VK P
Sbjct  132  TIQRIILGSVSNFVMTNAPCPVTIVKEP  159



>ref|NP_001236136.1| uncharacterized protein LOC100306513 [Glycine max]
 gb|ACU14717.1| unknown [Glycine max]
Length=167

 Score =   239 bits (610),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGDT Y+IHIN+++ DESRNKLW+ SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHINSNSLDESRNKLWAGSGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLDLLDTA+RQKEI +V K+YWGDAREKL D+IEDLKLDSLVMGSRGLS
Sbjct  72   MKKYDVQIDIEVLDLLDTASRQKEIHIVTKIYWGDAREKLLDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRII+GSV+N+V+T A+CP+T+VK
Sbjct  132  TIQRIILGSVSNFVMTHASCPVTIVK  157



>ref|XP_010044014.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW86028.1| hypothetical protein EUGRSUZ_B02732 [Eucalyptus grandis]
Length=164

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WA+DNLADKGDT YIIHI T+++DESR++LWS+SG PLIPLSEFREP L
Sbjct  12   DFSKSSKCALQWAVDNLADKGDTLYIIHIKTNSNDESRDQLWSKSGAPLIPLSEFREPHL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V  +MEVLD LDTA+RQKE+ +V KLYWGDAREKL  +I+DLKLDSLVMGSRGL 
Sbjct  72   MKKYDVPTDMEVLDTLDTASRQKEVKIVTKLYWGDAREKLLQAIDDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            +L+RII+GSVT+YV   A CP+TVVK P F+K
Sbjct  132  TLKRIILGSVTSYVTNHAPCPVTVVKEPGFNK  163



>ref|XP_002275745.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CAN81966.1| hypothetical protein VITISV_034082 [Vitis vinifera]
 emb|CBI30465.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLADKGD  YIIHI + + DESR+ LW+  G PLIPL+EFR+PE+
Sbjct  12   DFSSSSKLALQWAIDNLADKGDLLYIIHIKSSSGDESRDVLWTTHGSPLIPLTEFRQPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY VK ++EVLD LDTA+RQKE+ +V KLYWGDAR+KLC+++EDLKLDSLVMGSRGLS
Sbjct  72   MKKYGVKTDIEVLDTLDTASRQKEVKIVTKLYWGDARDKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSVTNYV+T ATCP+T+VK P  HK 
Sbjct  132  TIRRILLGSVTNYVMTNATCPVTIVKDPSSHKQ  164



>ref|XP_010101861.1| hypothetical protein L484_023651 [Morus notabilis]
 gb|EXB89998.1| hypothetical protein L484_023651 [Morus notabilis]
Length=164

 Score =   234 bits (597),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWAIDNLADKGDT Y+I+++ ++ DESRNKLW++SG PLIPL+EFR+PE+
Sbjct  12   DFSESSKNALKWAIDNLADKGDTLYVIYVSPNSLDESRNKLWAKSGAPLIPLAEFRQPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+VK +++VLDLLDT +R KE+T+VAK+YWGDAREK+  +IEDLKLDSLVMGSRGL 
Sbjct  72   LKKYDVKTDIQVLDLLDTGSRTKEVTIVAKIYWGDAREKILYAIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QR+IMGSV+N+V++ A CP+T+VK   F  H
Sbjct  132  TIQRLIMGSVSNHVISLAECPVTIVKDSSFKHH  164



>ref|XP_008442491.1| PREDICTED: uncharacterized protein C167.05 [Cucumis melo]
Length=164

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLADKGDT YII++N ++ +ES ++LW++SG PLIPLSEFREPE+
Sbjct  12   DFSDSSKNALKWAIDNLADKGDTLYIIYVNPNSLNESAHRLWAESGSPLIPLSEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+VK +++ LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLKLDSLVMGSRGLS
Sbjct  72   LKKYDVKIDIDALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  132  TIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  164



>ref|XP_007206040.1| hypothetical protein PRUPE_ppa012560mg [Prunus persica]
 gb|EMJ07239.1| hypothetical protein PRUPE_ppa012560mg [Prunus persica]
Length=164

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WA+DNL DKGDT YIIHIN ++ DESR +LW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKNALEWAVDNLLDKGDTLYIIHINPNSLDESRTQLWAQSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLD LDTA+RQKE+ +V KLYWGDAREKL  +IEDLKLDSLVMGSRGL 
Sbjct  72   MKKYDVRTDIEVLDTLDTASRQKEVNIVTKLYWGDAREKLLQAIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYVLT A  P+T+VK P    H
Sbjct  132  TIKRILLGSVSNYVLTNAPIPVTIVKDPSLQHH  164



>ref|XP_006349538.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=166

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKW ++NLA+KGDT Y+IHI TH   ESR++LWS++G PLIP  EFR+PE+
Sbjct  13   DFSTSSKEALKWTVENLAEKGDTVYLIHIKTHTLSESRDQLWSKTGSPLIPWVEFRDPEV  72

Query  182  LKKYNVK-ANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +K Y++K  +++V+DLLD AT+QKEI +VAK+YWGDAREK+CDSIEDL+L+SLVMGSRGL
Sbjct  73   MKYYDIKKTDVQVVDLLDAATKQKEINIVAKVYWGDAREKVCDSIEDLRLNSLVMGSRGL  132

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            S++QRI++GSVTNYVL  A CP+T+VK PDFHKH
Sbjct  133  STIQRIMLGSVTNYVLNNAACPVTIVKDPDFHKH  166



>ref|XP_011094934.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=165

 Score =   233 bits (594),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+W+IDNLADKGD FYI+H+  H+  ES ++LWS+SG PLIPL+EFREP++
Sbjct  12   DFSKSSKAALQWSIDNLADKGDIFYILHVKHHSLSESLHQLWSESGSPLIPLAEFREPQV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V  ++EVLD LDTA RQKEI VV KLYWGDAREKLC+++EDLKLDSLVMGSRGL+
Sbjct  72   MNKYGVPIDIEVLDTLDTAARQKEIKVVTKLYWGDAREKLCEAVEDLKLDSLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            ++QRII+GSVT+YV+  A CP+T+VK P+F+K
Sbjct  132  TIQRIILGSVTSYVMAHAACPVTIVKDPNFYK  163



>ref|XP_004163858.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis 
sativus]
 gb|KGN58822.1| hypothetical protein Csa_3G733270 [Cucumis sativus]
Length=164

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLADKGDT +II++N ++ +ES ++LW++SG PLIPLSEFREPE+
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSLEESAHRLWAESGSPLIPLSEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLKLDSLVMGSRGLS
Sbjct  72   LKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  132  TIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  164



>gb|KHG25151.1| hypothetical protein F383_09728 [Gossypium arboreum]
 gb|KJB76826.1| hypothetical protein B456_012G108900 [Gossypium raimondii]
Length=166

 Score =   233 bits (593),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAIDNLADKGDT YIIHIN ++ DESRN LW++SG PLIPL+EFR PE+
Sbjct  12   DFSASSKNALKWAIDNLADKGDTLYIIHINNNSLDESRNALWAKSGSPLIPLTEFRVPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            +KKY+V+ ++EVLD+LDTA+RQKEI VV+K+YW GDAREK+ D+IEDLKLDSLVMGSRGL
Sbjct  72   MKKYDVETDIEVLDMLDTASRQKEINVVSKIYWGGDAREKILDAIEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++RII+GSV+NYV+T ATCP+T+VK
Sbjct  132  GTVRRIILGSVSNYVVTHATCPVTIVK  158



>gb|AFK43920.1| unknown [Lotus japonicus]
Length=164

 Score =   232 bits (592),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGD  YIIHIN ++ DESRNKLW +SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDNIYIIHINPNSLDESRNKLWGKSGSPLIPLKEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY+V+ ++EVLDLLDTA+RQKE+ +V K+YWGDARE+L D++EDLKLDSLVMGSRGLS
Sbjct  72   MTKYDVQIDIEVLDLLDTASRQKEVNIVTKIYWGDAREQLLDAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRII+GSV+N+V+T A CP+T+VK
Sbjct  132  TIQRIILGSVSNFVMTHAPCPVTIVK  157



>ref|XP_010671709.1| PREDICTED: uncharacterized protein C167.05 [Beta vulgaris subsp. 
vulgaris]
Length=164

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNLADKGDT YIIH+  H+ DESR+ LW++SG PLIPL EFR+P +
Sbjct  12   DFSKSSKCALQWAIDNLADKGDTLYIIHVQPHSHDESRHLLWAKSGSPLIPLVEFRDPNI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+V+ ++EVLD+ DTA+RQKEIT+VAK+YWGDAREKL ++IEDLKLD+LVMGSRGL+
Sbjct  72   LKKYDVQTDIEVLDMCDTASRQKEITIVAKVYWGDAREKLMEAIEDLKLDTLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
             L+RIIMGSV NYV++ A  P+T+VK P  HK
Sbjct  132  GLKRIIMGSVANYVMSNAHIPVTIVKEPGVHK  163



>ref|XP_006429235.1| hypothetical protein CICLE_v10012955mg [Citrus clementina]
 ref|XP_006480914.1| PREDICTED: uncharacterized protein C167.05-like [Citrus sinensis]
 gb|ESR42475.1| hypothetical protein CICLE_v10012955mg [Citrus clementina]
 gb|KDO57980.1| hypothetical protein CISIN_1g031195mg [Citrus sinensis]
Length=164

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL WA++NL DKGDT YIIHIN ++ DESRN +W++SG PLIPL+EFREPE 
Sbjct  12   DFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPET  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KYNVK +++ LDLLDTA+RQKE  +VAK+YWGDARE+L ++IEDLKLDSLVMGSRGL 
Sbjct  72   MEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RII+GSV+NYV+T A CP+T+VK P F KH
Sbjct  132  TVRRIILGSVSNYVMTHAPCPVTIVKDPSFGKH  164



>ref|XP_008240065.1| PREDICTED: uncharacterized protein C167.05-like [Prunus mume]
Length=164

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WA+DNL DKGDT YIIHIN ++ DESR +LW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKNALEWAVDNLLDKGDTLYIIHINPNSLDESRTQLWAQSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ ++EVLD LDTA+RQKE  +V KLYWGDAREKL  +IEDLKLDSLVMGSRGL 
Sbjct  72   MKKYDVQTDIEVLDTLDTASRQKEANIVTKLYWGDAREKLLQAIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYVLT A  P+T+VK P    H
Sbjct  132  TIKRILLGSVSNYVLTNAPIPVTIVKDPSLQHH  164



>ref|XP_006850424.1| hypothetical protein AMTR_s00165p00044350 [Amborella trichopoda]
 gb|ERN12005.1| hypothetical protein AMTR_s00165p00044350 [Amborella trichopoda]
Length=164

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ ALKWAI+NL DKGDT ++IH+ +H  DE +N+LW++SG PLIPLSEFR+P++
Sbjct  12   DYSASSKYALKWAIENLLDKGDTLFVIHVKSHRGDEEKNQLWAKSGSPLIPLSEFRDPDM  71

Query  182  LKK-YNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            LKK Y+V+++MEVLDLLDT +RQKE+T++AK+YWGDAREKLC+++EDLKLDSLVMGSRGL
Sbjct  72   LKKHYDVQSDMEVLDLLDTTSRQKEVTMLAKIYWGDAREKLCEAVEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
              ++RI++GSV+NYVL+TA CP+T+VK P+F
Sbjct  132  GQIKRILLGSVSNYVLSTAACPVTIVKEPNF  162



>ref|XP_004249840.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=166

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKW ++NLA+K DT Y+IHI TH   ESR++LW+++G PLIP  EFR+PE+
Sbjct  13   DFSRSSKEALKWTVENLAEKSDTVYLIHIKTHTLSESRDQLWAKTGSPLIPWVEFRDPEV  72

Query  182  LKKYNVK-ANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +K Y++K  +++V+DLLD AT+QK+I +VAK+YWGDAREK+CDSIEDL+LDSLVMGSRGL
Sbjct  73   MKYYDIKKTDVQVVDLLDAATKQKQINIVAKVYWGDAREKVCDSIEDLRLDSLVMGSRGL  132

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            S++QRI++GSVTNYVL  A CP+T+VK PDFHKH
Sbjct  133  SAIQRIMLGSVTNYVLNNAACPVTIVKDPDFHKH  166



>ref|XP_007026861.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY07363.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=165

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA+DNLADKGDT YIIHIN ++ DES N LW++SG PLIPL+EFREPE+
Sbjct  12   DFSPSSKNALQWAVDNLADKGDTLYIIHINANSLDESHNALWAKSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            +KKY+VK ++EVLD+LDTA+RQKEI +V KLYW GDAREK+ D++E LKLDSLVMGSRGL
Sbjct  72   MKKYDVKPDIEVLDMLDTASRQKEIHIVTKLYWGGDAREKILDAVEGLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
             ++QRII+GSV+NYV+T A+CP+T+VK     KH
Sbjct  132  GTVQRIILGSVSNYVMTHASCPVTIVKESSSMKH  165



>ref|XP_008350501.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=164

 Score =   230 bits (586),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ A++WAI NLADKGDT YIIHIN ++ DESR +LW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKNAMEWAIANLADKGDTLYIIHINPNSLDESRTQLWAQSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ + EVLD LDTA+RQKE+ VV KLYWGDAREKL  ++EDLKLDSLVMGSRGL 
Sbjct  72   MTKYGVQTDTEVLDTLDTASRQKEVNVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYVLT A  P+TVVK P    H
Sbjct  132  TIKRILLGSVSNYVLTNAPIPVTVVKDPSMQHH  164



>ref|XP_009358793.1| PREDICTED: uncharacterized protein C167.05 [Pyrus x bretschneideri]
Length=164

 Score =   229 bits (585),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NLADKGDT YIIHIN ++ DESR +LW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHINPNSLDESRTQLWAQSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ +MEVLD LDTA+RQKE+ VV KLYWGDAREKL  ++EDLKLD+LVMGSRGL 
Sbjct  72   MTKYGVQTDMEVLDTLDTASRQKEVNVVTKLYWGDAREKLLQAVEDLKLDTLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV++YVLT A  P+T+VK P    H
Sbjct  132  TIKRILLGSVSDYVLTNAPIPVTIVKDPSMQHH  164



>ref|XP_007133981.1| hypothetical protein PHAVU_010G008900g [Phaseolus vulgaris]
 gb|ESW05975.1| hypothetical protein PHAVU_010G008900g [Phaseolus vulgaris]
Length=162

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGDT Y+IHI+ ++ DESRN+LW++SG PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHISPNSLDESRNQLWAKSGSPLIPLQEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ ++EVLD LDTA+RQKE+ +V K+YWGDAREKL D+IEDLKLDSLVMGSRGL+
Sbjct  72   MSKYGVQIDIEVLDTLDTASRQKEVHIVTKIYWGDAREKLLDAIEDLKLDSLVMGSRGLT  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            +++RII+GSV+N+V+  A+CP+T+VK P
Sbjct  132  TIKRIILGSVSNFVMAHASCPVTIVKEP  159



>ref|XP_008370018.1| PREDICTED: uncharacterized protein C167.05 [Malus domestica]
Length=164

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NLADKGDT YIIHI  ++  ESR++LW+QSG PLIPL+EFREP++
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ +MEVLD LDT +RQKE+ VV KLYWGDAREKL  ++EDLKLDSLVMGSRGLS
Sbjct  72   MKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+N+VLT A+ P+T+VK P   +H
Sbjct  132  TIKRIVLGSVSNFVLTNASIPVTIVKDPSMQQH  164



>ref|XP_008359768.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=164

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ A +WAI NLADKGDT YIIHIN ++ DESR +LW+QSG PLIPL+EFREPE+
Sbjct  12   DFSKSSKNAXEWAIANLADKGDTLYIIHINPNSLDESRTQLWAQSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ + EVLD LDTA+RQKE+ VV KLYWGDAREKL  ++EDLKLDSLVMGSRGL 
Sbjct  72   MTKYGVQTDTEVLDTLDTASRQKEVNVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYVLT A  P+TVVK P    H
Sbjct  132  TIKRILLGSVSNYVLTNAPIPVTVVKDPSMQHH  164



>ref|XP_007026862.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY07364.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=157

 Score =   226 bits (577),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA+DNLADKGDT YIIHIN ++ DES N LW++SG PLIPL+EFREPE+
Sbjct  12   DFSPSSKNALQWAVDNLADKGDTLYIIHINANSLDESHNALWAKSGSPLIPLTEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            +KKY+VK ++EVLD+LDTA+RQKEI +V KLYW GDAREK+ D++E LKLDSLVMGSRGL
Sbjct  72   MKKYDVKPDIEVLDMLDTASRQKEIHIVTKLYWGGDAREKILDAVEGLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVV  436
             ++QRII+GSV+NYV+T A CP+T+V
Sbjct  132  GTVQRIILGSVSNYVMTHAPCPVTIV  157



>ref|XP_009378881.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
Length=164

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NLADKGDT YIIHI  ++  ESR++LW+QSG PLIPLSEFREP++
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLSEFREPQI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ +MEVLD LDTA+RQKE+ VV KLYWGDAREKL  ++EDLKLDSLVMGSRGLS
Sbjct  72   MKNYGVQTDMEVLDTLDTASRQKEVDVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+N+VLT A  P+T+VK     +H
Sbjct  132  TIKRIVLGSVSNFVLTNAAIPVTIVKDLSMQQH  164



>ref|XP_004507182.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=165

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWA++NLA+KGD  YIIHI+  + DESRN++W++SG PLIPL EFREPE+
Sbjct  12   DFSNSSKNALKWALENLAEKGDNIYIIHISHDSLDESRNQIWAKSGSPLIPLKEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY V+ ++EVLDLLDT +RQKE+ +VAK+YWGDAREKL D+I+DLKLDSLVMGSRGLS
Sbjct  72   MKKYGVQIDIEVLDLLDTVSRQKEVNIVAKVYWGDAREKLLDAIDDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRI++GSV+N+V+T A CP+T+VK
Sbjct  132  TIQRILLGSVSNFVMTHAPCPVTIVK  157



>gb|ACJ83924.1| unknown [Medicago truncatula]
 gb|AFK46761.1| unknown [Medicago truncatula]
 gb|KEH28981.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=165

 Score =   225 bits (574),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGD  YIIHI+  + DE+RN+LW++ G PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDNIYIIHISHDSLDEARNQLWAKDGSPLIPLKEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY V+ ++EVLDLLDT +RQKE+ VV K+YWGDAREKL D++EDLKLDSLVMGSRGLS
Sbjct  72   MKKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWGDAREKLMDAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRI++GSV+N+V+T A CP+T+VK
Sbjct  132  TIQRILLGSVSNFVMTNAPCPVTIVK  157



>gb|ACJ84043.1| unknown [Medicago truncatula]
Length=165

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWA++NLADKGD  YIIHI+  + DE+RN+LW++ G PLIPL EFREPE+
Sbjct  12   DFSKSSKNALKWALENLADKGDNIYIIHISHDSLDEARNQLWAKDGSPLIPLKEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY V+ ++EVLDLLDT +RQKE+ VV K+YWGDAREKL D++EDLKLDSLVMGSRGLS
Sbjct  72   MKKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWGDAREKLMDAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRI++GSV+N+V+T A CP+T+VK
Sbjct  132  TIQRILLGSVSNFVMTNAPCPVTIVK  157



>gb|KJB11222.1| hypothetical protein B456_001G247900 [Gossypium raimondii]
Length=165

 Score =   224 bits (572),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLADKGDTFYIIHIN  +S++S N   +QSG PLIPL++FR+PE+
Sbjct  12   DFSCSSKSALRWAIDNLADKGDTFYIIHINPSSSNDSTNTHLAQSGSPLIPLAQFRQPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KY+VK ++ VLD+LDTA+RQKEI VV+KLYW GDAREK+ D+IE+LKLDSLVMGSRGL
Sbjct  72   MNKYDVKVDIAVLDMLDTASRQKEIQVVSKLYWGGDAREKILDAIENLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHP  445
             +LQRII+GSV+NYVLT A CP+T+VK P
Sbjct  132  GTLQRIILGSVSNYVLTYAPCPVTIVKEP  160



>ref|XP_004302689.1| PREDICTED: uncharacterized protein C167.05 [Fragaria vesca subsp. 
vesca]
Length=161

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNL DKGDT +IIHIN +  DESRN LW++SG PLIPLSEFRE E+
Sbjct  12   DFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPLIPLSEFRELEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY V  +MEVLD+LDT +RQKE+T++ K+YWGDAREKL  ++EDLKLDSLVMGSRGL 
Sbjct  72   MKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
            +L+RI++GSV+NYV+T A  P+T+VK  DF
Sbjct  132  TLKRIVLGSVSNYVMTQAPIPVTIVK--DF  159



>ref|XP_011000055.1| PREDICTED: uncharacterized protein LOC105107721 [Populus euphratica]
Length=161

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAIDNL D GDT Y+I++N+++ DESRNKLW++SGCPLIPL EF++PE+
Sbjct  12   DFSPSSKNALKWAIDNLVDDGDTLYLINVNSNSLDESRNKLWAESGCPLIPLDEFKDPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LKKY VK ++EVLD+LDT +RQK++TVV+KLYW GDAREKL D+++DLKLDSLVMGSRGL
Sbjct  72   LKKYGVKVDIEVLDMLDTISRQKKVTVVSKLYWGGDAREKLLDAVQDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKH  442
             ++QRI++GSV++YV+  A CP+T+VK 
Sbjct  132  GTVQRILLGSVSSYVMANAPCPVTIVKE  159



>ref|XP_007140453.1| hypothetical protein PHAVU_008G113500g [Phaseolus vulgaris]
 gb|ESW12447.1| hypothetical protein PHAVU_008G113500g [Phaseolus vulgaris]
Length=157

 Score =   222 bits (566),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAI+NLAD+G TFYI+H+N  +SD+ RN+LW++SG PLIPL+EFRE E+
Sbjct  12   DFSKSSKVALKWAIENLADEGHTFYIVHVNPDSSDD-RNQLWAKSGSPLIPLNEFREAEV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+++ EVLDLLDTATRQK+++VV KLYWGD REKL DSIEDLKLDSLV+GSRGLS
Sbjct  71   MKNYGVQSDAEVLDLLDTATRQKQVSVVVKLYWGDVREKLLDSIEDLKLDSLVIGSRGLS  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  131  TIQRMILGSVSNFVMTHAPCPVTIVK  156



>ref|XP_004137751.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis 
sativus]
Length=162

 Score =   222 bits (566),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLADKGDT +II++N ++ +ES ++LW++S   LIPLSEFREPE+
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSLEESAHRLWAESA--LIPLSEFREPEV  69

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLKLDSLVMGSRGLS
Sbjct  70   LKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLKLDSLVMGSRGLS  129

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            +++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  130  TIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  162



>ref|XP_010256749.1| PREDICTED: uncharacterized protein C167.05 [Nelumbo nucifera]
Length=164

 Score =   222 bits (565),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNL DKGDT  +IH+  H + ++   L +  G PLIPL+EFR PEL
Sbjct  12   DFSQSSKRALQWAIDNLLDKGDTLLVIHVKHHGAHDAAKLLSANGGVPLIPLTEFRVPEL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY+V+ + EVLD+LDTA+RQKE T+V KLYWGDAREKLC++IEDLKLDSLVMGSRGL 
Sbjct  72   MKKYDVEIDPEVLDILDTASRQKEATIVTKLYWGDAREKLCEAIEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            ++QRI++GSVTN+V+T A CPITVVK P F+KH
Sbjct  132  TIQRILLGSVTNHVITHANCPITVVKDPSFNKH  164



>ref|XP_002877951.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54210.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WAI+NLADKGDT YIIH    + DESRN LW +SG PLIPL+EFREPE+
Sbjct  12   DFSESSKNALQWAIENLADKGDTLYIIHTLPLSDDESRNSLWFKSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +LQRIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALQRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>ref|NP_566991.2| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AAG40033.1|AF324682_1 AT3g53990 [Arabidopsis thaliana]
 gb|AAG40390.1|AF325038_1 AT3g53990 [Arabidopsis thaliana]
 gb|AAG41484.1|AF326902_1 unknown protein [Arabidopsis thaliana]
 gb|AAK00403.1|AF339721_1 unknown protein [Arabidopsis thaliana]
 gb|AAK32867.1|AF361855_1 AT3g53990/F5K20_290 [Arabidopsis thaliana]
 emb|CAB88361.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAK96518.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 gb|AAL31227.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 gb|AAL49942.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 dbj|BAD94963.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19759.1| AT3G53990 [Arabidopsis thaliana]
 gb|AEE79170.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
Length=160

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWAI+NLADKGDT YIIH    + DESRN LW +SG PLIPL+EFREPE+
Sbjct  12   DFSESSKNALKWAIENLADKGDTIYIIHTLPLSGDESRNSLWFKSGSPLIPLAEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKTDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++V+  A CP+TVVK
Sbjct  132  ALQRIIMGSVSSFVIQHAPCPVTVVK  157



>ref|XP_010529788.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
Length=159

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS  AL+WAI+NLADKGDT YIIH N    DES N LWS+SG PLIPL+EFREPE 
Sbjct  12   DFSDSSRNALRWAIENLADKGDTLYIIHTN---PDESANNLWSKSGSPLIPLTEFREPET  68

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L KY VK ++ VLDLLDTA+RQKE+ +V+KLYWGDAREKL D+I+DLKLDS+VMGSRGLS
Sbjct  69   LHKYGVKVDIPVLDLLDTASRQKEVHIVSKLYWGDAREKLLDAIDDLKLDSIVMGSRGLS  128

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RII+GSV+N+++T A CP+TVVK
Sbjct  129  TIKRIILGSVSNFMVTHAACPVTVVK  154



>ref|XP_002534082.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28298.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAIDNLAD+GDT Y+IH++ ++ DESRN+LW++SG PLIPL++FREPE+
Sbjct  12   DFSKSSKSALKWAIDNLADRGDTLYLIHVSPNSLDESRNQLWAKSGSPLIPLAQFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++ Y+VK ++EVLD+LDT  RQK++ VV KLYW GDAREKL D++EDLKLD LVMGSRGL
Sbjct  72   MRGYDVKIDIEVLDMLDTVHRQKDVNVVTKLYWGGDAREKLLDAVEDLKLDCLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
             ++QRI++GSV+ YV+T ATCP+TVVK  +  K
Sbjct  132  GTVQRILLGSVSTYVMTHATCPVTVVKDQESQK  164



>gb|KJB17332.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=164

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S+ S+ ALKW+IDNL ++GDT Y+IH+  H SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DYSKGSKAALKWSIDNLLNQGDTLYLIHVKPHQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + E+LDL+D A+RQK+ T+VAK+YWGDAR+K+C+S+EDLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEILDLVDIASRQKQGTLVAKIYWGDARDKICESVEDLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR+++GSV+NYV+  ATCP+T+VK P  H
Sbjct  132  TIQRVLIGSVSNYVMVNATCPVTIVKDPSAH  162



>gb|KHG13508.1| hypothetical protein F383_20265 [Gossypium arboreum]
Length=165

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLAD GDTFYIIHIN  + ++S N   +Q+G PLIPL++FR+PE+
Sbjct  12   DFSWSSKSALRWAIDNLADIGDTFYIIHINPSSPNDSTNTHLAQAGSPLIPLAQFRQPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KY+VK ++ VLD+LDTA+RQKEI VV KLYW GDAREK+ D+IEDLKLDSLVMGSRGL
Sbjct  72   MNKYDVKVDIAVLDMLDTASRQKEIQVVTKLYWGGDAREKILDAIEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHP  445
             +LQRII+GSV+NYVLT A CP+T+VK P
Sbjct  132  GTLQRIILGSVSNYVLTYAPCPVTIVKEP  160



>gb|KHG19158.1| hypothetical protein F383_06056 [Gossypium arboreum]
Length=164

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S+ S+ ALKW+IDNL ++GDT Y+IH+  H SDESRN LWS +G PLIPLSEFRE E+
Sbjct  12   DYSKGSKAALKWSIDNLLNQGDTLYLIHVKPHQSDESRNLLWSTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + E+LDL+D A+RQK+ T+VAK+YWGDAR+K+C+S+EDLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEILDLVDIASRQKQGTLVAKIYWGDARDKICESVEDLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR+++GSV+NYV+  ATCP+T+VK P  H
Sbjct  132  TIQRVLIGSVSNYVMVNATCPVTIVKDPSAH  162



>gb|KFK34646.1| hypothetical protein AALP_AA5G172700 [Arabis alpina]
Length=162

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWA +NLADKGDT YIIH    + DESRN LW ++G PLIPL EFREPE+
Sbjct  12   DFSESSKNALKWAFENLADKGDTLYIIHTLPISDDESRNSLWFKTGSPLIPLVEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MQKYGVKLDIACLDILDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +LQRIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALQRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>ref|XP_006291961.1| hypothetical protein CARUB_v10018150mg [Capsella rubella]
 gb|EOA24859.1| hypothetical protein CARUB_v10018150mg [Capsella rubella]
Length=163

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WA DNLADKGDT YIIH      DESRN LW +SG PLIPL EFREPE+
Sbjct  12   DFSESSKNALQWAFDNLADKGDTLYIIHTLPIPDDESRNSLWFKSGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKTDIACLDILDTGSRQKEVNVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +L+RIIMGSV+++V+  A CP+T+VK  D H
Sbjct  132  ALRRIIMGSVSSFVMQNAHCPVTIVKDNDSH  162



>ref|XP_007016274.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY33893.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=164

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ AL+WAIDNL DKGDT Y+IH+     DESRN LWS +G PLIPL+EFRE E+
Sbjct  12   DFSKGSKLALQWAIDNLLDKGDTLYLIHVKPQQGDESRNLLWSTTGSPLIPLAEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY V  + EVLDL+DTA+RQK++T+VAK+YWGDAR+++C+++ DLKLD LVMGSRGL 
Sbjct  72   MQKYEVNLDPEVLDLVDTASRQKQVTIVAKIYWGDARDRICEAVGDLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR+++GSV+NYV+  ATCP+T+VK P  H
Sbjct  132  TIQRVLIGSVSNYVMVNATCPVTIVKDPSAH  162



>ref|XP_010553266.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=160

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 127/146 (87%), Gaps = 3/146 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI+NLADKGDT +IIH N    DES NKL+S+SG PLIPL+EFREPE 
Sbjct  12   DFSDSSKNALRWAIENLADKGDTLFIIHTNP---DESSNKLFSESGSPLIPLAEFREPET  68

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L KY V+ ++ VLD+LDTA+RQKE+ +V+KLYWGDAREKL D++ DLKLDSLVMGSRGL+
Sbjct  69   LNKYGVQIDIIVLDMLDTASRQKEVNIVSKLYWGDAREKLLDAVADLKLDSLVMGSRGLT  128

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++++T A CP+T+VK
Sbjct  129  TLQRIIMGSVSDFIMTHAPCPVTIVK  154



>ref|XP_006403631.1| hypothetical protein EUTSA_v10010778mg [Eutrema salsugineum]
 gb|ESQ45084.1| hypothetical protein EUTSA_v10010778mg [Eutrema salsugineum]
Length=162

 Score =   218 bits (554),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAI+NLADKGDT YIIH    +  ESRN LW ++G PLIPL EFREPE+
Sbjct  12   DFSDSSKNALKWAIENLADKGDTLYIIHTLPSSDAESRNALWLKTGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +KKY VK ++E LD+LDT +RQKE+ VV KLYWGDAREKL D++++LKLDS+VMG+RGLS
Sbjct  72   MKKYGVKIDIECLDILDTGSRQKEVHVVTKLYWGDAREKLVDAVKELKLDSIVMGNRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +LQRIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALQRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>ref|XP_006373900.1| ENOD18 family protein [Populus trichocarpa]
 gb|ABK95880.1| unknown [Populus trichocarpa]
 gb|ERP51697.1| ENOD18 family protein [Populus trichocarpa]
Length=161

 Score =   217 bits (553),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS  ALKWAIDNL D GDT Y++++N+++ DESRNKLW++SGCPLIPL EF++PE+
Sbjct  12   DFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSLDESRNKLWAESGCPLIPLDEFKDPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LK Y VK + EVLD+LDT +RQK++ VV+KLYW GDAREKL D+++DLKLDSLVMGSRGL
Sbjct  72   LKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWGGDAREKLLDAVQDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKH  442
             ++QRI++GSV+ YV+  A CP+T+VK 
Sbjct  132  GTVQRILLGSVSAYVMANAPCPVTIVKE  159



>gb|KHG19157.1| hypothetical protein F383_06055 [Gossypium arboreum]
Length=159

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKW IDNL DKGDT Y+IH+  + SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + EVLDL+DTA+RQKE+ +V K+YWGDAR+K+C+S+ DLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEVLDLVDTASRQKEVNIVTKIYWGDARDKICESVADLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV+N+V+  ATCP+T+VK
Sbjct  132  TIQRVLIGSVSNHVMVNATCPVTIVK  157



>ref|XP_010515911.1| PREDICTED: universal stress protein A family protein C25B2.10-like 
[Camelina sativa]
Length=164

 Score =   217 bits (552),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WA DNLADKGDT Y+IH    + DE+RN LW +SG PLIPL+EFREPE 
Sbjct  12   DFSESSKNALQWAFDNLADKGDTIYVIHTLPISEDEARNSLWFKSGSPLIPLAEFREPET  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            +L+RIIMGSV+++V+  A CP+TVVK  D +K
Sbjct  132  ALRRIIMGSVSSFVIQHAPCPVTVVKDNDSYK  163



>ref|XP_004492382.1| PREDICTED: uncharacterized protein C167.05-like [Cicer arietinum]
Length=163

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESRNKL +++G PLIPL E +E E+
Sbjct  12   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRNKLLAKTGSPLIPLEELKEAEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L KY V+A++EVLD+L  A  QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  72   LSKYGVQADVEVLDMLHAAAVQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSV+N+V+  + CP+T+VK
Sbjct  132  TIKRILLGSVSNFVMVHSPCPVTIVK  157



>ref|NP_001142159.1| USP family protein [Zea mays]
 gb|ACF87780.1| unknown [Zea mays]
 gb|AFW78218.1| USP family protein [Zea mays]
Length=164

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+SES++ AL WAIDNL   GDT  ++H+  H ++E+++ LW++SG PLIPLSEFREPE+
Sbjct  17   DYSESAKKALDWAIDNLLHHGDTLVVVHVLHHGAEETKHTLWAKSGSPLIPLSEFREPEV  76

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V+ + EVLD +DTA RQK++ VVAKLYWGDAREKLCD++EDL++DSLVMGSRGL 
Sbjct  77   MQGYGVRPDAEVLDAIDTAARQKQLKVVAKLYWGDAREKLCDAVEDLRIDSLVMGSRGLG  136

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  137  PIQRILLGSVTNYVLSNASCPVTVVK  162



>gb|ACG42306.1| USP family protein [Zea mays]
Length=164

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+SES++ AL WAIDNL   GDT  ++H+  H ++E+++ LW++SG PLIPLSEFREPE+
Sbjct  17   DYSESAKKALDWAIDNLLHHGDTLVVVHVLHHGAEETKHTLWAKSGSPLIPLSEFREPEV  76

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V+ + EVLD +DTA RQK++ VVAKLYWGDAREKLCD++EDL++DSLVMGSRGL 
Sbjct  77   MQGYGVRPDAEVLDAIDTAARQKQLKVVAKLYWGDAREKLCDAVEDLRIDSLVMGSRGLG  136

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  137  PIQRILLGSVTNYVLSNASCPVTVVK  162



>ref|XP_010427062.1| PREDICTED: universal stress protein A family protein C25B2.10-like 
[Camelina sativa]
Length=163

 Score =   216 bits (550),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WA DNLADKGDT Y+IH    + DE+RN LW +SG PLIPL EFREPE 
Sbjct  12   DFSESSKNALQWAFDNLADKGDTIYVIHTLPMSDDEARNSLWFKSGSPLIPLVEFREPET  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +L+RIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALRRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>ref|XP_009116089.1| PREDICTED: uncharacterized protein LOC103841315 [Brassica rapa]
Length=158

 Score =   216 bits (549),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WAIDNLADKGDTFYIIH    +    RN LW +SG PLIPL EFREPE 
Sbjct  12   DFSESSKNALRWAIDNLADKGDTFYIIHALPTSEAGPRNSLWLKSGSPLIPLVEFREPET  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++ VLDLLDT +RQKEI VV K+YWGDAREKL D+++ LKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIPVLDLLDTGSRQKEIHVVTKIYWGDAREKLVDAVKSLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++V+  A CP+TVVK
Sbjct  132  ALQRIIMGSVSSFVIQHAPCPVTVVK  157



>ref|XP_002323532.2| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
 gb|EEF05293.2| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
Length=223

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS  ALKWAIDNL D GDT Y++++N+++ DESRNKLW++SGCPLIPL EF++PE+
Sbjct  74   DFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSLDESRNKLWAESGCPLIPLDEFKDPEI  133

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LK Y VK + EVLD+LDT +RQK++ VV+KLYW GDAREKL D+++DLKLDSLVMGSRGL
Sbjct  134  LKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWGGDAREKLLDAVQDLKLDSLVMGSRGL  193

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             ++QRI++GSV+ YV+  A CP+T+VK
Sbjct  194  GTVQRILLGSVSAYVMANAPCPVTIVK  220



>gb|KHN05122.1| Universal stress protein A-like protein [Glycine soja]
Length=157

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAI+NLADK  TFYIIH+N ++SD+ RN+LW++SG PLIPL+EFRE E+
Sbjct  12   DFSNSSKIALKWAIENLADKCHTFYIIHVNPNSSDD-RNQLWAKSGSPLIPLTEFREEEI  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + EVLDLLDTA RQKE+ VV KL+WGD REKL DSIEDLKLDSLV+GSRGL 
Sbjct  71   MKHYGVQNDAEVLDLLDTAARQKEVNVVVKLHWGDVREKLLDSIEDLKLDSLVLGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  131  TIQRMILGSVSNFVMTHAPCPVTIVK  156



>gb|KJB19521.1| hypothetical protein B456_003G127400 [Gossypium raimondii]
Length=159

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKW+ DNL DKGDT Y+IH+  + SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DFSKGSKAALKWSTDNLVDKGDTLYLIHVKPNQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + EVLDL+DTA+RQKE+ +V K+YWGDAR+K+C+S+ DLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEVLDLVDTASRQKEVNIVTKIYWGDARDKICESVADLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV+N+V+  ATCP+T+VK
Sbjct  132  TIQRVLIGSVSNHVMVNATCPVTIVK  157



>emb|CDX73512.1| BnaC08g24910D [Brassica napus]
Length=157

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WAIDNLADKGDTFYIIH     S+  RN LW +SG PLIPL EFREPE 
Sbjct  12   DFSESSKNALRWAIDNLADKGDTFYIIH-ALPTSEAGRNSLWLKSGSPLIPLVEFREPET  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++ VLD+LDT +RQKEI VV K+YWGDAREKL D+++ LKLDS+VMGSRGLS
Sbjct  71   MEKYGVKIDIPVLDMLDTGSRQKEIHVVTKIYWGDAREKLVDAVKSLKLDSIVMGSRGLS  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++V+  A CP+TVVK
Sbjct  131  ALQRIIMGSVSSFVIQHAPCPVTVVK  156



>gb|ABY84681.1| universal stress protein 1 [Gossypium arboreum]
 gb|ACA51838.1| universal stress protein 1 [Gossypium arboreum]
Length=164

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKW IDNL DKGDT Y+IH+  + SDESR  LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQSDESRKLLWSTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + E+LDL+D A+ QK+ T+VAK+YWGDAR+K+C+S+EDLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEILDLVDIASGQKQGTLVAKIYWGDARDKICESVEDLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR+++GSV+NYV+  ATCP+T+VK P  H
Sbjct  132  TIQRVLIGSVSNYVMVNATCPVTIVKDPSAH  162



>ref|XP_002439902.1| hypothetical protein SORBIDRAFT_09g022230 [Sorghum bicolor]
 gb|EES18332.1| hypothetical protein SORBIDRAFT_09g022230 [Sorghum bicolor]
Length=166

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+SES++ AL WAIDNL   GDT  ++H+  H+ +E+++ LW++SG PLIPLSEFREPE+
Sbjct  19   DYSESAKKALDWAIDNLLHHGDTLVVLHVLHHSGEETKHALWAKSGSPLIPLSEFREPEV  78

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V+ + EVLD++DTA RQK++ VVAKLYWGDAREKLCD++ DLK+DSLVMGSRGL 
Sbjct  79   MQGYGVRTDAEVLDMIDTAARQKQLKVVAKLYWGDAREKLCDAVGDLKIDSLVMGSRGLG  138

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  139  PIQRILLGSVTNYVLSNASCPVTVVK  164



>ref|XP_010504187.1| PREDICTED: uncharacterized protein LOC104781260 [Camelina sativa]
Length=164

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ AL+WA DNLADKGDT Y+IH    + DE+RN LW +SG PLIPL EFREPE 
Sbjct  12   DFSESSKDALQWAFDNLADKGDTIYVIHTLPISEDEARNSLWFKSGSPLIPLVEFREPET  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++  LD+LDT +RQKE+ VV KLYWGDAREKL D+++DLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            +L+RIIMGSV+++V+  A CP+TVVK  D +K
Sbjct  132  ALRRIIMGSVSSFVIQHAPCPVTVVKDNDSYK  163



>ref|XP_004961892.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=164

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S+SS+ AL WAI NL   GDT  ++H+  H  +E+++ LW++SG PLIPLSEFREPE+
Sbjct  17   DYSDSSKKALDWAIANLLRHGDTLVVVHVLHHGGEETKHTLWAKSGSPLIPLSEFREPEV  76

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y VK + EVLD++DTA RQK++ VVAKLYWGDAREKLCD +E+LK+DSLVMGSRGL 
Sbjct  77   MKNYGVKTDAEVLDMIDTAARQKQLKVVAKLYWGDAREKLCDGVEELKIDSLVMGSRGLG  136

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  137  PIQRILLGSVTNYVLSNASCPVTVVK  162



>ref|XP_010905389.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI+NL DKGD   ++H+     DES++ LW++SG  LIPL+EFR+PE+
Sbjct  12   DFSKSSKRALEWAINNLLDKGDMLIVLHVMYPKKDESKHGLWAKSGSSLIPLTEFRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y+++ ++EVLD+LDTA+RQKE T+VAKLYWGDAREKLC+++EDLKLDSLVMGSRGLS
Sbjct  72   MKHYDLEVDIEVLDMLDTASRQKEATIVAKLYWGDAREKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNY+L+ A CP+TVVK
Sbjct  132  QIQRILLGSVTNYMLSNAACPVTVVK  157



>ref|NP_001236285.1| uncharacterized protein LOC100527197 [Glycine max]
 gb|ACU16249.1| unknown [Glycine max]
 gb|KHN25838.1| Universal stress protein A-like protein [Glycine soja]
Length=157

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKWAI+NLADKG T YIIH+N ++SD+ RN+LW +SG PL+PL+EFR+ E+
Sbjct  12   DFSKSSKIALKWAIENLADKGQTLYIIHVNPNSSDD-RNQLWVKSGSPLVPLTEFRDAEV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y V+ + EVLDLLDTA RQKE+ VV KLYWGD REKL DSIEDLKL+SLV+GSRGL 
Sbjct  71   TKHYGVQTDAEVLDLLDTAARQKEVNVVVKLYWGDVREKLLDSIEDLKLNSLVLGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  131  TIQRMILGSVSNFVMTHAPCPVTIVK  156



>emb|CAC18558.1| ENOD18 protein [Vicia faba]
Length=164

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESRNKL++++G PLIPL E +E  +
Sbjct  11   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRNKLFAKTGSPLIPLEELKEAGV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y V+ ++EV+DLL+ A  QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  71   MKQYGVQTDVEVIDLLEIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSV+N+V+  + CP+T+VK
Sbjct  131  TIKRILLGSVSNFVMVHSPCPVTIVK  156



>gb|ABK22721.1| unknown [Picea sitchensis]
Length=164

 Score =   212 bits (540),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTH-ASDESRNKLWSQSGCPLIPLSEFREPE  178
            D+S SS+ ALKWA+DNLAD+GD   +IH+N + AS+  +++LW +SG PLIPL+EFRE  
Sbjct  12   DYSPSSKSALKWALDNLADEGDRVVVIHVNQNKASESGQSQLWEKSGSPLIPLAEFREGN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            L K Y +  + EVLD+LDTATRQKE+ V+AK+YWGDAREKLCD++EDLKLDSLVMGSRGL
Sbjct  72   LSKHYELTPDAEVLDMLDTATRQKELEVIAKVYWGDAREKLCDAVEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
              L+R+ +GSV+NYV++ A+CP+TVVK P F
Sbjct  132  GQLKRVFLGSVSNYVISNASCPVTVVKEPGF  162



>ref|XP_009139276.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX76180.1| BnaA04g04440D [Brassica napus]
Length=162

 Score =   211 bits (538),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWA +NLADKGDT YIIH    +  +S N  W +SG PLIPL EFREPE+
Sbjct  12   DFSESSKNALKWAFENLADKGDTLYIIHTLPTSEVDSHNSAWLESGSPLIPLVEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++ VLD+LDT +RQKE+ VV KLYWGDARE L D++EDLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIPVLDMLDTGSRQKEVHVVTKLYWGDAREALVDAVEDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +L+RIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALRRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>ref|XP_010043475.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW85492.1| hypothetical protein EUGRSUZ_B02294 [Eucalyptus grandis]
 gb|KCW85493.1| hypothetical protein EUGRSUZ_B02294 [Eucalyptus grandis]
Length=164

 Score =   211 bits (538),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL DK DT Y++H+     DESRN LWS +G PLIPLSEFRE  +
Sbjct  12   DFSKGSKLALKWAIDNLVDKDDTLYMLHVKPFVGDESRNLLWSATGSPLIPLSEFREKAV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             +KY+V+ + EVLD+LDT  RQK +TVV K+YWGDAR+KLC ++ DLKLD LVMGSRGL 
Sbjct  72   AQKYDVELDPEVLDMLDTGCRQKHVTVVVKIYWGDARDKLCAAVGDLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            S+QR+I+GSVT++V+ TATCP+T+VK P  H
Sbjct  132  SIQRVILGSVTSHVMATATCPVTIVKEPTSH  162



>emb|CDY13163.1| BnaC04g26720D [Brassica napus]
Length=162

 Score =   211 bits (538),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWA +NLADKGDT YIIH    +  +S N  W +SG PLIPL EFREPE+
Sbjct  12   DFSESSKNALKWAFENLADKGDTLYIIHTLPTSEVDSHNSAWLESGSPLIPLMEFREPEI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++KY VK ++ VLD+LDT +RQKE+ VV KLYWGDARE L D++EDLKLDS+VMGSRGLS
Sbjct  72   MEKYGVKIDIPVLDMLDTGSRQKEVHVVTKLYWGDAREALVDAVEDLKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +L+RIIMGSV+++V+  A CP+TVVK  D H
Sbjct  132  ALRRIIMGSVSSFVIQHAPCPVTVVKDNDSH  162



>emb|CAC18556.1| early nodulin ENOD18 [Vicia faba]
Length=165

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESR+KL++++G PLIPL E +E  +
Sbjct  12   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRSKLFAKTGSPLIPLEELKEAGV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y V+ ++EV+DLL+ A  QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  72   MKQYGVQTDVEVIDLLEIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSV+N+V+  + CP+T+VK
Sbjct  132  TIKRILLGSVSNFVMVHSPCPVTIVK  157



>ref|XP_010905911.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NL DKGD   ++H+     DES++ LW+ SG PLIPL+E R+PE+
Sbjct  12   DFSKSSKRALEWAISNLLDKGDMLIVLHVMRPQKDESKHALWAASGSPLIPLTELRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y+++ ++EVLD+LDTA+RQKE T+V KLYWGDAREKLC++ EDLK+DSLVMGSRGLS
Sbjct  72   MKHYDLEVDIEVLDILDTASRQKEATIVVKLYWGDAREKLCEAAEDLKVDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
             +QRI++GSV NYVL+ A CP+T+VK  +F
Sbjct  132  QIQRILLGSVANYVLSNAACPVTIVKDSNF  161



>ref|NP_001288953.1| uncharacterized protein C167.05-like [Brassica rapa]
 gb|ABL97944.1| hypothetical protein [Brassica rapa]
 emb|CDX67580.1| BnaA07g16200D [Brassica napus]
Length=159

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSESS+ ALKWAI+NLADKGDT YIIH    +  ESRN LW +SG PLIPL+EFREP++
Sbjct  12   DFSESSKNALKWAIENLADKGDTLYIIHTLPTSEAESRNALWLESGSPLIPLAEFREPKI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y VK ++  LD+LDT +R+KE+ VV KLYWGDAREKL D++++LKLDS+VMGSRGLS
Sbjct  72   MENYGVKIDIACLDMLDTGSRKKEVHVVTKLYWGDAREKLVDAVKELKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++V+  A CP+T+VK
Sbjct  132  ALQRIIMGSVSSFVIDHAPCPVTIVK  157



>gb|AFK49059.1| unknown [Lotus japonicus]
Length=164

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ AL WA+DNL   GDT YIIHIN     ESRN LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKTALNWAVDNLLRNGDTLYIIHINPPQDSESRNLLWSTTGSPLIPLSEFREREV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V  + EVLDLLDTA+RQK++T+VAKLYWGDAREK+ D++EDLKLD+LVMGSRGL 
Sbjct  72   MRHYEVDTDAEVLDLLDTASRQKQVTIVAKLYWGDAREKIVDAVEDLKLDALVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV+ YV + A CP+T+VK
Sbjct  132  AIQRVLLGSVSTYVTSNANCPVTIVK  157



>ref|XP_003623213.1| Early nodulin ENOD18 [Medicago truncatula]
 gb|AES79431.1| early nodulin ENOD18 [Medicago truncatula]
Length=169

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESRNK ++++G PLI L E +E E+
Sbjct  12   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRNKQFAKTGSPLISLEELKEVEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ ++EVLD+LDT   QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  72   MSKYGVQTDVEVLDMLDTLATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSV+N+V+  + CP+T+VK
Sbjct  132  TIKRILLGSVSNFVMVHSPCPVTIVK  157



>ref|XP_006424952.1| hypothetical protein CICLE_v10029414mg [Citrus clementina]
 ref|XP_006488418.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR38192.1| hypothetical protein CICLE_v10029414mg [Citrus clementina]
Length=166

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL +KGDT YIIHI     DESRN LWS +G PLIPL EFR+ E+
Sbjct  13   DFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIPLEEFRDQEV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y V  + +VLD+LD A++QK ++VVAKLYWGDAR+KLC+++E +KLDSLVMGSRGL 
Sbjct  73   MKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            ++QR+++GSV+N+VL  A+CP+T+VK P
Sbjct  133  TIQRVLLGSVSNHVLANASCPVTIVKDP  160



>ref|XP_002309096.1| ENOD18 family protein [Populus trichocarpa]
 gb|ABK94618.1| unknown [Populus trichocarpa]
 gb|EEE92619.1| ENOD18 family protein [Populus trichocarpa]
Length=157

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAIDNL D GDT Y+IHIN +    S N+L+++SG PLIPL+EFREPE+
Sbjct  12   DFSPSSKNALKWAIDNLVDNGDTLYLIHINPN----SHNQLFAKSGSPLIPLAEFREPEI  67

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LKKY+V+A+++VLD+LDT +RQKE+ VV+KLYW GDAREKL D+I+DLKLDSLVMGSRGL
Sbjct  68   LKKYDVQADIQVLDMLDTISRQKEVKVVSKLYWGGDAREKLLDAIDDLKLDSLVMGSRGL  127

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++RI++GSV+ YV+T A CP+T+VK
Sbjct  128  GTIRRILLGSVSTYVMTHAPCPVTIVK  154



>gb|ABK22475.1| unknown [Picea sitchensis]
 gb|ABK23200.1| unknown [Picea sitchensis]
 gb|ACN40676.1| unknown [Picea sitchensis]
Length=164

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDES-RNKLWSQSGCPLIPLSEFREPE  178
            D+S SS+ ALKWA+DNLADKGD   +IHIN +   ES +++LW ++G PLIPL+EFRE  
Sbjct  12   DYSPSSKSALKWALDNLADKGDRVVVIHINQNKEPESGQSQLWDKAGSPLIPLAEFREGN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            L K Y +  + EVLD+LDTA RQKE+ V+AK+YWGDAREKLCD++EDLKLDSLVMGSRGL
Sbjct  72   LSKHYELNPDAEVLDMLDTAARQKELEVIAKVYWGDAREKLCDAVEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
              L+R+ +GSV+NYV++ A CP+TVVK P F
Sbjct  132  GQLKRVFLGSVSNYVISNANCPVTVVKEPGF  162



>gb|KDO66689.1| hypothetical protein CISIN_1g041485mg, partial [Citrus sinensis]
Length=179

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL +KGDT YIIHI     DESRN LWS +G PLIPL EFR+ E+
Sbjct  26   DFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEV  85

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y V  + +VLD+LD A++QK ++VVAKLYWGDAR+KLC+++E +KLDSLVMGSRGL 
Sbjct  86   MKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLG  145

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            ++QR+++GSV+N+VL  A+CP+T+VK P
Sbjct  146  TIQRVLLGSVSNHVLANASCPVTIVKDP  173



>ref|XP_011019203.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=157

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAIDNL D GDT Y+IHIN +    S N+L+++SG PLIPL+EFREPE+
Sbjct  12   DFSPSSKNALKWAIDNLVDNGDTLYLIHINPN----SHNQLFAKSGSPLIPLAEFREPEI  67

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LKKY+V+ ++EVLD+LDT +RQKE+ VV+KLYW GDAREKL D+I+DLKLDSLVMGSRGL
Sbjct  68   LKKYDVEVDIEVLDMLDTISRQKEVKVVSKLYWGGDAREKLLDAIDDLKLDSLVMGSRGL  127

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++RI++GSV+ YV+T A CP+TVVK
Sbjct  128  GTIRRILLGSVSTYVMTHAPCPVTVVK  154



>ref|XP_009405844.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   209 bits (532),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAIDNL  KGDT  ++HI     DE+++ LW QSG PLIPL+EFR+P++
Sbjct  14   DFSKSSKAALRWAIDNLLRKGDTILLLHIMPDKGDEAKHPLWIQSGSPLIPLTEFRQPDV  73

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y +  NMEVLD LDTA+RQK   +VAKL+WGDAREKLC ++ DL LDSLVMGSRG+S
Sbjct  74   MKHYELDVNMEVLDELDTASRQKGAIIVAKLFWGDAREKLCQAVGDLGLDSLVMGSRGVS  133

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKH  442
             ++RI++GSVTNYVLT ATCP+TVVK+
Sbjct  134  PIRRILLGSVTNYVLTNATCPVTVVKN  160



>gb|AFK43282.1| unknown [Lotus japonicus]
Length=164

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ AL WA+DNL   GDT YIIHIN     ESRN LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKTALNWAVDNLLRNGDTLYIIHINPPQDSESRNLLWSTTGSPLIPLSEFREREV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V  + EVLDLLDTA+RQK+ T+VAKLYWGDAREK+ D++EDLKLD+LVMGSRGL 
Sbjct  72   MRHYEVDTDAEVLDLLDTASRQKQATIVAKLYWGDAREKIVDAVEDLKLDALVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV+ YV + A CP+T+VK
Sbjct  132  AIQRVLLGSVSTYVTSNANCPVTIVK  157



>ref|XP_010923192.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   209 bits (531),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ AL WAIDNL D GDT  ++H+     DE+R+ LWSQSG PLIPL+E R+PE+
Sbjct  12   DFSKGSKRALGWAIDNLLDHGDTLIVLHVLHPKVDEARHALWSQSGSPLIPLTELRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y+++ ++EVLD+LDTA+RQK+ T+V K YWGDAREKLC + EDLKLDSLVMGSRG S
Sbjct  72   MKNYDLEVDIEVLDMLDTASRQKQATIVGKFYWGDAREKLCQAEEDLKLDSLVMGSRGHS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDF  451
             L RI++GSVT+YVL+  +CP+T+VK PDF
Sbjct  132  RLLRILLGSVTSYVLSNVSCPVTIVKDPDF  161



>ref|XP_008811502.1| PREDICTED: uncharacterized protein C167.05 [Phoenix dactylifera]
Length=163

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI+NL  KGD   ++H+      ES++ LW +SG PLIPL+EFREPE+
Sbjct  12   DFSKSSKKALEWAINNLLHKGDMLVVLHVMPPKKGESKHGLWVKSGSPLIPLAEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
               Y+++ ++E LD+LDTA+RQKE T+VAKLYWGDAREKLC+++EDLKLDSLVMGSRGLS
Sbjct  72   TTHYDLEVDIEALDMLDTASRQKEATIVAKLYWGDAREKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNY+L+ A CP+T+VK
Sbjct  132  QIQRILLGSVTNYILSNAACPVTIVK  157



>gb|AFK47553.1| unknown [Medicago truncatula]
Length=169

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESRNK ++++G PLI L E +E E+
Sbjct  12   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRNKQFAKTGSPLISLEELKEVEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + KY V+ ++EVLD+LDT   QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  72   MSKYGVQTDVEVLDMLDTLATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++ I++GSV+N+V+  + CP+T+VK
Sbjct  132  TIKGILLGSVSNFVMVHSPCPVTIVK  157



>emb|CDY07565.1| BnaC06g14990D [Brassica napus]
Length=159

 Score =   207 bits (526),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D SESS+ ALKWAI+NLADKGDT YIIH    +  ESRN LW +SG PLIPL EFREP++
Sbjct  12   DLSESSKNALKWAIENLADKGDTLYIIHTLPTSEAESRNALWLESGSPLIPLVEFREPKI  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y VK ++  LD+LDT +R+KE+ VV KLYWGDAREKL D++++LKLDS+VMGSRGLS
Sbjct  72   MENYGVKIDIACLDMLDTGSRKKEVHVVTKLYWGDAREKLVDAVKELKLDSIVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQRIIMGSV+++V+  A CP+T+VK
Sbjct  132  ALQRIIMGSVSSFVIDHAPCPVTIVK  157



>emb|CAC18557.1| early nodulin ENOD18 [Vicia faba]
Length=164

 Score =   207 bits (526),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS++S+ ALKWAI N+ADKGDTFY+IHIN+++SDESR+KL++++G PLIPL E +E  +
Sbjct  12   DFSKNSKNALKWAIVNMADKGDTFYLIHINSNSSDESRSKLFAKTGSPLIPL-ELKEAGV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K+Y V+ ++EV+DLL+ A  QKE++VVAKLYWGDAR+KL DSIEDLKLD+LV+GSRGLS
Sbjct  71   MKQYGVQTDVEVIDLLEIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALVLGSRGLS  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSV+N+V+  + CP+T+VK
Sbjct  131  TIKRILLGSVSNFVMVHSPCPVTIVK  156



>gb|KDP24530.1| hypothetical protein JCGZ_25094 [Jatropha curcas]
Length=163

 Score =   207 bits (526),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ ALKWAIDNLAD+ DT Y+IH+N ++ DES ++LW++SG PLIPL++FREPE 
Sbjct  12   DFSPSSKKALKWAIDNLADRKDTLYLIHVNPNSLDES-HQLWAKSGSPLIPLAQFREPET  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LK Y+VK +++VLD+LDT +RQKE+ V+ KLYW GDAR+KL D+I+DLKLDSLVMGSRGL
Sbjct  71   LKSYDVKIDIDVLDMLDTISRQKEVNVITKLYWGGDARDKLLDAIDDLKLDSLVMGSRGL  130

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             +++RI++GSV+ +V+T ATCP+TVVK  D
Sbjct  131  GTVKRILLGSVSTFVMTHATCPVTVVKDLD  160



>ref|NP_001236015.1| uncharacterized protein LOC100306505 [Glycine max]
 gb|ACU14709.1| unknown [Glycine max]
 gb|KHN25235.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   207 bits (526),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL   GD  YI+HI      E RN LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKIALKWAIDNLLRNGDILYIVHIKPSGGSEFRNLLWSTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +  Y V  + EVLDLLDTA+R+K++TVVAKLYWGDAREK+ +++ DLKLDSLVMGSRGL 
Sbjct  72   MHHYEVDTDAEVLDLLDTASREKQVTVVAKLYWGDAREKIVEAVGDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSVTNYV T A+CPIT+VK
Sbjct  132  AIQRVLLGSVTNYVTTNASCPITIVK  157



>ref|XP_004507155.1| PREDICTED: uncharacterized protein C167.05-like [Cicer arietinum]
Length=164

 Score =   206 bits (525),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAI+NL    DT YIIHIN   S ESRN LW  +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKIALKWAIENLLRNADTLYIIHINPSQSTESRNLLWLTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +  Y V  + EVLDLLDTA+RQKE+TVVAK+YWGD REK+CD++ DLKLD+LVMGSRGL 
Sbjct  72   MHHYEVDPDAEVLDLLDTASRQKELTVVAKIYWGDPREKICDAVGDLKLDALVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV++YV + A+CP+T+VK
Sbjct  132  AIQRVLLGSVSSYVTSNASCPVTIVK  157



>ref|NP_001235190.1| uncharacterized protein LOC100499728 [Glycine max]
 gb|ACU13396.1| unknown [Glycine max]
 gb|KHN21915.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL   GDT YI+H       ES N LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKIALKWAIDNLISNGDTLYIVHTKPSGGSESGNLLWSTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V  + EVLDLLDTA+RQK++ VVAKLYWGDAREK+ +++ DLKLDSLVMGSRGL 
Sbjct  72   MRHYEVDTDAEVLDLLDTASRQKQVNVVAKLYWGDAREKIVEAVGDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSVTNYV   A+CPIT+VK
Sbjct  132  AIQRVLLGSVTNYVTANASCPITIVK  157



>gb|EMT01474.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=166

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ AL+WA+ NL  +GDT  ++H+  H  +E+++ +W++SG PLIPLSE+REPE+
Sbjct  18   DYSASSKRALEWAVRNLLRRGDTVVVLHVQRHGGEEAKHAVWAKSGSPLIPLSEYREPEV  77

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V  + EVLD+LDTA RQ E+ VVAK+YWGDAREKLCD++E+ K+D++VMGSRGL 
Sbjct  78   MKNYGVTCDAEVLDMLDTAARQLELKVVAKVYWGDAREKLCDAVEEQKIDTIVMGSRGLG  137

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  138  TIQRILLGSVTNYVLSNASCPVTVVK  163



>ref|XP_009392694.1| PREDICTED: uncharacterized protein C167.05 [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL WA+ NL  KGDT  ++HI     DE+++ LWSQSG PLIPL EFR+PE+
Sbjct  20   DFSKSSKAALGWALGNLLRKGDTLILLHIIPTTGDEAKHLLWSQSGSPLIPLMEFRQPEV  79

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y++  + EVLD+LDT++RQKE T+V KLYWGDAREKLC + EDL LD LVMGSRGLS
Sbjct  80   MKHYDLDVDSEVLDMLDTSSRQKEATIVTKLYWGDAREKLCHAAEDLNLDLLVMGSRGLS  139

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKH  442
             +QRI++GSVTNYVLT A CP+TVVK 
Sbjct  140  QIQRIMLGSVTNYVLTYAPCPVTVVKQ  166



>ref|XP_007132029.1| hypothetical protein PHAVU_011G060700g [Phaseolus vulgaris]
 gb|ESW04023.1| hypothetical protein PHAVU_011G060700g [Phaseolus vulgaris]
Length=164

 Score =   204 bits (520),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL  KGDT  I+HI      ESRN LWS +G PLIPLSEFRE E+
Sbjct  12   DFSKGSKIALKWAIDNLLRKGDTLLIVHIKHTQGSESRNLLWSTTGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +  Y V ++ EVLDLLDTA++QK++ VVAKLYWGDAREK+C+++ DLKL +LVMGSRGL 
Sbjct  72   MHHYEVDSDAEVLDLLDTASKQKQVDVVAKLYWGDAREKICEAVGDLKLHTLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSVTNYV   A+CP+T+VK
Sbjct  132  AIQRVLLGSVTNYVTLNASCPVTIVK  157



>gb|AFK45410.1| unknown [Medicago truncatula]
 gb|KEH30197.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=164

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAIDNL   GDT YI+H+N     ESRN LW+ +G PLIPLSEFRE  +
Sbjct  12   DFSKGSKIALKWAIDNLLRTGDTLYIVHVNHSHPTESRNLLWATTGSPLIPLSEFREKNV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            + +Y V  + EVLD+LDTA+RQK++TVV K+YWGDAREK+ DS+ DLKLD+LVMGSRGL 
Sbjct  72   VHQYEVDPDAEVLDILDTASRQKQVTVVGKVYWGDAREKIVDSVGDLKLDALVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QR+++GSV+ YV + A+CP+T+VK
Sbjct  132  AIQRVLLGSVSTYVTSNASCPVTIVK  157



>ref|XP_002520471.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41884.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ AL WAI NL D GDT YIIH+     DESR  LWS +G PLIPL EFRE E+
Sbjct  12   DFSKGSKLALNWAITNLIDNGDTLYIIHVKPQQGDESRLLLWSATGSPLIPLVEFREQEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              KY +K + EVLD+LDT +RQK++T+VAKLYWGDAR++ C+++  LKLD LVMGSRGL 
Sbjct  72   ANKYEIKLDPEVLDMLDTVSRQKQVTIVAKLYWGDARDRFCEAVGHLKLDCLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            +++R+++GSVTNYV+ TATCP+TVVK    H
Sbjct  132  TIKRVLLGSVTNYVMATATCPVTVVKDSSPH  162



>gb|EPS57397.1| hypothetical protein M569_17421 [Genlisea aurea]
Length=185

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFSE+S+ AL+W+IDNLAD GDTFYI+H+  H   +S ++L    G PLIPLSEFREPE+
Sbjct  36   DFSETSKAALQWSIDNLADGGDTFYILHVKKHQ--DSSHELCFHGGSPLIPLSEFREPEV  93

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y+V  ++E+LD+LDTA+RQKEITVV K+YWGD REK+ +++EDL LDSLV+G+RGLS
Sbjct  94   MRNYDVPIDIEILDMLDTASRQKEITVVVKVYWGDPREKIVEAVEDLNLDSLVIGNRGLS  153

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++RI++GSVTNYV+  A+CP+T+VK
Sbjct  154  TIKRILLGSVTNYVMEHASCPVTIVK  179



>ref|XP_008221790.1| PREDICTED: uncharacterized protein LOC103321737 [Prunus mume]
Length=162

 Score =   202 bits (513),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLA-DKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ ALKWAI+NLA +KGDT Y IH+     DESRN LWS +G PLIPL+EFR+  
Sbjct  12   DFSRGSKIALKWAINNLAHEKGDTLYAIHVKPSQGDESRNLLWSTTGSPLIPLAEFRQKA  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +++ Y V+ + EVLDLLDTA RQK +TVVAKLYWGDAREKLC ++EDLKLD LV+GSRGL
Sbjct  72   VMENYEVEVDPEVLDLLDTAHRQKHVTVVAKLYWGDAREKLCGAVEDLKLDCLVLGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             ++QR+++GSV++YV+  ATC +T+VK
Sbjct  132  GTIQRVLLGSVSSYVMANATCAVTIVK  158



>gb|AFK37746.1| unknown [Lotus japonicus]
Length=160

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS  ALKWAI+N+ADKGDTFYIIH+    SD SR  +W++SG PLIPLS  R+PE 
Sbjct  12   DFSKSSNSALKWAIENMADKGDTFYIIHV---MSDGSRTNIWAKSGSPLIPLSILRQPEA  68

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +  Y V+ + EVLD+LD A  QKE+  VAKLYWG+AR+KL DSIEDLKLDSLVMGSRG  
Sbjct  69   MSNYGVQTDPEVLDMLDAAAGQKEVNFVAKLYWGEARQKLIDSIEDLKLDSLVMGSRGRG  128

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S++RI+MGSV+N+++  ATCP+ +V+
Sbjct  129  SIKRILMGSVSNFLMIHATCPVAIVR  154



>ref|XP_007206045.1| hypothetical protein PRUPE_ppa012585mg [Prunus persica]
 gb|EMJ07244.1| hypothetical protein PRUPE_ppa012585mg [Prunus persica]
Length=162

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLA-DKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS+ S+ ALKWAI+NLA +KGDT Y IH+     DESRN LWS +G PLIPL EFR+  
Sbjct  12   DFSKGSKIALKWAINNLAHEKGDTLYAIHVKPSQGDESRNLLWSTTGSPLIPLEEFRQKA  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +++ Y V+ + EVLDLLDTA RQK +TVVAKLYWGDAREKLC ++EDLKLD LV+GSRGL
Sbjct  72   VMENYEVEVDPEVLDLLDTAHRQKHVTVVAKLYWGDAREKLCGAVEDLKLDCLVLGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             ++QR+++GSV++YV+  ATC +T+VK
Sbjct  132  GTIQRVLLGSVSSYVMANATCAVTIVK  158



>ref|XP_003568332.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=167

 Score =   201 bits (512),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S S++ AL+WA  NL  +GDT  ++H+  H  +E+++ LW++SG PLIPLSEFREP +
Sbjct  20   DYSASAKKALEWATQNLLRRGDTLVVLHVLRHGGEEAKHTLWAKSGSPLIPLSEFREPAV  79

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V+ + EVLD+LDTA RQ E+ VVAKLYWGDAREKLC+++++ K+D++VMGSRGL 
Sbjct  80   MQNYGVRCDAEVLDMLDTAARQLELKVVAKLYWGDAREKLCEAVDEQKIDTIVMGSRGLG  139

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            ++QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  140  TMQRILLGSVTNYVLSNASCPVTVVK  165



>ref|XP_008386015.1| PREDICTED: uncharacterized protein LOC103448528 [Malus domestica]
Length=162

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLA-DKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS+ S+ ALKWAIDNL+ +KGDT Y+IH+     DESR+ LWS +G PLIP +EFRE  
Sbjct  12   DFSKGSKIALKWAIDNLSQEKGDTLYVIHVKPSQGDESRSILWSSTGSPLIPFTEFREKS  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +++KY V+ + EVL+LL+TA+RQK +TVVAKLYWGDAREKLC + E+LKLD LV+GSRGL
Sbjct  72   VMEKYEVELDAEVLELLETASRQKHVTVVAKLYWGDAREKLCGAAEELKLDCLVIGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             ++QR+++GSV++YV+  A CP+TVVK
Sbjct  132  GTIQRVLLGSVSSYVMANAECPVTVVK  158



>ref|XP_008384901.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=162

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNL-ADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS+  + ALKWA+DNL  +KGDT Y+IHI     DESR+ LWS +G PLIP +EFRE  
Sbjct  12   DFSKGCKVALKWAMDNLIHEKGDTLYVIHIKPSQGDESRSTLWSSTGSPLIPFTEFREKL  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +++KY+VK + EVLDLLDT +RQK  TVVAKLYWGDAREKLC + E+LKLD LV+GSRGL
Sbjct  72   VMEKYDVKVDAEVLDLLDTVSRQKHATVVAKLYWGDAREKLCGAAEELKLDCLVLGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             S+QR+++GSV++YV+  A CP+T+VK
Sbjct  132  GSIQRVLLGSVSSYVMANAICPVTIVK  158



>ref|XP_009350161.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=162

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNL-ADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS+  + ALKWAIDNL  +KGDT Y+IH+     DESR+ LWS +G PLIP +EFRE  
Sbjct  12   DFSKGCKLALKWAIDNLIHEKGDTLYVIHVKPSQGDESRSTLWSSTGSPLIPFTEFREKL  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            +++KY+VK + EVLDLLDT +RQK  TVVAK+YWGDAREKLC + E+LKLD LV+GSRGL
Sbjct  72   VMEKYDVKVDAEVLDLLDTVSRQKHATVVAKIYWGDAREKLCGAAEELKLDCLVLGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             S+QR+++GSV++YV+  A CP+T+VK
Sbjct  132  GSIQRVLLGSVSSYVMANAICPVTIVK  158



>ref|XP_002281607.1| PREDICTED: uncharacterized protein C167.05 [Vitis vinifera]
 emb|CBI16038.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   199 bits (506),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S  ALKWAIDNL DKGDT + IH+     DESRN LWS +G PLIPL EFR+ ++
Sbjct  12   DFSQGSNIALKWAIDNLLDKGDTLFFIHVKPSQGDESRNLLWSATGSPLIPLEEFRDLDV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             +KY +  + E L +L TA+ QK+  ++AK+YWGDAR+KLCD++ +LKLDSLVMGSRGL 
Sbjct  72   AQKYEINLDPEFLGMLATASSQKKAKIIAKIYWGDARDKLCDAVAELKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR  +GSVTNYV+  ATCP+T+VK P  H
Sbjct  132  TIQRTFLGSVTNYVMVHATCPVTIVKDPSSH  162



>ref|XP_008657063.1| PREDICTED: universal stress protein A-like protein [Zea mays]
 gb|AFW84580.1| hypothetical protein ZEAMMB73_526883 [Zea mays]
Length=158

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNL  +GDT  ++H+  H  +E +N LWS++G PL+PL E  EP +
Sbjct  11   DFSPSSKKALRWAIDNLVRRGDTLVLLHVRHHGREEGKNVLWSRTGSPLVPLEELMEPPV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y+V  + EV D+L+ A RQKE+ VV K+YWGD REK+CD++E+L+++SLVMGSRGL 
Sbjct  71   RQRYDVPYDAEVFDMLNAAARQKEMRVVVKMYWGDPREKVCDAVEELQIESLVMGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  131  QIQRILLGSVTNYVLSNASCPVTVVK  156



>ref|XP_004137752.1| PREDICTED: uncharacterized protein C167.05-like isoform 3 [Cucumis 
sativus]
Length=142

 Score =   196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WAIDNLADKGDT +II++N ++ +ES ++LW++SG PLIPLSEFREPE+
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSLEESAHRLWAESGSPLIPLSEFREPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLKLDSLVMGSRGLS
Sbjct  72   LKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIM  382
            +++R + 
Sbjct  132  TIRRFVF  138



>ref|XP_004291522.1| PREDICTED: universal stress protein A-like protein [Fragaria 
vesca subsp. vesca]
Length=161

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWA+ NL+DK DT Y+IH+      ESR+ LWS +G PLIP +EFR+ ++
Sbjct  12   DFSKGSKTALKWALHNLSDKSDTLYVIHVKPQEGSESRSLLWSTTGSPLIPFAEFRQKDV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            ++ Y V+ + EVL+LLDTA +QK +TV+AK+YWGDAR+KLC+++EDLKLD LV+GSRGL 
Sbjct  72   MENYEVELDQEVLELLDTAIKQKHVTVIAKIYWGDARDKLCEAVEDLKLDCLVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +LQR+++GSV+++V+  A CP+T+VK
Sbjct  132  TLQRVLLGSVSSHVMANANCPVTIVK  157



>ref|XP_006654496.1| PREDICTED: universal stress protein A-like protein-like [Oryza 
brachyantha]
Length=166

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ AL WAI NL  +GDT  ++H+  H  +E+++ LW +SG PLIPLSEFR+P  
Sbjct  19   DYSASSKRALDWAIANLLRRGDTVVVVHVLHHGGEEAKHALWGKSGSPLIPLSEFRDPTA  78

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +++Y +  + EVLD+LDTA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+LVMGSRGL 
Sbjct  79   MQQYGIHCDAEVLDMLDTAARQFELTVVAKLYWGDAREKLCDAVEEQKIDTLVMGSRGLG  138

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S+QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  139  SIQRILLGSVTNYVLSNASCPVTVVK  164



>ref|XP_008791855.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=164

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A++WA+DNL D GD   +IH+ +  SD ++ KLW  +G PLIPL EFRE  L
Sbjct  12   DYSASSKVAVRWAVDNLVDGGDRIVLIHVQSGKSDHAQKKLWEDTGSPLIPLEEFREMNL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDTA++ K++ VV+K+YWGD REKLCD++EDLKLDSLV+GSRGL 
Sbjct  72   SKQYGINPDREVLDILDTASKTKQVKVVSKIYWGDPREKLCDAVEDLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            S +R+++GSV++YV++ ATCP+TVVK     K
Sbjct  132  SFKRLLLGSVSSYVVSNATCPVTVVKGTPMPK  163



>ref|NP_001055716.1| Os05g0453700 [Oryza sativa Japonica Group]
 dbj|BAC78561.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAT47039.1| putative universal stress protein (USP) [Oryza sativa Japonica 
Group]
 dbj|BAF17630.1| Os05g0453700 [Oryza sativa Japonica Group]
 gb|EEC79327.1| hypothetical protein OsI_20177 [Oryza sativa Indica Group]
Length=165

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ AL WAI NL  +GD   ++H+  H  +E+++ LW +SG PLIPLSEFR+P  
Sbjct  18   DYSASSKRALDWAIANLLRRGDHLVVLHVLHHGGEEAKHALWGKSGSPLIPLSEFRDPTA  77

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +++Y V  + EVLD+LDTA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+LVMGSRGL 
Sbjct  78   MQQYGVHCDAEVLDMLDTAARQLELTVVAKLYWGDAREKLCDAVEEQKIDTLVMGSRGLG  137

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S+QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  138  SIQRILLGSVTNYVLSNASCPVTVVK  163



>ref|XP_010917276.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=164

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A++WAIDNL   GD   +IH+ +  SD ++ +LW  SG PLIPL EFRE  L
Sbjct  12   DYSASSKAAVRWAIDNLVGSGDRIVVIHVQSGKSDRAQKQLWEDSGSPLIPLDEFREMNL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDTA++ K++ VV+K+YWGD REKLCD++EDLKLDSLV+GSRGL 
Sbjct  72   PKQYGINPDREVLDILDTASKTKQVIVVSKIYWGDPREKLCDAVEDLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
            S +R+++GSV++YV++ A+CP+TVVK     K
Sbjct  132  SFKRLLLGSVSSYVVSNASCPVTVVKGTPMSK  163



>ref|XP_002458767.1| hypothetical protein SORBIDRAFT_03g039910 [Sorghum bicolor]
 gb|EES03887.1| hypothetical protein SORBIDRAFT_03g039910 [Sorghum bicolor]
Length=158

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA DNL  KGDT  ++HI  H  DE++N LWS++G PLIPL E  +P +
Sbjct  11   DFSPSSKKALRWATDNLVCKGDTLVLLHIRHHRKDEAKNTLWSRTGSPLIPLEELMDPPV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++  + EV D L    RQKE+ VV K+YWGD REK+CD++E+L L+SLVMGSRGL 
Sbjct  71   RQRYDMPEDPEVFDTLSAVARQKELCVVIKMYWGDPREKVCDAVEELHLESLVMGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S+QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  131  SVQRILLGSVTNYVLSNASCPVTVVK  156



>ref|XP_010262906.1| PREDICTED: uncharacterized protein C167.05-like [Nelumbo nucifera]
Length=229

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCP--LIPLSEFREP  175
            DFS SS  AL W I+NL DKGDT Y+IH+     DE+R+ LW+ +G P  LIPLSE  +P
Sbjct  12   DFSNSSRSALNWTIENLLDKGDTLYVIHVKYDKGDEARHVLWANTGSPTALIPLSELLDP  71

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
            EL+KKY+++   +VLDLL+TA   KE TVV KLY GDAR+KLC ++EDLKLDSLVMGSRG
Sbjct  72   ELMKKYDIQMAPDVLDLLETA-YTKEATVVGKLYLGDARDKLCSAVEDLKLDSLVMGSRG  130

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKHP  445
            LS+++RI++GSVTN+V+T A+CPIT+VK P
Sbjct  131  LSTIRRILLGSVTNHVITHASCPITIVKEP  160



>dbj|BAK06554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA DNL  KGDT  ++HI  H  DE+++ LWS SG PLIPL E ++  +
Sbjct  24   DFSASSKKALRWAADNLLRKGDTLVLLHIEHHGRDEAKHVLWSHSGSPLIPLEELKDTAI  83

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++  + EVLD+LD  +R+KE++VV KLYWGD REK+C+++ +L L+SLVMGSRGL 
Sbjct  84   RQRYDIPDDAEVLDMLDAVSREKELSVVLKLYWGDPREKVCEAVGELNLESLVMGSRGLG  143

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  144  QIQRILLGSVTNYVLSNASCPVTVVK  169



>gb|KJB17335.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=145

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 19/151 (13%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S+ S+ ALKW+IDNL ++GDT Y+IH+  H SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DYSKGSKAALKWSIDNLLNQGDTLYLIHVKPHQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y                   E T+VAK+YWGDAR+K+C+S+EDLKLD LVMGSRGL 
Sbjct  72   MKHY-------------------EGTLVAKIYWGDARDKICESVEDLKLDCLVMGSRGLG  112

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
            ++QR+++GSV+NYV+  ATCP+T+VK P  H
Sbjct  113  TIQRVLIGSVSNYVMVNATCPVTIVKDPSAH  143



>ref|XP_006373899.1| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
 gb|ERP51696.1| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
Length=208

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS  ALKWAIDNL D GDT Y++++N+++ DESRNKLW++SGCPLIPL EF++PE+
Sbjct  74   DFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSLDESRNKLWAESGCPLIPLDEFKDPEI  133

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-GDAREKLCDSIEDLKLDSLVMGSRGL  358
            LK Y VK + EVLD+LDT +RQK++ VV+KLYW GDAREKL D+++DLKLDSLVMGSRGL
Sbjct  134  LKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWGGDAREKLLDAVQDLKLDSLVMGSRGL  193

Query  359  SSLQRIIMGSVTNYV  403
             ++QR      TN +
Sbjct  194  GTVQRYPYNFKTNML  208



>ref|NP_001044810.1| Os01g0849600 [Oryza sativa Japonica Group]
 dbj|BAB89509.1| putative early nodulin ENOD18 [Oryza sativa Japonica Group]
 dbj|BAF06724.1| Os01g0849600 [Oryza sativa Japonica Group]
 gb|EAZ14154.1| hypothetical protein OsJ_04084 [Oryza sativa Japonica Group]
 dbj|BAG98303.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71807.1| hypothetical protein OsI_04441 [Oryza sativa Indica Group]
Length=162

 Score =   186 bits (473),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA DNL  KGDT  ++HI  H  DE++N LWS +G PLIPL E  E  +
Sbjct  15   DFSPSSKKALQWAADNLLRKGDTLVLLHIRHHGRDEAKNVLWSHTGSPLIPLEELMETAV  74

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++ ++ EV D+L+  +R+KE++VV K+YWG+ REK+C+++ +L L+SLVMGSRGL 
Sbjct  75   RQRYDIPSDEEVFDMLNAVSREKELSVVLKMYWGEPREKVCEAVGELNLESLVMGSRGLG  134

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  135  QIQRILLGSVTNYVLSNASCPVTVVK  160



>ref|XP_003567271.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=164

 Score =   186 bits (472),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA  N   KGD   ++HI     DE+++ LWSQSG PLIPL E R+  +
Sbjct  11   DFSASSKKALRWAAHNFLRKGDILVLLHIEHRGRDEAKHVLWSQSGSPLIPLEELRDTAV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++  + EV D+LDT  R+KE+ VV KLYWGD REK+C+++ +L+LDSLVMGSRGL 
Sbjct  71   RQRYDIPEDAEVFDMLDTVEREKELAVVLKLYWGDPREKVCEAVGELQLDSLVMGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  131  QIQRILLGSVTNYVLSNASCPVTVVK  156



>ref|XP_004970581.1| PREDICTED: uncharacterized protein C167.05-like [Setaria italica]
Length=158

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA DNL  KGDT  ++H+  H  +E++N LWS +G PLIP  E  EP +
Sbjct  11   DFSASSKKALRWAADNLVRKGDTLVLLHVRHHGREEAKNVLWSHTGSPLIPFEELMEPPV  70

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++  + EV D+L+    QKE+ VV K+YWGD REK+CD++ +L L SLVMGSRGL 
Sbjct  71   RQRYDMPEDPEVFDMLNALALQKELCVVVKMYWGDPREKVCDAVGELNLQSLVMGSRGLG  130

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  131  QIQRILLGSVTNYVLSNASCPVTVVK  156



>ref|XP_010685657.1| PREDICTED: universal stress protein A-like protein [Beta vulgaris 
subsp. vulgaris]
Length=164

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAID L  KGDT +IIH+      ESRN +WS SG PL+PL+EF +PE+
Sbjct  13   DFSKGSKAALKWAIDGLLRKGDTLFIIHVKHAQGLESRNLIWSTSGTPLVPLAEFCDPEV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +  Y V+   +VL+LL+  ++Q E+TV+ K+YWGDAREK+C++I  L+LD+++MGSRGLS
Sbjct  73   MHGYGVQPEPDVLELLELISKQLEVTVLWKIYWGDAREKVCEAIGSLELDAMIMGSRGLS  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSVT+YVL  ATCP+TVVK
Sbjct  133  AIRRVLLGSVTSYVLEHATCPVTVVK  158



>ref|XP_008811359.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008811360.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Phoenix 
dactylifera]
Length=157

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NL D+GDT  ++H+     +ES++ LW++SG PLIPL+EFR+PE+
Sbjct  12   DFSKSSKRALEWAISNLLDEGDTLIVLHVMPPQKEESKHGLWAKSGSPLIPLTEFRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y+++ +++VLD+LDTA+RQKE T+VAKLYWGDAREKLC+++EDLKLDSLVMGSRGLS
Sbjct  72   MKHYDLEVDIQVLDMLDTASRQKEATIVAKLYWGDAREKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQRIIMGSVTNYVLTTATCPITV  433
             +Q     S   Y+L   +CP+ V
Sbjct  132  QIQSPRY-SCLRYLLRLRSCPVPV  154



>ref|XP_010062315.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
Length=164

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL D+GD   +I +    SD +R +L+  +G PLIPL EFRE   
Sbjct  12   DYSPTSKAALRWAAENLVDEGDQLLLIPVQPPKSDHTRKQLFEDTGSPLIPLEEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y + ++ EVLD+LDT +R K + V AK+YWGD REKLC+++EDLKLDSLV+GSRGL 
Sbjct  72   SKQYGLTSDPEVLDVLDTVSRTKGVKVAAKVYWGDPREKLCEAVEDLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S++R+++GSV+NYV+T+ATCP+TVVK
Sbjct  132  SIKRVLLGSVSNYVVTSATCPVTVVK  157



>gb|KJB19522.1| hypothetical protein B456_003G127400 [Gossypium raimondii]
Length=135

 Score =   182 bits (463),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKW+ DNL DKGDT Y+IH+  + SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DFSKGSKAALKWSTDNLVDKGDTLYLIHVKPNQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + EVLDL+DTA+RQKE+ +V K+YWGDAR+K+C+S+ DLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEVLDLVDTASRQKEVNIVTKIYWGDARDKICESVADLKLDCLVMGSRGLG  131

Query  362  SLQR  373
            ++QR
Sbjct  132  TIQR  135



>ref|XP_006645015.1| PREDICTED: uncharacterized protein C167.05-like [Oryza brachyantha]
Length=161

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS SS+ AL+WA DNL  +GDT  ++H+  H  +E++N LWS +G PLIPL E  E  +
Sbjct  14   DFSASSKKALQWAADNLLRQGDTLVLLHVQHHGRNEAKNALWSHTGSPLIPLEELMETAV  73

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             ++Y++ ++ EV D+L+  +R+K ++VV K+YWGD REK+C+++ +L L+SLVMGSRGL 
Sbjct  74   RQRYDIPSDGEVFDMLNAVSREKGLSVVLKMYWGDPREKVCEAVGELNLESLVMGSRGLG  133

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  134  QIQRILLGSVTNYVLSNASCPVTVVK  159



>gb|KCW69440.1| hypothetical protein EUGRSUZ_F02899 [Eucalyptus grandis]
Length=215

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL D+GD   +I +    SD +R +L+  +G PLIPL EFRE   
Sbjct  63   DYSPTSKAALRWAAENLVDEGDQLLLIPVQPPKSDHTRKQLFEDTGSPLIPLEEFREINF  122

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y + ++ EVLD+LDT +R K + V AK+YWGD REKLC+++EDLKLDSLV+GSRGL 
Sbjct  123  SKQYGLTSDPEVLDVLDTVSRTKGVKVAAKVYWGDPREKLCEAVEDLKLDSLVVGSRGLG  182

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            S++R+++GSV+NYV+T+ATCP+TVVK
Sbjct  183  SIKRVLLGSVSNYVVTSATCPVTVVK  208



>gb|EEE63940.1| hypothetical protein OsJ_18765 [Oryza sativa Japonica Group]
Length=171

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 118/152 (78%), Gaps = 6/152 (4%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGC------PLIPLSE  163
            D+S SS+ AL WAI NL  +GD   ++H+  H  +E+++ LW +SG        LIPLSE
Sbjct  18   DYSASSKRALDWAIANLLRRGDHLVVLHVLHHGGEEAKHALWGKSGSLDSIPPALIPLSE  77

Query  164  FREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVM  343
            FR+P  +++Y V  + EVLD+LDTA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+LVM
Sbjct  78   FRDPTAMQQYGVHCDAEVLDMLDTAARQLELTVVAKLYWGDAREKLCDAVEEQKIDTLVM  137

Query  344  GSRGLSSLQRIIMGSVTNYVLTTATCPITVVK  439
            GSRGL S+QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  138  GSRGLGSIQRILLGSVTNYVLSNASCPVTVVK  169



>ref|XP_010276270.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=164

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ ALKWA+DNL + GD   +IH+ +  SD ++ KLW ++G PLIPL EF+E  L
Sbjct  12   DYSPSSKTALKWAVDNLVENGDKLVVIHVQSPKSDPAQKKLWEETGSPLIPLGEFKEMNL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + +VLDLLD+A+  +  TV+ K+YWGD REKL D++E LKLDSLV+GSRGL 
Sbjct  72   SKQYGLTRDPDVLDLLDSASAAEGATVLCKVYWGDPREKLLDAVEGLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+T ATCP+TVVK
Sbjct  132  AIKRVLLGSVSNYVVTNATCPVTVVK  157



>gb|KJB17333.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
 gb|KJB17334.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=135

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S+ S+ ALKW+IDNL ++GDT Y+IH+  H SDESRN LWS SG PLIPLSEFRE E+
Sbjct  12   DYSKGSKAALKWSIDNLLNQGDTLYLIHVKPHQSDESRNLLWSTSGSPLIPLSEFREKEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V+ + E+LDL+D A+RQK+ T+VAK+YWGDAR+K+C+S+EDLKLD LVMGSRGL 
Sbjct  72   MKHYEVEPDPEILDLVDIASRQKQGTLVAKIYWGDARDKICESVEDLKLDCLVMGSRGLG  131

Query  362  SLQR  373
            ++QR
Sbjct  132  TIQR  135



>ref|XP_011085896.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=165

 Score =   181 bits (459),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL WAI+NL D+GD  +IIH+ +  +D +  +L++ +G PLIPL EFRE  +
Sbjct  12   DYSATSKSALNWAINNLIDEGDQMFIIHVVSPKADPTNKQLFADTGSPLIPLEEFREINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EVLD+LDT ++ + + VVAK+YWGD REKLCD+ E LKLDSLV+GSRGL 
Sbjct  72   SKHYGLNPDPEVLDMLDTVSKTRRVKVVAKVYWGDPREKLCDAAEQLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  132  TIKRVLLGSVSNYVVQNATCPVTVVK  157



>ref|XP_006432876.1| hypothetical protein CICLE_v10002725mg [Citrus clementina]
 ref|XP_006471631.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR46116.1| hypothetical protein CICLE_v10002725mg [Citrus clementina]
 gb|KDO40421.1| hypothetical protein CISIN_1g031202mg [Citrus sinensis]
Length=164

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D S +S+ AL+WA DNL D GD   +IH+    +D +R +L+  +G PL+PL EFRE   
Sbjct  12   DNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPLVPLEEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y + +N EVLD+LDT +R K   VVAK+YWGD REKLCD++EDLKLD+LV+GSRGL 
Sbjct  72   SKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKLDTLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +L+R+++GSV+N+V+T ++CP+TVVK
Sbjct  132  ALKRVLLGSVSNHVVTNSSCPVTVVK  157



>ref|XP_008811357.1| PREDICTED: uncharacterized protein LOC103722544 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811358.1| PREDICTED: uncharacterized protein LOC103722544 isoform X1 [Phoenix 
dactylifera]
Length=158

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ AL+WAI NL D+GDT  ++H+     +ES++ LW++SG PLIPL+EFR+PE+
Sbjct  12   DFSKSSKRALEWAISNLLDEGDTLIVLHVMPPQKEESKHGLWAKSGSPLIPLTEFRQPEV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y+++ +++VLD+LDTA+RQKE T+VAKLYWGDAREKLC+++EDLKLDSLVMGSRGLS
Sbjct  72   MKHYDLEVDIQVLDMLDTASRQKEATIVAKLYWGDAREKLCEAVEDLKLDSLVMGSRGLS  131

Query  362  SLQR  373
             +QR
Sbjct  132  QIQR  135



>ref|XP_008227919.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=164

 Score =   179 bits (453),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA+DNL ++GD   +IH+    +  +R +L+  +G PLIPL EF E  +
Sbjct  12   DYSATSKSALRWAVDNLIEEGDRIILIHVEPPKATNTRKQLFEDTGSPLIPLEEFVETNV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y + ++ EVLD+LDT +R K   VVAK+YWGD REKLCD+++DLKLDSLV+GSRGL 
Sbjct  72   SKQYGLTSDPEVLDILDTVSRTKRAKVVAKVYWGDPREKLCDAVQDLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R+++GSV+NYV+T A+CP+TVVK
Sbjct  132  LIKRVLLGSVSNYVVTNASCPVTVVK  157



>ref|XP_009602053.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=165

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ ALKWAIDNL ++GD   IIH+ +   D +  +L+  +G PLIPL EFRE  +
Sbjct  15   DYSATSKIALKWAIDNLIEEGDKIIIIHVVSSKVDTTNKQLFEDTGSPLIPLDEFREINV  74

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EVLD+LDT ++ K++ V+AK+YWGDAREKLCD+ E LKLDSLV+GSRGL 
Sbjct  75   SKYYGLNPDREVLDMLDTVSKLKKVIVMAKVYWGDAREKLCDAAEHLKLDSLVVGSRGLG  134

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+  ATCP+TVVK
Sbjct  135  VLKRVLLGSVSNHVVQNATCPVTVVK  160



>ref|XP_011071386.1| PREDICTED: uncharacterized protein C167.05-like [Sesamum indicum]
Length=161

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL+WA+DN++  GD   ++ +      +E   +LW  +G PLIPL EF EP 
Sbjct  12   DFSPCSRKALRWAVDNISRNGDHLILVTVRPEGHYEEGEMQLWEATGSPLIPLLEFSEPH  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY V  + E LD++ TA+RQKEITV+ K+YWGDAREK+C+SI+++ LD L++G+RGL
Sbjct  72   IMKKYGVNPDPETLDIVTTASRQKEITVLMKIYWGDAREKICESIDNIPLDCLIIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R+IMGSV+NYV++ ATCP+TVVK  D
Sbjct  132  GKLKRVIMGSVSNYVVSNATCPVTVVKSHD  161



>ref|XP_006384122.1| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
 gb|ERP61919.1| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
Length=161

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL  +GD   +I +    +D +R +L+  +G PL+PL+EFRE   
Sbjct  12   DYSSTSKAALRWAAENLIGEGDRIILIQVQPPNADHTRKQLFGGTGSPLVPLAEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K   VVAK+YWGD REKL D++EDLKLDSLVMGSRGL 
Sbjct  72   SKQYGLTYDPEVLDILDTVSRTKGAEVVAKVYWGDPREKLIDAVEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+T A CP+TVVK
Sbjct  132  AIKRVLLGSVSNYVVTNAPCPVTVVK  157



>ref|XP_010101064.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXB86774.1| Universal stress protein A-like protein [Morus notabilis]
Length=166

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA+DNL D GD   +IH+    +D +R +L+  +G PLIPL EFRE   
Sbjct  12   DYSATSKAALRWAVDNLIDGGDLVVLIHVEPPEADHTRKELFQDTGSPLIPLEEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +    EV+D+LDT +R K   VVAK+YWGD REKL D+++ LKLDSLV+GSRGL 
Sbjct  72   SKQYGLSNEPEVIDILDTVSRTKGAKVVAKVYWGDPREKLLDAVKQLKLDSLVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R+++GSV+NYV+T A+CP+TVVK
Sbjct  132  PIKRVLLGSVSNYVVTHASCPVTVVK  157



>ref|XP_009761731.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=167

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ ALKWAIDNL ++GD   IIH+ +   + +  +L+  +G PLIPL EFRE  +
Sbjct  12   DYSATSKIALKWAIDNLIEEGDKIIIIHVVSSKLEPTNKQLFEDTGSPLIPLDEFREINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EVLD+LDT ++ K++ VVAK+YWGDAREKLCD+ E LKLDSLV+GSRGL 
Sbjct  72   SKYYGLNPDREVLDMLDTVSKLKKVIVVAKVYWGDAREKLCDAAEHLKLDSLVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+  ATCP+TVVK
Sbjct  132  VLKRMLLGSVSNHVVQNATCPVTVVK  157



>gb|ABQ42110.1| NOD18 protein [Sonneratia caseolaris]
Length=106

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDA  289
            SRN LWS++G PLIPLSE+REPE +KKY+ + +MEVLD+LDTA+RQKE+ VV KLYWGDA
Sbjct  1    SRNLLWSKTGSPLIPLSEYREPEAMKKYDAETDMEVLDMLDTASRQKEMKVVTKLYWGDA  60

Query  290  REKLCDSIEDLKLDSLVMGSRGLSSLQRIIMGSVTNYVLTTATCPI  427
            REKL  S EDLKLDSLVMGSRGLS++QRII+GSVTNYVL  ATCP+
Sbjct  61   REKLVQSTEDLKLDSLVMGSRGLSTIQRIILGSVTNYVLNHATCPV  106



>ref|XP_010558670.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=159

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL D GD   +IH+    +  +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKSALRWAAENLVDDGDHLVLIHVQPPNAGHTRKILFEDTGSPLVPLEEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + +VLD+LDT +R K + VVAK+YWGD REKLCD+++DL LD +V+GSRGL 
Sbjct  72   SKQYGLAYDPQVLDVLDTLSRAKTVKVVAKVYWGDPREKLCDAVDDLNLDCIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++RI+MGSV+NYV+T ATCP+TVVK
Sbjct  132  PIKRILMGSVSNYVVTNATCPVTVVK  157



>ref|XP_002528512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33881.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL D GD   +I +    +D +R +L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKAALRWAAENLIDSGDMVVLIQVQPPKADHTRKQLFEATGSPLVPLEEFREINY  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD LDT +R K   VVAK+YWGD REKLCD+++DLKLDSLV+GSRGL 
Sbjct  72   SKQYGLSRDPEVLDFLDTVSRTKGAKVVAKVYWGDPREKLCDAVDDLKLDSLVIGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R ++GSV+NYV+T A+CP+TVVK
Sbjct  132  PIKRELLGSVSNYVVTNASCPVTVVK  157



>ref|XP_006357579.1| PREDICTED: uncharacterized protein LOC102602636 [Solanum tuberosum]
Length=132

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+SS+ ALKW I+NLADKGDTF IIH+  +   +SR++LW+QSG PLIPL EFRE E+
Sbjct  12   DFSKSSKAALKWTINNLADKGDTFCIIHVKNY---DSRHQLWAQSGSPLIPLVEFREAEV  68

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            L  Y+V+ ++E+LD LDTAT QK+I VV KLYWGDAREKLC  I DL+L+S+VMGSRGLS
Sbjct  69   LHYYDVETDIELLDTLDTATTQKQINVVIKLYWGDAREKLCQGIHDLQLNSIVMGSRGLS  128

Query  362  SLQR  373
             LQR
Sbjct  129  RLQR  132



>gb|ABQ42109.1| NOD18 protein [Sonneratia alba]
 gb|ABQ42111.1| NOD18 protein [Sonneratia ovata]
 gb|ABQ42112.1| NOD18 protein [Sonneratia apetala]
Length=106

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDA  289
            SRN LWS++G PLIPLSE+REPE +KKY+ + +MEVLD+LDTA+RQKE+ VV KLYWGDA
Sbjct  1    SRNLLWSKTGSPLIPLSEYREPEAMKKYDAETDMEVLDMLDTASRQKEMKVVTKLYWGDA  60

Query  290  REKLCDSIEDLKLDSLVMGSRGLSSLQRIIMGSVTNYVLTTATCPI  427
            REKL  S EDLKLDSLVMGSRGLS++QRII+GSVTNYV+  ATCP+
Sbjct  61   REKLVQSTEDLKLDSLVMGSRGLSTIQRIILGSVTNYVMNHATCPV  106



>ref|XP_010259285.1| PREDICTED: uncharacterized protein C167.05 [Nelumbo nucifera]
Length=164

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL+WA+DN+   GD   ++++    + +E   +LW  +G PLIPLSEF +P 
Sbjct  12   DFSPCSTKALRWAVDNVVRDGDHLILVNVRPEGNYEEGEMQLWEATGSPLIPLSEFSDPV  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY +  + E LD+L  A+RQKEI V+ K+YWGD REK+C++I+D+ L S+V+G+RGL
Sbjct  72   IMKKYGITPDPETLDILQCASRQKEIVVIMKIYWGDPREKICEAIDDIPLSSIVIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R+IMGSV+NYV+   TCP+TVVKH D
Sbjct  132  GKLKRVIMGSVSNYVVNNGTCPVTVVKHVD  161



>gb|AID16037.1| putative universal stress protein [Catharanthus roseus]
Length=163

 Score =   174 bits (441),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRN-KLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL WA++N+  KGD   ++ I      ES   +LW  +G PLIPLSEF +P 
Sbjct  14   DFSPCSRKALNWAVENVVRKGDHLILVTIRPEGHYESGEMQLWETTGSPLIPLSEFSDPH  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY V  ++E L++++TA RQKEI V+ K+YWGDAREKLC+S++D+ LD +++G+RGL
Sbjct  74   IMKKYGVTPDVETLEIVNTAARQKEIVVLMKIYWGDAREKLCESVDDIPLDCIILGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKH  442
             +++R IMGSV+NYV+  ATCP+TVVK 
Sbjct  134  GTIKRAIMGSVSNYVVNNATCPVTVVKQ  161



>ref|XP_011005923.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Populus euphratica]
Length=161

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL  +GD   +I +    +D +R +L+  +G PL+PL+EFRE   
Sbjct  12   DYSSTSKAALRWAAENLIGEGDRIILIQVQPPKADHTRKQLFEGTGSPLVPLAEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LD  +R K   VVAK+YWGD REKL D++EDLKLDSLVMGSRGL 
Sbjct  72   SKQYGLTYDPEVLDILDIVSRTKGAEVVAKVYWGDPREKLIDAVEDLKLDSLVMGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+T A CP+TVVK
Sbjct  132  AIKRVLLGSVSNYVVTNAPCPVTVVK  157



>ref|XP_002305257.2| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
 gb|EEE85768.2| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
Length=162

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL  +GD   +I +    +D +R +L+  +G PL+PL+EFRE   
Sbjct  12   DYSSTSKAALRWAAENLIGEGDRIILIQVQPPNADHTRKQLFGGTGSPLVPLAEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQK-EITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
             K+Y +  + EVLD+LDT +R K +  VVAK+YWGD REKL D++EDLKLDSLVMGSRGL
Sbjct  72   SKQYGLTYDPEVLDILDTVSRTKGQAEVVAKVYWGDPREKLIDAVEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++R+++GSV+NYV+T A CP+TVVK
Sbjct  132  GAIKRVLLGSVSNYVVTNAPCPVTVVK  158



>ref|XP_006298705.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
 gb|EOA31603.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
Length=157

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL + GDT  +IH+    +D +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKLALRWTAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K+  VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKK--VVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  129

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  130  SLKRMLLGSVSNHVVTNATCPVTVVK  155



>emb|CDP01682.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S++S+ ALKWA DNL ++GD+  IIH  +   + +  +L+  +G PLIPL+EFRE  +
Sbjct  12   DYSQTSKLALKWAADNLVEEGDSLIIIHGVSPKVETTNKQLFEDTGSPLIPLAEFREINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EVLDLLD   + K + VVAK+YWGDAREKLC++++ LKLDSLV+GSRGL 
Sbjct  72   SKHYGLNPDPEVLDLLDMVAKTKGVKVVAKVYWGDAREKLCEAVDHLKLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
            +++R+++GSV+NYV+  A CP+TVVK P
Sbjct  132  AIKRVLLGSVSNYVVQNALCPVTVVKGP  159



>gb|KHG02876.1| hypothetical protein F383_26328 [Gossypium arboreum]
Length=164

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSG-CPLIPLSEFREP  175
            DFS SS+ ALKWA+DN+  KGD   ++ +      +E   +LW+ SG  PLIPLSEF +P
Sbjct  12   DFSPSSKNALKWAVDNIMRKGDYLILVAVQPEGHYEEGEMQLWAISGGSPLIPLSEFSDP  71

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
              +KKY VK + E LD+ +TA +QKE+ VV K+YWGD REKLC++I+++ L  +V+G+RG
Sbjct  72   ATMKKYGVKPDPETLDIANTAAKQKEVMVVMKIYWGDPREKLCEAIDNIPLSCMVVGNRG  131

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            L +L+R IMGSV+NYV+   +CP+TVVKH   H H
Sbjct  132  LGTLKRAIMGSVSNYVVNNGSCPVTVVKH---HGH  163



>ref|XP_004236679.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=162

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ ALKWAIDNL ++GDT  IIH+ +   + +  +L+  +G PLIPL EF++  +
Sbjct  12   DYSATSKIALKWAIDNLIEEGDTIIIIHVVSSKVEPTSKQLFEDTGSPLIPLDEFKQINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EV+D+L+   + K++TVV+K+YWGDAREKLCD+ E LKLDSLV+G RGL 
Sbjct  72   SKYYGLNPDKEVIDMLEPVAKLKKVTVVSKVYWGDAREKLCDAAESLKLDSLVIGGRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+NYV+  ATCP+TVVK
Sbjct  132  VLKRVLLGSVSNYVVQNATCPVTVVK  157



>ref|XP_006346765.1| PREDICTED: uncharacterized protein C167.05-like [Solanum tuberosum]
Length=162

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ ALKWAIDNL ++GDT  IIH+ +   + +  +L+  +G PLIPL EF++  +
Sbjct  12   DYSATSKIALKWAIDNLIEEGDTIIIIHVVSSKVEPTSKQLFEVTGSPLIPLDEFKQINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EV+D+L+   + K++TVV+K+YWGDAREKLCD+ E LKLDSLV+G RGL 
Sbjct  72   SKYYGLNPDKEVIDMLEPVAKLKKVTVVSKVYWGDAREKLCDAAESLKLDSLVIGGRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+NYV+  ATCP+TVVK
Sbjct  132  VLKRVLLGSVSNYVVQNATCPVTVVK  157



>gb|KJB34724.1| hypothetical protein B456_006G080000 [Gossypium raimondii]
Length=164

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 110/155 (71%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSG-CPLIPLSEFREP  175
            DFS SS+ ALKWA+DN+  KGD   ++ +      +E   +LW+ SG  PLIPLSEF +P
Sbjct  12   DFSPSSKNALKWAVDNIMRKGDYLILVAVQPEGHYEEGEMQLWAISGGSPLIPLSEFSDP  71

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
              +KKY VK + E LD+ +TA +QKE+ VV K+YWGD REKLC++I+ + L  +V+G+RG
Sbjct  72   ATMKKYGVKPDPETLDIANTAAKQKEVMVVMKIYWGDPREKLCEAIDSIPLSCMVVGNRG  131

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            L +L+R IMGSV+NYV+   +CP+TVVKH   H H
Sbjct  132  LGTLKRAIMGSVSNYVVNNGSCPVTVVKH---HGH  163



>ref|NP_850506.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AAF26101.1|AC012328_4 unknown protein [Arabidopsis thaliana]
 gb|AEE73920.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=159

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL + GDT  +IH+    +D +R  L+ ++G PLIPL EFRE  L
Sbjct  12   DYSPTSKLALRWAAENLLEDGDTVILIHVQPQNADHTRKILFEETGSPLIPLEEFREVNL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|XP_008797443.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Phoenix dactylifera]
Length=211

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHA-SDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL+WA++N+   GD   +I++      +E   +LW  +G PLIPL+EF +P 
Sbjct  59   DFSACSKAALRWAVENVVRPGDHLILINVQKEVLYEEGEMQLWEATGSPLIPLAEFSDPG  118

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  RQKEI V+ K+YWGDAREK+C++IE + L  LV+G RGL
Sbjct  119  VAKKYGVKPDAETLDILNTVARQKEIVVIMKIYWGDAREKICEAIESIPLSCLVIGKRGL  178

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
            S+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  179  STVKRILIGSVSNYVVNNGTCPVTVVKSPE  208



>ref|XP_011005922.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Populus euphratica]
Length=162

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL  +GD   +I +    +D +R +L+  +G PL+PL+EFRE   
Sbjct  12   DYSSTSKAALRWAAENLIGEGDRIILIQVQPPKADHTRKQLFEGTGSPLVPLAEFREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQK-EITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
             K+Y +  + EVLD+LD  +R K +  VVAK+YWGD REKL D++EDLKLDSLVMGSRGL
Sbjct  72   SKQYGLTYDPEVLDILDIVSRTKGQAEVVAKVYWGDPREKLIDAVEDLKLDSLVMGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++R+++GSV+NYV+T A CP+TVVK
Sbjct  132  GAIKRVLLGSVSNYVVTNAPCPVTVVK  158



>ref|XP_002271154.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI27357.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D S +S+ AL+WA+DNL D  D   +I++ +  S+  + +L+  +G PL+PL EFR+  L
Sbjct  12   DNSANSKSALRWAVDNLIDAEDCLILIYVQSPKSEHPKKQLFEDTGSPLVPLEEFRDINL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT  R K   VVAK+YWGD REKLCD+++DLKLD LV+GSRGL 
Sbjct  72   SKQYGLNPDPEVLDILDTVARSKGAKVVAKVYWGDPREKLCDAVDDLKLDCLVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+RI++GSV+NYV+  A+CP+TVVK
Sbjct  132  VLRRILLGSVSNYVMVHASCPVTVVK  157



>ref|XP_011038407.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
 ref|XP_011038408.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=161

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL D+GD   +I +    +D +R +L+ ++G PL+PL EFRE   
Sbjct  12   DYSPTSKAALRWAAENLIDEGDRVILIQVQPPKADHTRKQLFEENGSPLVPLEEFREINY  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT ++ K   VVAK+YWGD REKL D+++DLKLDSLV+GSRGL 
Sbjct  72   SKQYGLTHDPEVLDILDTVSKTKGAKVVAKVYWGDPREKLLDAVDDLKLDSLVIGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+ YV+T A+CP+TVVK
Sbjct  132  AIKRVLLGSVSYYVVTNASCPVTVVK  157



>ref|XP_009381389.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ A++WA+DNL   GD   +IH+ + +   +  +LW + G PLIPL EF +  L
Sbjct  14   DYSPTSKVAVRWAVDNLVCAGDHVVLIHVLSKSDHHTEKQLWEEHGSPLIPLGEFEDMNL  73

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + EVLD+L TA+  K + VV+K+YWGD REK+CD++E+LKLDSLV+GSRGL 
Sbjct  74   TVRYGISPDGEVLDILHTASETKGVKVVSKIYWGDPREKICDAVEELKLDSLVVGSRGLG  133

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  134  AIKRVLLGSVSNYVVVHATCPVTVVK  159



>ref|XP_004487759.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=160

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS  S  ALKW +DN+A +GD   ++ I     +    +LW+ +G PL PL+EF +P L
Sbjct  12   DFSPCSIKALKWTLDNIAREGDHIILVIIRPEQYEHGEMQLWAVTGSPLTPLAEFSDPTL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             KKY +++N EV+++  +A  QK++ V+ K+YWGDAREKLC++IE + LDSL+MG+RGL 
Sbjct  72   FKKYGLESNSEVINIATSAANQKKVVVLVKIYWGDAREKLCEAIEHIPLDSLIMGNRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
            +++R+IMGSV+NY++  A+CP+TVVK  D
Sbjct  132  TIKRVIMGSVSNYIVNNASCPVTVVKSSD  160



>dbj|BAJ86638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ AL+WA+ NL  +GDT  ++H+  H  +E+++ +W++SG PLIPLSEFREPE+
Sbjct  18   DYSASSKRALEWAVKNLLRRGDTVVVLHVLRHGGEEAKHAVWAKSGSPLIPLSEFREPEV  77

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
            +K Y V  + EVLD+LDTA RQ E+ VVAKLYWGDAREKLCD++E+ K+D++VMGSRGL 
Sbjct  78   MKNYGVTCDAEVLDMLDTAARQLELKVVAKLYWGDAREKLCDAVEEQKIDTIVMGSRGLG  137

Query  362  SLQRIIMGSVTNYVLTT--ATCPI  427
             +QR    + T  V+T    TC I
Sbjct  138  LIQRY---NTTTAVVTMLLRTCAI  158



>gb|AFK43932.1| unknown [Lotus japonicus]
Length=172

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS + + AL+WA+DNL ++GD   II++    +D +R +L++++G PL+P+ E RE   
Sbjct  2    DFSPTCKLALRWAVDNLINRGDQIIIINVEPPNADHTRKELFAENGSPLVPMEELREINF  61

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EV+D+LDTA+R K    +AK+YWGD REKLC ++EDL LDSLV+GSRGL 
Sbjct  62   TKQYGIARDPEVIDILDTASRTKGAKAMAKVYWGDPREKLCSAVEDLHLDSLVVGSRGLG  121

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R++MGSV+ +V+T A+CP+TVVK
Sbjct  122  PIKRVLMGSVSKHVVTNASCPVTVVK  147



>gb|EYU41387.1| hypothetical protein MIMGU_mgv1a015186mg [Erythranthe guttata]
Length=165

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ ALKWAI +  + GD   +IH+ +  +D +  +L++ +G PLIPL EFRE  +
Sbjct  12   DYSATSKSALKWAIHDFVEDGDQIIMIHVASPKADPTNKQLFADTGSPLIPLEEFREMNV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  +  VLD+L T ++ K + VVAK+YWGD REKLC ++E LKLDSLV+GSRGL 
Sbjct  72   SKQYGLTPDSNVLDMLTTLSKTKRVKVVAKVYWGDPREKLCGAVEQLKLDSLVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  132  AIKRVLLGSVSNYVVQHATCPVTVVK  157



>gb|ACR38280.1| unknown [Zea mays]
Length=165

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +WA+DNL   GD   ++H+    +D S  +LW  +G PLIPLSEF E  L
Sbjct  13   DYSPSSKAAARWAVDNLIKAGDRLVLVHVLPKGADASHKELWKSTGSPLIPLSEFMEMNL  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + E L++L   ++ K++ V+AK+YWGDAREKLC++++DLK+DS V+G RGL 
Sbjct  73   QARYGLNPDKETLEILRAVSKSKQVEVLAKVYWGDAREKLCEAVDDLKVDSFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_003547361.1| PREDICTED: universal stress protein A-like protein-like [Glycine 
max]
 gb|KHN14685.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI-NTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL W +DN+  +GD   +I + N H  +    +LW  +G PLIPL+EF +P 
Sbjct  12   DFSACSIKALNWTVDNVVREGDNLILIIVRNAHGYEHGEMQLWETTGSPLIPLAEFSDPV  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            L+K+Y +K   EV+D++ TA +QK I V+ K+YWGDARE+LC++I+ + LD L +G+RGL
Sbjct  72   LMKRYELKPAPEVIDIVSTAAKQKNIVVLMKIYWGDARERLCEAIDHVPLDYLTLGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +LQR+IMGSV+NYV+  ATCP+TVVK
Sbjct  132  GTLQRVIMGSVSNYVVNNATCPVTVVK  158



>ref|XP_003570541.1| PREDICTED: uncharacterized protein C167.05-like [Brachypodium 
distachyon]
Length=166

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A KWA DNL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAAKWAFDNLVKAGDRIILIHVLPKGTDASHKGLWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + EVL++L   ++ K++ V+AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  73   QARYGVNPDKEVLEILQAESKSKQVEVLAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGP  160



>gb|KDP42177.1| hypothetical protein JCGZ_02907 [Jatropha curcas]
Length=193

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS+ S+ ALKWAI NL D+GDT ++IH+     DESRN LW  SG PLIPL EFR+ ++
Sbjct  12   DFSKGSKLALKWAISNLIDEGDTLFVIHVKPSQGDESRNLLWYNSGAPLIPLEEFRDEQV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             +KY +  + EVLDLLDTA+RQK++ V+AKLYWGDAR++LC +++DLKLD LVMGSRGL 
Sbjct  72   AQKYEINLDPEVLDLLDTASRQKQVIVLAKLYWGDARDRLCQAVDDLKLDCLVMGSRGLG  131

Query  362  SLQR  373
            ++QR
Sbjct  132  TIQR  135



>ref|XP_009780200.1| PREDICTED: uncharacterized protein C167.05 [Nicotiana sylvestris]
Length=162

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ ALKWAIDN+  KGD   ++ +      +E   +LW  +G PLIPLSEF +  
Sbjct  12   DFSACSKKALKWAIDNILRKGDHLILVTVRPEGHYEEGEMQLWEATGSPLIPLSEFCDAH  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
             +KKY V  + E LD++  A RQKEI VV K+YWGDAREKLC++I+   L  LV+G+RGL
Sbjct  72   TMKKYGVNPDPETLDMVTLAARQKEIMVVLKIYWGDAREKLCEAIDKTPLSCLVIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R IMGSV+NYV+  ATCP+TVVKH D
Sbjct  132  GKLKRAIMGSVSNYVVNNATCPVTVVKHAD  161



>ref|XP_002884367.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60626.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+WA +NL + GDT  +IH+    +D +R  L+  +G PL+PL EFRE  L
Sbjct  12   DYSPTSKLALRWAAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREINL  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|XP_002452902.1| hypothetical protein SORBIDRAFT_04g034630 [Sorghum bicolor]
 gb|EES05878.1| hypothetical protein SORBIDRAFT_04g034630 [Sorghum bicolor]
Length=165

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +WA+DNL   GD   ++H+    +D S  +LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAARWAVDNLLKAGDRIILVHVLPKGADASHKELWKSTGSPLIPLPEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + E+L++L  A++ K++ V+AK+YWGDAREKLC++++DLK++S V+G RGL 
Sbjct  73   QARYGLNPDKEILEILQAASKSKQVEVLAKIYWGDAREKLCEAVDDLKVNSFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGP  160



>gb|KJB34720.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
 gb|KJB34722.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
 gb|KJB34723.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
Length=162

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINT--HASDESRNKLWSQSGCPLIPLSEFREP  175
            DFS SS+ ALKWA+DN+  KGD   ++ +    H  +  + +LW  +G PLIPLSEF +P
Sbjct  12   DFSPSSKNALKWAVDNVIRKGDHLILVAVRPEGHYDEGDQIQLWEATGSPLIPLSEFCDP  71

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
             ++K+Y VK + E LD++ TA RQ +I V+ K+YWGD REKLC++I+ + L  +++G+RG
Sbjct  72   IIMKRYGVKPDPETLDIVTTAARQTQIEVLMKIYWGDPREKLCEAIDTIPLSCIIVGNRG  131

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKH  442
            L +L+R IMGSV+NYV+  A+CP+TVVKH
Sbjct  132  LGTLKRAIMGSVSNYVVNNASCPVTVVKH  160



>ref|NP_001132238.1| hypothetical protein [Zea mays]
 gb|ACF81008.1| unknown [Zea mays]
 gb|AFW73684.1| hypothetical protein ZEAMMB73_655044 [Zea mays]
Length=165

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +WA+DNL   GD   ++H+     D S  +LW  +G PLIPLSEF E  L
Sbjct  13   DYSPSSKAAARWAVDNLIKAGDRLVLVHVLPKGVDSSHKELWKTTGSPLIPLSEFMEMNL  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + E L++L   ++ K++ V+AK+YWGDAREKLC++++DLK+DS V+G RGL 
Sbjct  73   QARYGLNPDKETLEILRAVSKSKQVEVLAKVYWGDAREKLCEAVDDLKVDSFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGP  160



>gb|AGT02387.1| UspA-like protein [Calotropis procera]
Length=162

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL WAI+N+  K D   ++ I      +E   +LW  +G PLIPL+E  EP 
Sbjct  14   DFSPCSKKALNWAIENIVRKEDNLILVVIRPEGHYEEGEMQLWETTGSPLIPLAELSEPN  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY    + E LD+++TA RQKEI V+ K+YWGDAREKLC++++D+ LD +V+G+RGL
Sbjct  74   VMKKYGFVPDAETLDIVNTAARQKEIFVLMKIYWGDAREKLCEAVDDIPLDCIVLGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKH  442
              ++R IMGSV+NYV+  A+CP+TVVKH
Sbjct  134  GKIKRAIMGSVSNYVVNNASCPVTVVKH  161



>ref|XP_002323966.2| hypothetical protein POPTR_0017s01470g [Populus trichocarpa]
 gb|EEF04099.2| hypothetical protein POPTR_0017s01470g [Populus trichocarpa]
Length=161

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS +S+ AL+WA +NL D+GD   +I      +D +R +L+ ++G PL+PL EFRE   
Sbjct  12   DFSPTSKAALRWAAENLIDEGDRVILIQAQPPKADHTRKQLFEENGSPLVPLEEFREINY  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT ++ K   VVAK+YWGD REKL D+++DLKLDSLV+GSRGL 
Sbjct  72   SKQYGLTHDPEVLDILDTVSKTKGAKVVAKVYWGDPREKLIDAVDDLKLDSLVIGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++R+++GSV+ +V+T A+CP+TVVK
Sbjct  132  AIKRVLLGSVSYHVVTNASCPVTVVK  157



>ref|XP_003568882.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=171

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD+  ++H+      ++    LW  +G PLIPLSEF EP 
Sbjct  18   DFSEGSRAALRWAADNLLRAGDSLLLLHVLKDPDYEQGETLLWEATGSPLIPLSEFSEPA  77

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  +QKEITVV+K+ WGD REKLC +I D+ +  LV+GSRGL
Sbjct  78   IAKKYGVKPDAETLDMLNTIAKQKEITVVSKVLWGDPREKLCQAIHDIPMSCLVIGSRGL  137

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+++GSV+++V+  A CP+TVVK
Sbjct  138  GKLKRVLLGSVSDFVVNNAACPVTVVK  164



>ref|XP_007147360.1| hypothetical protein PHAVU_006G117600g [Phaseolus vulgaris]
 gb|ESW19354.1| hypothetical protein PHAVU_006G117600g [Phaseolus vulgaris]
Length=159

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDE-SRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL+W +DN+  +GD   +I +   A  E    +LW  +G PLIPLSEF EP 
Sbjct  12   DFSSCSIKALQWTVDNVVKEGDHLILIVVRQPAHYEHGEMQLWETTGSPLIPLSEFSEPA  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY+ K   EV+D++ TA RQK I V+ K++WGDAREKLCD++  + LDSL MG+RGL
Sbjct  72   VMKKYDFKPEPEVIDIVQTAARQKSIMVIMKIFWGDAREKLCDAVTQVPLDSLTMGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              LQR+IMGSV+N+V+  A+C +TVVK
Sbjct  132  GPLQRVIMGSVSNFVVNNASCTVTVVK  158



>gb|EMT31927.1| hypothetical protein F775_31141 [Aegilops tauschii]
Length=165

 Score =   168 bits (426),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A++W ++NL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAMRWVVENLVKAGDRIILIHVLPKGADASHKGLWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + EVL++L   ++ K++ ++AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  73   QARYGVNPDKEVLEILQAESKSKQVEILAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>ref|XP_007035783.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY06709.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=161

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS SS+ ALKW +DN+  KGD   ++ I    + +E   +LW  +G P IPLSEF +P 
Sbjct  12   DFSASSKNALKWTVDNVIRKGDHLILVTIRPEGNYEEGEMQLWEVTGSPFIPLSEFSDPV  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY +K + E LD+++TA RQKE+ V+ K++WGD REKLC++I+ + L  +++G+RGL
Sbjct  72   VMKKYGMKPDPETLDIVNTAARQKEVEVLMKIFWGDPREKLCEAIDTIPLSCIIVGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R IMGSV+NYV+   +CP+TVVKH D
Sbjct  132  GKLKRAIMGSVSNYVVNNGSCPVTVVKHHD  161



>ref|XP_006841013.1| hypothetical protein AMTR_s00085p00099740 [Amborella trichopoda]
 gb|ERN02688.1| hypothetical protein AMTR_s00085p00099740 [Amborella trichopoda]
Length=168

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 113/151 (75%), Gaps = 6/151 (4%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS---DESRNKLWSQSGCPLIPLSEFRE  172
            DFS  S+ A++WA +NL  +GD  ++I IN   S   ++   +LW  +G P IPLSEF +
Sbjct  11   DFSACSKSAIRWASENLVREGD--HLILINVQGSVYYEQGEMQLWETTGSPFIPLSEFSD  68

Query  173  PELLKKYNVKANMEVLDLLDTATRQKE-ITVVAKLYWGDAREKLCDSIEDLKLDSLVMGS  349
            P ++KKY V+ ++E LDLL+   RQK+ ITVV+K+YWGDAREK+C+++ED+ L SLV+G+
Sbjct  69   PNIMKKYGVQPDIETLDLLNCIARQKKGITVVSKIYWGDAREKICEAVEDIPLHSLVIGN  128

Query  350  RGLSSLQRIIMGSVTNYVLTTATCPITVVKH  442
            RGL  L+R ++GSV+NYV+  A+CP+TVVKH
Sbjct  129  RGLGKLKRALLGSVSNYVVNNASCPVTVVKH  159



>ref|XP_006408321.1| hypothetical protein EUTSA_v10021680mg [Eutrema salsugineum]
 gb|ESQ49774.1| hypothetical protein EUTSA_v10021680mg [Eutrema salsugineum]
Length=159

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL + GDT  +IH+    +D +R  L+ ++G PL+PL EFRE   
Sbjct  12   DYSPTSKSALRWTAENLLEDGDTVILIHVQPQNADHTRKILFEETGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++++LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVQNLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|XP_009630214.1| PREDICTED: uncharacterized protein C167.05 isoform X1 [Nicotiana 
tomentosiformis]
Length=162

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ ALKWAIDN+  KGD   ++ +      +E   +LW  +G PLIPLSE  +  
Sbjct  12   DFSACSKKALKWAIDNILRKGDHLILVTVRPEGHYEEGETQLWEATGSPLIPLSELCDAH  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
             +KKY V  + E LD++  A RQKEI VV K+YWGDAREKLC++I+   L  LV+G+RGL
Sbjct  72   TMKKYGVNPDPETLDMVTLAARQKEIMVVLKIYWGDAREKLCEAIDKTPLSCLVIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R IMGSV+NYV+  ATCP+TVVKH D
Sbjct  132  GKLKRAIMGSVSNYVVNNATCPVTVVKHAD  161



>ref|XP_007141947.1| hypothetical protein PHAVU_008G239500g [Phaseolus vulgaris]
 gb|ESW13941.1| hypothetical protein PHAVU_008G239500g [Phaseolus vulgaris]
Length=163

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS +S+ AL+WA++NL +KGD   +I++    +  +R +L+  +G PL+PL E RE   
Sbjct  12   DFSATSKLALRWAVENLINKGDQIILINVQPPHAHHTRKELFEVTGSPLVPLEELRELNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EV+D+LDTA++ K    VAK+YWGD REKLC+++EDL LDSLV+GSRGL 
Sbjct  72   AKQYGIPRDPEVIDILDTASKTKGAKAVAKVYWGDPREKLCNAVEDLHLDSLVIGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R+++GSV+ +V+T A+CP+TVVK
Sbjct  132  PIKRVLLGSVSKHVMTNASCPVTVVK  157



>ref|XP_004954077.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Setaria 
italica]
Length=165

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ + +WAIDNL   GD   ++H+    +D S  +LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKASARWAIDNLLKAGDRIILVHVIPKGADASHKELWKSTGSPLIPLPEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + E+L++L  A++ K++ V+AK+YWGDAREKLC++++DLK++S V+G RGL 
Sbjct  73   QARYGLVPDKEILEILQAASKAKQVEVLAKIYWGDAREKLCEAVDDLKVNSFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_004954078.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Setaria 
italica]
Length=164

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ + +WAIDNL   GD   ++H+    +D S  +LW  +G PLIPL EF E  +
Sbjct  12   DYSPSSKASARWAIDNLLKAGDRIILVHVIPKGADASHKELWKSTGSPLIPLPEFMEMNV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + E+L++L  A++ K++ V+AK+YWGDAREKLC++++DLK++S V+G RGL 
Sbjct  72   QARYGLVPDKEILEILQAASKAKQVEVLAKIYWGDAREKLCEAVDDLKVNSFVLGCRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  132  PLKRALLGSVSNYVVNNATCPVTVVRGP  159



>ref|NP_001048266.1| Os02g0773200 [Oryza sativa Japonica Group]
 dbj|BAD16874.1| universal stress protein / early nodulin ENOD18-like [Oryza sativa 
Japonica Group]
 dbj|BAF10180.1| Os02g0773200 [Oryza sativa Japonica Group]
 gb|EAZ24778.1| hypothetical protein OsJ_08554 [Oryza sativa Japonica Group]
 dbj|BAG98422.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A KWA+DNL   GD   ++H+    +D S  +LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAAKWAVDNLVKAGDRIILVHVLPKGADASHKELWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + EVL++L   ++ K++ V+AK+YWGDAREKLC++++DLK+++ V+G RGL 
Sbjct  73   QARYGINPDKEVLEILQAESKSKQVEVLAKVYWGDAREKLCEAVDDLKVNTFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRAP  160



>gb|EEC74090.1| hypothetical protein OsI_09119 [Oryza sativa Indica Group]
Length=165

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A KWA+DNL   GD   ++H+    +D S  +LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAAKWAVDNLVKAGDRIILVHVLPKGADASHKELWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + EVL++L   ++ K++ V+AK+YWGDAREKLC++++DLK+++ V+G RGL 
Sbjct  73   QARYGINPDKEVLEILQAESKSKQVEVLAKVYWGDAREKLCEAVDDLKVNTFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRAP  160



>emb|CDY50688.1| BnaC05g47950D [Brassica napus]
Length=159

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL D GDT  +IH+    ++ +R  L+ ++G PLIPL EFRE   
Sbjct  12   DYSPTSKSALRWTAENLLDDGDTIILIHVQPQNAEHTRKILFEETGSPLIPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  PLKRMLLGSVSNHVVTNATCPVTVVK  157



>gb|KHG02877.1| hypothetical protein F383_26329 [Gossypium arboreum]
Length=162

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINT--HASDESRNKLWSQSGCPLIPLSEFREP  175
            DFS SS+ ALKWA+DN+  KGD   ++ +    H  +  + +LW  +G PLIPLSEF +P
Sbjct  12   DFSPSSKNALKWAVDNVIRKGDHLILVAVRPEGHYDEGDQIQLWEATGSPLIPLSEFCDP  71

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
             ++K+Y VK + E LD++ TA RQ +I V+ K+YWGD REKLC++I+ + L  +++G+RG
Sbjct  72   IIMKRYGVKPDPETLDIVTTAARQTQIEVLMKIYWGDPREKLCEAIDTIPLSCIIVGNRG  131

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKH  442
            L +L+R IMGSV+NYV+   +CP+TVVKH
Sbjct  132  LGTLKRAIMGSVSNYVVNNGSCPVTVVKH  160



>ref|XP_009370564.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=175

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHIN-THASDESRNKLWSQSGCPLIPLSEFREPE  178
            D+S +S+ AL+WA+DNL ++GD   +IH+  T A+  SR +L+  +G PLIPL E  E  
Sbjct  12   DYSATSKLALRWAVDNLIEQGDRIVLIHVEPTTAATTSRKQLFENTGSPLIPLEELVETN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + K+Y +  + EVLD+LD  ++ K    VAK+YWGD REKLCD+++DLKLDSLV+GSRGL
Sbjct  72   VSKQYGLTNDPEVLDILDKVSKTKGAKAVAKVYWGDPREKLCDAVQDLKLDSLVVGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK----HPDFHK  457
              ++R+++GSV+ YV+T A+CP+TVVK    HP+ HK
Sbjct  132  GPIKRVLLGSVSIYVVTNASCPVTVVKGSRNHPN-HK  167



>ref|XP_010508189.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=158

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL D GDT  +IH+    +D +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKLALRWTAENLLDDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRMLLGSVSNHVVTNATCPVTVVK  157



>ref|XP_003616191.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|AES99149.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
 gb|AFK40246.1| unknown [Medicago truncatula]
Length=166

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS +S+ AL+WA+DNL +K D   +I++   ++D +R +L+  +G PL+PL E RE   
Sbjct  12   DFSPTSKLALRWAVDNLINKNDQIIMINVQPPSADHTRKELFEDTGSPLVPLEELREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EV+D+L+TA++ K   VVAK+YWGD REKLC+++EDL LDSLV+GSRGL 
Sbjct  72   TKQYGIAKDPEVIDILETASKIKGAKVVAKVYWGDPREKLCNAVEDLHLDSLVIGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            +++ +++GSV+ +V+T A+CP+TVVK
Sbjct  132  TIKSVLLGSVSKHVVTNASCPVTVVK  157



>gb|KDP35746.1| hypothetical protein JCGZ_10518 [Jatropha curcas]
Length=166

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKG-DTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            D+S +S+ AL+WA +NL D   DT  +I +    +D +R  L+  +G PL+PL EFRE  
Sbjct  12   DYSATSKAALRWATENLIDNASDTLILIQVQPPNADHTRKHLFGDTGSPLVPLEEFREIN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
              K+Y +  + EVLD+LDT ++ K   VVAK+YWGD REKLCD+++ LKLDSLV+GSRGL
Sbjct  72   YSKQYGLSRDPEVLDILDTVSKTKGAKVVAKVYWGDPREKLCDAVDHLKLDSLVIGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             S++RI++GSV+N+V+  A+CP+TVVK
Sbjct  132  GSIKRILLGSVSNHVVANASCPVTVVK  158



>ref|XP_010064666.1| PREDICTED: uncharacterized protein C167.05 [Eucalyptus grandis]
 gb|KCW87966.1| hypothetical protein EUGRSUZ_A00373 [Eucalyptus grandis]
Length=164

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  ALKWA+DN+A  GD   +I +    + +E   +LW  +G PLIPLSEF +P 
Sbjct  12   DFSPCSHKALKWAVDNVARNGDHLILITVRPEGNYEEGEMQLWEATGSPLIPLSEFSDPV  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E +D++ T  RQKE+ VV K+YWGDAREK+C++I+   L  L++G+RGL
Sbjct  72   IMKKYGVKVDPETIDIVSTIARQKEVVVVMKIYWGDAREKICEAIDKFPLSCLIIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R I+GSV+NYV+   +CP+TVVK
Sbjct  132  GKLKRAILGSVSNYVVNNGSCPVTVVK  158



>ref|XP_008797442.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=212

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHA-SDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL+WA++N+   GD   +I++      +E   +LW  +G PLIPL+EF +P 
Sbjct  59   DFSACSKAALRWAVENVVRPGDHLILINVQKEVLYEEGEMQLWEATGSPLIPLAEFSDPG  118

Query  179  LLKKYNVKANMEVLDLLDTATRQKE-ITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
            + KKY VK + E LD+L+T  RQKE I V+ K+YWGDAREK+C++IE + L  LV+G RG
Sbjct  119  VAKKYGVKPDAETLDILNTVARQKEQIVVIMKIYWGDAREKICEAIESIPLSCLVIGKRG  178

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
            LS+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  179  LSTVKRILIGSVSNYVVNNGTCPVTVVKSPE  209



>ref|XP_006654074.1| PREDICTED: universal stress protein A-like protein-like [Oryza 
brachyantha]
Length=164

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S GAL+WA DNL   GD   ++H+      ++    LW  +G PLIPLS+F EP 
Sbjct  14   DFSEGSRGALQWAADNLLRAGDHLVLLHVLKDPDYEQGETLLWEATGSPLIPLSDFSEPT  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY  K + E LD+L+T  RQKE+ VV K+ WGD REKLC +I ++ +  LV+GSRGL
Sbjct  74   IAKKYGAKPDAETLDMLNTVARQKEVVVVFKVLWGDPREKLCQAINEIPMKCLVIGSRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R+++GSV++YV+  ATCP+TVVK  D
Sbjct  134  GKLKRVLLGSVSDYVVNNATCPVTVVKSAD  163



>ref|XP_010931741.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=165

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHA-SDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL+WA++N+   GD   +I++      +E   +LW  +G PLIPL E  +P 
Sbjct  13   DFSVCSKAALRWAVENIVRPGDHLILINVQKEVLYEEGEMQLWEATGSPLIPLVELSDPG  72

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  RQKEI VV K+YWGDAREK+C++IE++ L  L++G+RGL
Sbjct  73   IAKKYGVKPDAETLDILNTVARQKEIVVVMKIYWGDAREKICEAIENIPLCCLIIGNRGL  132

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
            S ++R+++GSV+NYV+   TCP+TVVK
Sbjct  133  SKIKRVLLGSVSNYVVNNGTCPVTVVK  159



>ref|XP_004137750.1| PREDICTED: uncharacterized protein C167.05-like isoform 1 [Cucumis 
sativus]
Length=176

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  146  LIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLK  325
            LIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLK
Sbjct  72   LIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLK  131

Query  326  LDSLVMGSRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            LDSLVMGSRGLS+++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  132  LDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  176



>ref|XP_004163857.1| PREDICTED: uncharacterized protein C167.05-like isoform 1 [Cucumis 
sativus]
Length=185

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  146  LIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLK  325
            LIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLK
Sbjct  81   LIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLK  140

Query  326  LDSLVMGSRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  460
            LDSLVMGSRGLS+++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  141  LDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  185



>gb|EPS64036.1| hypothetical protein M569_10742 [Genlisea aurea]
Length=161

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDES-RNKLWSQSGCPLIPLSEFREPE  178
            DFS  S  AL WA+DNL   GD   ++++ +    ES   +LW  +G PLIPLSE  +P 
Sbjct  12   DFSPFSRKALNWALDNLVRDGDHLILVNVTSDGYYESGERQLWEATGSPLIPLSELTDPH  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY V  + E LDL+ T  RQKEITVV K++WGD REKLC++++ + LD LV+G+RGL
Sbjct  72   VMKKYEVNPDPETLDLVSTVARQKEITVVLKIFWGDPREKLCEAVDAIPLDCLVVGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              ++R IMGSV+NYV+  ATCP+TVVK  D
Sbjct  132  GKIKRAIMGSVSNYVVNNATCPVTVVKAHD  161



>gb|KHN39491.1| Universal stress protein A-like protein [Glycine soja]
Length=166

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS +S+ AL+WA+DNL +KGD   +I +    +  +R +L+  +G PL+PL E RE   
Sbjct  12   DFSPTSKLALRWAVDNLINKGDQIILITVQPPQAHHTRKELFEDTGSPLVPLEELRELNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EV+ +LDTA++ K    VAK+YWGD REKLC+++EDL LDSLV+GSRGL 
Sbjct  72   TKQYGIARDPEVIGILDTASKTKGAKAVAKVYWGDPREKLCNAVEDLHLDSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             ++R+++GSV+ +V+T A+CP+TVVK
Sbjct  132  PIKRVLLGSVSKHVMTNASCPVTVVK  157



>gb|EEC78561.1| hypothetical protein OsI_18538 [Oryza sativa Indica Group]
Length=169

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S GAL+WA DNL   GD   ++H+      ++    LW  +G PLIPLS+F EP 
Sbjct  19   DFSEGSRGALRWAADNLLRAGDHLILLHVLKDPDYEQGETLLWEATGSPLIPLSDFSEPT  78

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY  K + E LD+L+T  RQKE+ VV K+ WGD REKLC +I ++ +  LV+GSRGL
Sbjct  79   IAKKYGAKPDAETLDMLNTVARQKEVVVVFKVLWGDPREKLCQAINEIPMSCLVIGSRGL  138

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R+++GSV++YV+  ATCP+TVVK  D
Sbjct  139  GKLKRVLLGSVSDYVVNNATCPVTVVKTAD  168



>ref|XP_006647984.1| PREDICTED: uncharacterized protein C167.05-like [Oryza brachyantha]
Length=165

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A KWA+DNL   GD   +IH+    +D S  +LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAAAKWAVDNLVKAGDRIILIHVLPKRADASHKELWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y +  + EVL++L   ++ KE+ V+AK+YWGDAREKLC++++DLKL++ V+G RGL 
Sbjct  73   QARYGINPDREVLEILQDESKSKEVEVLAKVYWGDAREKLCEAVDDLKLNTFVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R ++G V+NYV+  A+CP+TVV+ P
Sbjct  133  PLKRTLLGGVSNYVVNNASCPVTVVRGP  160



>emb|CDY43136.1| BnaA05g32500D [Brassica napus]
Length=159

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL D GDT  +IH+    ++ +R  L+ ++G PLIPL EFRE   
Sbjct  12   DYSPTSKSALRWTAENLLDDGDTIILIHVQPQNAEHTRKILFEETGSPLIPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVL++LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLNVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  PLKRMLLGSVSNHVVTNATCPVTVVK  157



>ref|XP_009146047.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX92110.1| BnaA05g22970D [Brassica napus]
Length=163

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S+ AL WAIDN+   GD   +I +  + + +E   +LW   G PLIPLSE  E  
Sbjct  14   DFSECSKKALNWAIDNVVRDGDYLILITVAPNMNYEEGEMQLWETVGSPLIPLSEVSEAS  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E LD+ +TA RQK ITVV K+YWGD REK+C+++E + L SLV+G+RGL
Sbjct  74   VMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGDPREKICEAVEHIPLSSLVIGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+IMGSV+N+V+    CP+TVVK
Sbjct  134  GGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_009367132.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=165

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEF-REPE  178
            D+S +S+ AL+WA+DNL ++GD   +IH+    +  SR +L+  SG PLIPL E   E  
Sbjct  12   DYSATSKLALRWAVDNLIEEGDRIVLIHVEPPKAATSRKQLFENSGSPLIPLEELVLETN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + K+Y +  + EVLD+LD  +R K   VVAK+YWGDA EKLCD++ DLKLDSLV+GSRGL
Sbjct  72   VSKQYGLTNDPEVLDILDKVSRSKGAKVVAKVYWGDAGEKLCDAVLDLKLDSLVVGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  457
              ++R+++GSV+NYV+T A+CP+TVVK     K
Sbjct  132  GLIKRVLLGSVSNYVVTNASCPVTVVKGAQSSK  164



>ref|XP_006298706.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
 gb|EOA31604.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
Length=159

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL + GDT  +IH+    +D +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKLALRWTAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRMLLGSVSNHVVTNATCPVTVVK  157



>ref|XP_008381381.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=165

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEF-REPE  178
            D+S +S+ AL+WA+DNL ++GD   +IH+    +  SR +L+  SG PLIPL E   E  
Sbjct  12   DYSATSKLALRWAVDNLIEEGDRIVLIHVEXPKAATSRKQLFENSGSPLIPLEELVLETN  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + K+Y +  + EVLD+LD  +R K   VVAK+YWGDA EKLCD++ DLKLDSLV+GSRGL
Sbjct  72   VSKQYGLTNDPEVLDILDKVSRSKGAKVVAKVYWGDAGEKLCDAVLDLKLDSLVVGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              ++R+++GSV+NYV+T A+CP+TVVK
Sbjct  132  GLIKRVLLGSVSNYVVTNASCPVTVVK  158



>gb|EYU29653.1| hypothetical protein MIMGU_mgv1a015303mg [Erythranthe guttata]
Length=161

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRN-KLWSQSGCPLIPLSEFREPE  178
            DFS  S  ALKWAIDNL   GD   ++ +      ES   +LW  +G PLIPLS+     
Sbjct  12   DFSPCSRKALKWAIDNLTRSGDHLILVTVRPEGYYESGEMQLWEATGSPLIPLSDLTNAH  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY +  + E LD++ TA  QKEITV+ K+YWGDAREKLC+SI+++ LDSLV+G+RGL
Sbjct  72   IMKKYGLTPDPETLDMVSTAASQKEITVLMKIYWGDAREKLCESIDNVPLDSLVIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              ++R IMGSV+N+V+  ATCP+TVVK  D
Sbjct  132  GKIKRAIMGSVSNFVVNNATCPVTVVKSHD  161



>gb|KFK37768.1| hypothetical protein AALP_AA3G027100 [Arabis alpina]
Length=159

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL   GDT  +IH+    +D +R  L+ ++G PL+PL EFRE   
Sbjct  12   DYSPTSKSALRWTAENLLADGDTVILIHVQPQNADHTRKILFEETGSPLVPLEEFRELNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDTEVLDVLDTLSRTKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  PLKRMLLGSVSNHVVTNATCPVTVVK  157



>ref|NP_001288857.1| universal stress protein A-like protein [Brassica rapa]
 gb|ABV89642.1| universal stress protein family protein [Brassica rapa]
Length=159

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S  AL+W  +NL D GDT  +IH+    ++ +R  L+ ++G PLIPL EFRE   
Sbjct  12   DYSPTSRSALRWTAENLLDDGDTIILIHVQPQNAEHTRKILFEETGSPLIPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVL++LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLNVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  PLKRMLLGSVSNHVVTNATCPVTVVK  157



>dbj|BAJ92234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +W ++NL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAATRWVVENLVKAGDRIILIHVLPKGADASHKGLWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + +VL++L   ++ K++ ++AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  73   QARYGVNPDKDVLEILQAESKSKQVEILAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>emb|CDX75899.1| BnaC03g39820D [Brassica napus]
Length=163

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI-NTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S+ AL WAIDN+   GD   +I + +    +E   +LW   G PLIPLSEF E  
Sbjct  14   DFSECSKKALNWAIDNVVRDGDHLILITVAHDMHYEEGEMQLWETVGSPLIPLSEFSEAA  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E LD+ +TA R+K ITVV K+YWGD REK+C+++E + L SLV+G+RGL
Sbjct  74   VMKKYAVKPDAETLDIANTAARKKSITVVMKIYWGDPREKICEAVEHIPLSSLVIGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+IMGSV+N+V+    CP+TVVK
Sbjct  134  GGLKRMIMGSVSNHVVNNVACPVTVVK  160



>gb|ADB54804.1| universal stress protein 7364 [Hordeum vulgare subsp. vulgare]
Length=162

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +W ++NL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  10   DYSPSSKAATRWVVENLVKAGDRIILIHVLPKGADASHKGLWKSTGSPLIPLLEFMEMNV  69

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + +VL++L   ++ K++ ++AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  70   QARYGVNPDKDVLEILQAESKSKQVEILAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  129

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  130  PLKRALLGSVSNYVVNNATCPVTVVRGPN  158



>gb|EMT05701.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=166

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD   ++H+      ++    LW  SG PLIPLSEF  P 
Sbjct  14   DFSEGSRAALQWAADNLLRAGDNLLLLHVLKDPDYEQGETLLWEASGSPLIPLSEFSHPS  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  +QKE+ VV+K+ +GD REKLC +I D+ + SLV+GSRGL
Sbjct  74   IAKKYGVKPDAETLDMLNTIAKQKEVAVVSKVLFGDPREKLCQAIHDMPISSLVIGSRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
              L+R+++GSV++YV+  A CP+TVVK    H
Sbjct  134  GKLKRVLLGSVSDYVVNNAACPVTVVKPASNH  165



>ref|NP_001288846.1| universal stress protein A-like protein [Brassica rapa]
 gb|ABL97971.1| unknown [Brassica rapa]
 emb|CDY34988.1| BnaA01g27460D [Brassica napus]
Length=163

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI--NTHASDESRNKLWSQSGCPLIPLSEFREP  175
            DFSE S+ AL WAI+N+A  GD   +I +  + H  D    +LW   G PLIPLSEF E 
Sbjct  14   DFSECSKKALNWAIENVARDGDYLILITVAHDMHYED-GEMQLWETVGSPLIPLSEFSEA  72

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
             ++KKY VK + E LD+ +TA RQK ITVV K+YWGD REK+C++ E + L SLV+G+RG
Sbjct  73   AVMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGDPREKICEAAEHIPLSSLVIGNRG  132

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVK  439
            L  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  133  LGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>dbj|BAJ86930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +W ++NL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAATRWVVENLVKAGDRIILIHVLPKGADASHKGLWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + +VL++L    + K++ ++AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  73   QARYGVNPDKDVLEILQAEPKSKQVEILAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  133  PLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>emb|CDX82383.1| BnaA03g34380D [Brassica napus]
Length=163

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI-NTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S+ AL WAIDN+   GD   +I + +    +E   +LW   G PLIPLSEF E  
Sbjct  14   DFSECSKKALNWAIDNVVRDGDNLILITVAHDMHYEEGEMQLWETVGSPLIPLSEFSEAA  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E LD+ +TA R K ITVV K+YWGD REK+C+++E + L SLV+G+RGL
Sbjct  74   VMKKYAVKPDAETLDIANTAARTKSITVVMKIYWGDPREKICEAVEHIPLSSLVIGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+IMGSV+N+V+    CP+TVVK
Sbjct  134  GGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|NP_001054704.1| Os05g0157200 [Oryza sativa Japonica Group]
 gb|AAS55767.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16618.1| Os05g0157200 [Oryza sativa Japonica Group]
 dbj|BAG89670.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62397.1| hypothetical protein OsJ_17188 [Oryza sativa Japonica Group]
Length=167

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD   ++H+      ++    LW  +G PLIPLS+F EP 
Sbjct  17   DFSEGSRAALRWAADNLLRAGDHLILLHVLKDPDYEQGETLLWEATGSPLIPLSDFSEPT  76

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY  K + E LD+L+T  RQKE+ VV K+ WGD REKLC +I ++ +  LV+GSRGL
Sbjct  77   IAKKYGAKPDAETLDMLNTVARQKEVVVVFKVLWGDPREKLCQAINEIPMSCLVIGSRGL  136

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
              L+R+++GSV++YV+  ATCP+TVVK  D
Sbjct  137  GKLKRVLLGSVSDYVVNNATCPVTVVKTAD  166



>gb|AAQ02914.1|AF396464_1 C2.6 protein [Pisum sativum]
Length=164

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 11/151 (7%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLS-----EF  166
            DFS+SS+ ALKWA++NLAD GD        T ++      + SQS    I  S       
Sbjct  12   DFSKSSKNALKWALENLADNGDNI------TSSTSAKIPLMISQSAMVQIWFSFDSFERV  65

Query  167  REPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMG  346
            + PE++ KY V+ ++EVLDLLDT +RQKE+ VV K+YWGDAREKL D++EDLKLDSLVMG
Sbjct  66   QRPEIMNKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWGDAREKLLDAVEDLKLDSLVMG  125

Query  347  SRGLSSLQRIIMGSVTNYVLTTATCPITVVK  439
            SRGLS++QRI++GSV+N+V+  A CP+T+VK
Sbjct  126  SRGLSTIQRILLGSVSNFVMANAPCPVTIVK  156



>gb|AAX13276.1| USP family protein [Triticum aestivum]
 gb|EMS58495.1| Universal stress protein A-like protein [Triticum urartu]
Length=166

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD   ++H+      ++    LW  SG PLIPLSEF  P 
Sbjct  14   DFSEGSRAALQWAADNLLRSGDNLLLLHVLKDPDYEQGETLLWEASGSPLIPLSEFSHPS  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
              KKY VK + E LD+L+T  +QKE++VV+K+ +GD REKLC +I D+ + SLV+GSRGL
Sbjct  74   TAKKYGVKPDAETLDMLNTIAKQKEVSVVSKVLFGDPREKLCQAIHDMPISSLVIGSRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
              L+R+++GSV++YV+  A CP+TVVK    H
Sbjct  134  GKLKRVLLGSVSDYVVNNAACPVTVVKPASNH  165



>ref|XP_010463777.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=158

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL + GDT  +IH+    +D +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKLALRWTAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++E+LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
             L+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  PLKRMLLGSVSNHVVTNATCPVTVVK  157



>gb|KEH28228.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=167

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            DFS +S+ AL+WA+DNL +K D   +I++   ++D +R +L+  +G PL+PL E RE   
Sbjct  12   DFSPTSKLALRWAVDNLINKNDQIIMINVQPPSADHTRKELFEDTGSPLVPLEELREINF  71

Query  182  LKKYNVKANMEVLDLLDTATRQK-EITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
             K+Y +  + EV+D+L+TA++ K +  VVAK+YWGD REKLC+++EDL LDSLV+GSRGL
Sbjct  72   TKQYGIAKDPEVIDILETASKIKGQAKVVAKVYWGDPREKLCNAVEDLHLDSLVIGSRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
             +++ +++GSV+ +V+T A+CP+TVVK
Sbjct  132  GTIKSVLLGSVSKHVVTNASCPVTVVK  158



>gb|ABY84682.1| universal stress protein 2 [Gossypium arboreum]
 gb|ACA51839.1| universal stress protein 2 [Gossypium arboreum]
Length=169

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 102/158 (65%), Gaps = 34/158 (22%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSG--------------  139
            DFS+ S+ ALKW IDNL DKGDT Y+IH+  + SDESRN LWS SG              
Sbjct  12   DFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQSDESRNLLWSTSGSRKSLPYSTSVFDQ  71

Query  140  --------------------CPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEIT  259
                                  LIPLSEFRE E++K Y V+ + EVLDL+DTA+RQKE+ 
Sbjct  72   VLKLWVIGILTIFDLGDLLFVALIPLSEFREKEVMKHYEVEPDPEVLDLVDTASRQKEVN  131

Query  260  VVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLSSLQR  373
            +V K+YWGDAR+K+C+S+ DLKLD LVMGSRGL ++QR
Sbjct  132  IVTKIYWGDARDKICESVADLKLDCLVMGSRGLGTIQR  169



>gb|AID16043.1| putative universal stress protein [Catharanthus roseus]
Length=167

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W IDNL ++GD   +IH+ +   D +  +L+  +G PLIPL EFRE  +
Sbjct  12   DYSTTSKSALRWVIDNLIEEGDLLIVIHVVSSKVDTTNKQLFEDTGSPLIPLEEFREINV  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLC++++ LKL+SLV+GSRGL 
Sbjct  72   SKHYGLTPDPEVLDMLDTVSRNKKVKVVAKVYWGDPREKLCEAVDHLKLNSLVVGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHP  445
             L+R+++GSV+NYV+  ATCP+TVVK P
Sbjct  132  VLKRVLLGSVSNYVVQNATCPVTVVKGP  159



>ref|XP_002885183.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61442.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI-NTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S+ AL WAIDN+   GD   +I I N    +E   +LW   G P IPLSEF +  
Sbjct  14   DFSECSKKALSWAIDNVVRDGDHLILITIANDMNYEEGEMQLWETVGSPFIPLSEFSDAA  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E LD+++TA R+K +TVV K+YWGD REK+C + E + L SLVMG+RGL
Sbjct  74   VMKKYAVKPDAETLDIVNTAARKKTVTVVMKIYWGDPREKICAAAEQIPLSSLVMGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+IMGSV+N+V+    CP+TVVK
Sbjct  134  GGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_009135511.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
Length=163

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI-NTHASDESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S+ AL WAIDN+   GD   +I + +    +E   +LW   G PLIPLSEF E  
Sbjct  14   DFSECSKKALNWAIDNVVRDGDHLILITVAHDMHYEEGEMQLWETVGSPLIPLSEFSEAA  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY VK + E LD+ +TA R K ITVV K+YWGD REK+C+++E + L SLV+G+RGL
Sbjct  74   VMKKYAVKPDAETLDIANTAARTKSITVVMKIYWGDPREKICEAVEHIPLASLVIGNRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVK  439
              L+R+IMGSV+N+V+    CP+TVVK
Sbjct  134  GGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_010485662.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=158

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S +S+ AL+W  +NL + GDT  +IH+    +D +R  L+  +G PL+PL EFRE   
Sbjct  12   DYSPTSKLALRWTAENLLEDGDTVILIHVEPQNADHTRKILFEDTGSPLVPLEEFREVNF  71

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
             K+Y +  + EVLD+LDT +R K++ VVAK+YWGD REKLCD++++LKLDS+V+GSRGL 
Sbjct  72   SKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVDNLKLDSIVLGSRGLG  131

Query  362  SLQRIIMGSVTNYVLTTATCPITVVK  439
            SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  132  SLKRMLLGSVSNHVVTNATCPVTVVK  157



>gb|ADB54803.1| universal stress protein 7364 [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHASDESRNKLWSQSGCPLIPLSEFREPEL  181
            D+S SS+ A +W I+NL   GD   +IH+    +D S   LW  +G PLIPL EF E  +
Sbjct  13   DYSPSSKAATRWEIENLVKAGDRIILIHVLPKGADASHKGLWKSTGSPLIPLLEFMEMNV  72

Query  182  LKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGLS  361
              +Y V  + +VL++L   ++ K++ ++AK+YWGDAREKLC++++DLK+DS+V+G RGL 
Sbjct  73   QARYGVNPDKDVLEILQAESKSKQVEILAKIYWGDAREKLCEAVDDLKVDSVVLGCRGLG  132

Query  362  SLQRIIMGSVTNYVLTTATCPITVVKHPD  448
             L+R ++GSV+NYV+  A CP+TVV+ P+
Sbjct  133  PLKRALLGSVSNYVVNNAACPVTVVRGPN  161



>ref|XP_008797478.1| PREDICTED: uncharacterized protein LOC103712673 [Phoenix dactylifera]
Length=554

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHA-SDESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL+WA++N+   GD   +I++      +E   +LW  +G PLIPL+EF +P 
Sbjct  241  DFSACSKAALRWAVENVVRPGDHLILINVQKEVLYEEGEMQLWEATGSPLIPLAEFSDPG  300

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  RQKEI V+ K+YWGDAREK+C++IE + L  LV+G RGL
Sbjct  301  VAKKYGVKPDAETLDILNTVARQKEIVVIMKIYWGDAREKICEAIESIPLSCLVIGKRGL  360

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPD  448
            S+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  361  STVKRILIGSVSNYVVNNGTCPVTVVKSPE  390



>dbj|BAG74754.1| universal stress protein [Hordeum bulbosum]
Length=166

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD   ++H+      ++    LW  SG PLIPLSEF  P 
Sbjct  14   DFSEGSRAALQWAADNLLRSGDNLLLLHVLKDPDYEQGETLLWEASGSPLIPLSEFSHPS  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  +QKE++VV+K+ +GD REKLC +I D+ +  LV+GSRGL
Sbjct  74   VAKKYGVKPDAETLDMLNTIAKQKEVSVVSKVLFGDPREKLCQAIHDMPISCLVIGSRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
              L+R+++GSV++YV+  A CP+TVVK    H
Sbjct  134  GKLKRVLLGSVSDYVVNNAACPVTVVKPASTH  165



>ref|XP_006419393.1| hypothetical protein CICLE_v10006081mg [Citrus clementina]
 ref|XP_006488847.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR32633.1| hypothetical protein CICLE_v10006081mg [Citrus clementina]
Length=164

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFS  S+ AL+WA DN+   GD   ++ I      ++   +LW  SG PLIPL+EF EP 
Sbjct  12   DFSACSKKALQWAADNVVRNGDHLILVTIVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPT  71

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            ++KKY  K + E LD+++T  RQK+I VV K++WGD REK+C++I+ + L  LV+G+RGL
Sbjct  72   IMKKYGAKPDAETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGL  131

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKH  442
              L+R IMGSV+NYV+   +CP+TVVK 
Sbjct  132  GKLKRAIMGSVSNYVVNNGSCPVTVVKQ  159



>emb|CDY52729.1| BnaC01g44140D [Brassica napus]
Length=163

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHI--NTHASDESRNKLWSQSGCPLIPLSEFREP  175
            DFSE S+ AL WAI+N+   GD   +I +  + H  D    +LW   G PLIPLSEF E 
Sbjct  14   DFSECSKKALNWAIENVVRDGDYLILITVAHDMHYED-GEMQLWETVGSPLIPLSEFSEA  72

Query  176  ELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRG  355
             ++KKY VK + E LD+ +TA RQK ITVV K+YWGD REK+C++ E + L SLV+G+RG
Sbjct  73   AVMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGDPREKICEAAEHIPLSSLVIGNRG  132

Query  356  LSSLQRIIMGSVTNYVLTTATCPITVVK  439
            L  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  133  LGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>gb|ADB54802.1| universal stress protein 3739 [Hordeum vulgare subsp. vulgare]
 dbj|BAK03162.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=166

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    DFSESSEGALKWAIDNLADKGDTFYIIHINTHAS-DESRNKLWSQSGCPLIPLSEFREPE  178
            DFSE S  AL+WA DNL   GD   ++H+      ++    LW  SG PLIPLSEF  P 
Sbjct  14   DFSEGSRAALQWAADNLLRSGDNLLLLHVLKDPDYEQGETLLWEASGSPLIPLSEFSHPS  73

Query  179  LLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSLVMGSRGL  358
            + KKY VK + E LD+L+T  +QKE+ VV+K+ +GD REKLC +I D+ +  LV+GSRGL
Sbjct  74   VAKKYGVKPDAETLDMLNTIAKQKEVAVVSKVLFGDPREKLCQAIHDMPISCLVIGSRGL  133

Query  359  SSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  454
              L+R+++GSV++YV+  A CP+TVVK    H
Sbjct  134  GKLKRVLLGSVSDYVVNNAACPVTVVKPASTH  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090