BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006C06 332 bp,:Filtered

Length=332
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46304.1|  cysteine proteinase precursor                          183   1e-52   Ipomoea nil [qian niu]
gb|AAK48495.1|AF259983_1  putative cysteine protease                    137   6e-36   Ipomoea batatas [batate]
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                135   7e-35   Phoenix dactylifera
ref|NP_001183396.1|  uncharacterized protein LOC100501813               131   1e-34   Zea mays [maize]
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                133   2e-34   Setaria italica
ref|NP_001149658.1|  cysteine protease 1 precursor                      133   2e-34   Zea mays [maize]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    133   2e-34   Sesamum indicum [beniseed]
emb|CAQ00105.1|  papain-like cysteine proteinase                        133   2e-34   Hordeum vulgare subsp. vulgare [barley]
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                133   2e-34   Zea mays [maize]
gb|EMS56635.1|  Oryzain alpha chain                                     133   3e-34   Triticum urartu
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like                133   3e-34   Brachypodium distachyon [annual false brome]
dbj|BAF02546.1|  triticain alpha                                        133   3e-34   Triticum aestivum [Canadian hard winter wheat]
gb|EMT10408.1|  Oryzain alpha chain                                     133   3e-34   Aegilops tauschii
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                132   5e-34   Elaeis guineensis
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like                132   6e-34   Elaeis guineensis
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                132   7e-34   Phoenix dactylifera
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 131   9e-34   
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          131   9e-34   Tarenaya hassleriana [spider flower]
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg                131   1e-33   Erythranthe guttata [common monkey flower]
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    131   1e-33   
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                131   1e-33   Elaeis guineensis
gb|ABR19827.1|  cysteine proteinase                                     131   1e-33   Elaeis guineensis
dbj|BAG92753.1|  unnamed protein product                                128   1e-33   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          131   1e-33   Zea mays [maize]
ref|NP_001148706.1|  cysteine protease 1 precursor                      131   1e-33   Zea mays [maize]
gb|ABR26128.1|  cysteine proteinase rd21a precursor                     127   1e-33   Oryza sativa Indica Group [Indian rice]
gb|ABG33750.1|  cysteine protease                                       130   2e-33   Hevea brasiliensis [jebe]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         130   2e-33   Jatropha curcas
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like                130   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE04498.2|  OSJNBb0059K02.8                                        130   2e-33   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA14402.1|  oryzain alpha precursor                                130   3e-33   Oryza sativa Japonica Group [Japonica rice]
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...    130   3e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61807.1|  hypothetical protein OsJ_16426                          130   3e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78138.1|  hypothetical protein OsI_17694                          130   3e-33   Oryza sativa Indica Group [Indian rice]
emb|CAJ86180.1|  H0212B02.7                                             130   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                130   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN61026.1|  hypothetical protein VITISV_001146                     129   4e-33   Vitis vinifera
gb|KDO84083.1|  hypothetical protein CISIN_1g024783mg                   125   4e-33   Citrus sinensis [apfelsine]
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    129   5e-33   Vitis vinifera
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like                129   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          129   5e-33   Tarenaya hassleriana [spider flower]
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                129   5e-33   Erythranthe guttata [common monkey flower]
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      129   6e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19479.3|  unnamed protein product                                128   7e-33   Vitis vinifera
gb|KDO84077.1|  hypothetical protein CISIN_1g024783mg                   125   7e-33   Citrus sinensis [apfelsine]
gb|KDO84078.1|  hypothetical protein CISIN_1g024783mg                   126   7e-33   Citrus sinensis [apfelsine]
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like                129   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH44128.1|  papain family cysteine protease                         129   1e-32   Medicago truncatula
gb|AAC49455.1|  Pseudotzain                                             128   1e-32   Pseudotsuga menziesii
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          128   1e-32   Citrus sinensis [apfelsine]
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g             128   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like                128   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63305.1|  hypothetical protein M569_11479                         128   1e-32   Genlisea aurea
gb|KDO84085.1|  hypothetical protein CISIN_1g024783mg                   125   1e-32   Citrus sinensis [apfelsine]
ref|XP_006434710.1|  hypothetical protein CICLE_v100010542mg            126   2e-32   Citrus clementina
dbj|BAH11164.1|  cysteine protease                                      128   2e-32   Hordeum vulgare [barley]
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...    128   2e-32   Phoenix dactylifera
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               128   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             128   2e-32   Capsella rubella
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          127   2e-32   Camelina sativa [gold-of-pleasure]
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     127   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    127   2e-32   Eucalyptus grandis [rose gum]
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like          127   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          127   3e-32   Malus domestica [apple tree]
ref|XP_002510170.1|  cysteine protease, putative                        127   3e-32   Ricinus communis
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like                127   3e-32   Elaeis guineensis
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like          127   3e-32   Populus euphratica
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    127   3e-32   Cicer arietinum [garbanzo]
gb|AAD28476.1|AF133838_1  papain-like cysteine protease                 126   3e-32   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    127   4e-32   
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             127   4e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          127   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006374886.1|  cysteine proteinase                                127   4e-32   Populus trichocarpa [western balsam poplar]
gb|AEV40973.1|  putative oryzain beta chain precursor                   126   5e-32   Oryza punctata
gb|AEV41024.1|  putative oryzain beta chain precursor                   126   6e-32   Oryza minuta
gb|ABK24233.1|  unknown                                                 126   6e-32   Picea sitchensis
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       126   7e-32   Brassica oleracea
emb|CDX71540.1|  BnaC04g17750D                                          126   7e-32   Brassica napus [oilseed rape]
dbj|BAF01762.1|  cysteine protease component of protease-inhibito...    124   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220          126   8e-32   
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             126   8e-32   Eutrema salsugineum
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               126   9e-32   Populus euphratica
gb|AAX84673.1|  cysteine protease CP1                                   125   1e-31   Manihot esculenta [manioc]
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...    125   1e-31   Malus domestica [apple tree]
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          125   1e-31   Populus euphratica
gb|AEZ65082.1|  cysteine protease                                       125   1e-31   Carica papaya [mamon]
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             125   1e-31   Populus trichocarpa [western balsam poplar]
dbj|BAH08632.1|  daikon cysteine protease RD21                          123   2e-31   Raphanus sativus
gb|AGV15823.1|  cysteine protease CP15                                  125   2e-31   Nicotiana tabacum [American tobacco]
gb|AIE88288.1|  hypothetical protein OG_BBa0063K01.19                   125   2e-31   Oryza glaberrima
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    125   2e-31   Nicotiana tomentosiformis
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like                 125   2e-31   Brachypodium distachyon [annual false brome]
dbj|BAA14403.1|  oryzain beta precursor                                 125   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAU81588.1|  cysteine proteinase                                     120   2e-31   Petunia x hybrida [garden petunia]
gb|ACI00280.1|  triticain beta 2                                        125   2e-31   Hordeum vulgare [barley]
dbj|BAK03074.1|  predicted protein                                      125   2e-31   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001054211.2|  Os04g0670200                                       125   2e-31   
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    125   2e-31   Nicotiana sylvestris
gb|EMS68758.1|  Oryzain beta chain                                      125   2e-31   Triticum urartu
dbj|BAF02547.1|  triticain beta                                         125   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like                125   2e-31   Oryza brachyantha
gb|EAZ32359.1|  hypothetical protein OsJ_16569                          125   2e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CAQ00106.1|  papain-like cysteine proteinase                        125   2e-31   Hordeum vulgare subsp. vulgare [barley]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    125   2e-31   Sesamum indicum [beniseed]
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like          124   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             124   3e-31   Eutrema salsugineum
dbj|BAF93840.1|  triticain beta 2                                       124   3e-31   Triticum aestivum [Canadian hard winter wheat]
gb|ABK24495.1|  unknown                                                 124   3e-31   Picea sitchensis
gb|AEV41071.1|  putative oryzain beta chain precursor                   124   4e-31   Oryza minuta
gb|AAU81595.1|  cysteine proteinase                                     119   4e-31   Petunia x hybrida [garden petunia]
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    124   4e-31   Arabis alpina [alpine rockcress]
ref|XP_010107858.1|  Cysteine proteinase RD21a                          124   4e-31   Morus notabilis
emb|CDY22370.1|  BnaA06g36920D                                          124   4e-31   Brassica napus [oilseed rape]
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               124   4e-31   Brassica rapa
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          124   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...    124   5e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|AEV41117.1|  putative oryzain beta chain precursor                   124   6e-31   Oryza officinalis
emb|CDY63586.1|  BnaCnng42340D                                          123   7e-31   Brassica napus [oilseed rape]
dbj|BAC75923.1|  cysteine protease-1                                    123   7e-31   Helianthus annuus
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                123   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     123   7e-31   
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like                123   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             123   8e-31   Prunus persica
gb|EMT10724.1|  Oryzain beta chain                                      122   9e-31   Aegilops tauschii
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    123   9e-31   Malus domestica [apple tree]
ref|XP_002518705.1|  cysteine protease, putative                        123   1e-30   Ricinus communis
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...    123   1e-30   
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    123   1e-30   Arabis alpina [alpine rockcress]
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a               123   1e-30   Fragaria vesca subsp. vesca
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    122   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    122   1e-30   Prunus mume [ume]
gb|AAD56028.1|AF181567_1  cysteine protease CYP1                        119   1e-30   Solanum chacoense
dbj|BAD29954.1|  cysteine protease                                      122   1e-30   Daucus carota [carrots]
dbj|BAE98640.1|  cysteine proteinase RD21A                              118   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             122   2e-30   Prunus persica
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...    122   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_008357442.1|  PREDICTED: oryzain alpha chain-like                122   2e-30   Malus domestica [apple tree]
gb|KJB58558.1|  hypothetical protein B456_009G214900                    122   2e-30   Gossypium raimondii
dbj|BAH20390.1|  AT1G47128                                              117   2e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD29958.1|  cysteine protease                                      122   2e-30   Daucus carota [carrots]
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320          122   2e-30   Sorghum bicolor [broomcorn]
gb|KJB58559.1|  hypothetical protein B456_009G214900                    122   2e-30   Gossypium raimondii
tpg|DAA35450.1|  TPA: cysteine protease 1                               122   2e-30   Zea mays [maize]
gb|KJB58557.1|  hypothetical protein B456_009G214900                    122   2e-30   Gossypium raimondii
gb|ACR34204.1|  unknown                                                 122   2e-30   Zea mays [maize]
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          122   3e-30   Prunus mume [ume]
ref|NP_001150266.1|  cysteine protease 1 precursor                      122   3e-30   Zea mays [maize]
gb|AAP41847.1|  senescence-associated cysteine protease                 122   3e-30   Anthurium andraeanum [flamingo-lily]
dbj|BAD95392.1|  cysteine proteinase RD21A                              121   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    122   3e-30   Brassica rapa
emb|CDY17044.1|  BnaA08g04080D                                          121   3e-30   Brassica napus [oilseed rape]
gb|AAK62661.1|  F2G19.31/F2G19.31                                       121   3e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17093.1|  BnaC06g00260D                                          121   3e-30   Brassica napus [oilseed rape]
ref|NP_564497.1|  cysteine proteinase RD21a                             121   3e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG16371.1|  cysteine protease                                      121   3e-30   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1          121   3e-30   Zea mays [maize]
dbj|BAG16377.1|  cysteine protease                                      121   4e-30   Brassica rapa var. perviridis [kabuna]
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          121   4e-30   Camelina sativa [gold-of-pleasure]
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       121   4e-30   Brassica oleracea
gb|KGN55227.1|  hypothetical protein Csa_4G641600                       121   5e-30   Cucumis sativus [cucumbers]
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like          121   5e-30   
ref|XP_003603086.1|  Cysteine proteinase                                121   5e-30   Medicago truncatula
dbj|BAD29956.1|  cysteine protease                                      120   6e-30   Daucus carota [carrots]
gb|ABQ10204.1|  cysteine protease Cp6                                   120   6e-30   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    120   6e-30   Solanum tuberosum [potatoes]
gb|KJB14608.1|  hypothetical protein B456_002G133800                    120   6e-30   Gossypium raimondii
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg             121   7e-30   Capsella rubella
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2      120   7e-30   Setaria italica
emb|CDY25228.1|  BnaC02g30040D                                          120   7e-30   Brassica napus [oilseed rape]
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like          120   7e-30   
gb|KJB14609.1|  hypothetical protein B456_002G133800                    120   7e-30   Gossypium raimondii
emb|CDY06760.1|  BnaA10g05390D                                          120   8e-30   Brassica napus [oilseed rape]
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             120   8e-30   Phaseolus vulgaris [French bean]
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1      120   8e-30   
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    120   9e-30   Solanum tuberosum [potatoes]
gb|AFO83614.1|  papain-like cysteine protease                           120   1e-29   Fagopyrum esculentum
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like          120   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    120   1e-29   Nicotiana tomentosiformis
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...    120   1e-29   Nicotiana sylvestris
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a               120   1e-29   Camelina sativa [gold-of-pleasure]
ref|NP_001150196.1|  cysteine protease 1 precursor                      120   1e-29   Zea mays [maize]
emb|CDO97206.1|  unnamed protein product                                120   1e-29   Coffea canephora [robusta coffee]
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  120   1e-29   Arabidopsis lyrata subsp. lyrata
gb|KJB14607.1|  hypothetical protein B456_002G133800                    117   1e-29   Gossypium raimondii
dbj|BAH20463.1|  cysteine protease                                      120   1e-29   Spinacia oleracea
gb|KJB14610.1|  hypothetical protein B456_002G133800                    120   1e-29   Gossypium raimondii
dbj|BAD16614.1|  cysteine proteinase                                    120   1e-29   Dianthus caryophyllus [carnation]
ref|XP_010094652.1|  Cysteine proteinase RD21a                          120   1e-29   Morus notabilis
gb|KHG05637.1|  Cysteinease RD21a -like protein                         120   1e-29   Gossypium arboreum [tree cotton]
gb|KJB14606.1|  hypothetical protein B456_002G133800                    118   1e-29   Gossypium raimondii
gb|KHG12125.1|  Cysteinease RD21a -like protein                         121   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like          119   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             119   2e-29   Citrus clementina
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   119   2e-29   Citrus sinensis [apfelsine]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          119   2e-29   Citrus sinensis [apfelsine]
dbj|BAD29960.1|  cysteine protease                                      119   2e-29   Daucus carota [carrots]
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      119   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like                 119   3e-29   Oryza brachyantha
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          119   3e-29   Nicotiana sylvestris
gb|AAA79915.1|  cysteine proteinase                                     118   4e-29   Dianthus caryophyllus [carnation]
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766             118   4e-29   Selaginella moellendorffii
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          118   5e-29   Solanum lycopersicum
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344             118   7e-29   Selaginella moellendorffii
gb|KJB63901.1|  hypothetical protein B456_010G022700                    117   7e-29   Gossypium raimondii
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    117   8e-29   Malus domestica [apple tree]
dbj|BAD29957.1|  cysteine protease                                      117   9e-29   Daucus carota [carrots]
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    117   9e-29   Theobroma cacao [chocolate]
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       117   1e-28   Brassica oleracea
emb|CDX99227.1|  BnaC05g33420D                                          117   1e-28   Brassica napus [oilseed rape]
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          117   1e-28   Nicotiana tomentosiformis
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          117   1e-28   Solanum tuberosum [potatoes]
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    117   2e-28   Solanum lycopersicum
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          116   3e-28   
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    117   3e-28   Theobroma cacao [chocolate]
ref|XP_006364868.1|  PREDICTED: uncharacterized protein LOC102583833    117   4e-28   
emb|CDY46179.1|  BnaA05g20660D                                          115   5e-28   Brassica napus [oilseed rape]
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    115   5e-28   Brassica rapa
ref|XP_001781010.1|  predicted protein                                  115   8e-28   Physcomitrella patens
ref|XP_001783545.1|  predicted protein                                  114   1e-27   Physcomitrella patens
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          114   1e-27   Cicer arietinum [garbanzo]
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          114   1e-27   Vitis vinifera
ref|XP_002447300.1|  hypothetical protein SORBIDRAFT_06g032360          114   1e-27   Sorghum bicolor [broomcorn]
gb|AJA74414.1|  cysteine protease                                       114   2e-27   Cicer arietinum [garbanzo]
gb|KHN08598.1|  Cysteine proteinase RD21a                               114   2e-27   Glycine soja [wild soybean]
emb|CBI40282.3|  unnamed protein product                                113   2e-27   Vitis vinifera
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    114   2e-27   Solanum lycopersicum
gb|AEZ65083.1|  cysteine protease                                       113   2e-27   Carica papaya [mamon]
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             113   3e-27   Arabidopsis lyrata subsp. lyrata
gb|ABQ10202.1|  cysteine protease Cp4                                   113   4e-27   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004173252.1|  PREDICTED: oryzain alpha chain-like                112   4e-27   
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...    113   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...    112   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg             112   5e-27   Capsella rubella
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                     112   5e-27   Eucalyptus grandis [rose gum]
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...    112   5e-27   Eucalyptus grandis [rose gum]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          112   5e-27   Cucumis sativus [cucumbers]
ref|XP_006653861.1|  PREDICTED: cysteine protease 1-like                112   6e-27   
ref|XP_003589133.1|  Cysteine proteinase                                112   6e-27   Medicago truncatula
gb|AAW34137.1|  cysteine protease gp3b                                  112   7e-27   Zingiber officinale [ginger]
ref|XP_003589136.1|  Cysteine proteinase                                111   7e-27   
ref|XP_003589135.1|  Cysteine proteinase                                112   7e-27   Medicago truncatula
dbj|BAE80740.1|  cysteine proteinase                                    112   8e-27   Platycodon grandiflorus [balloon-flower]
gb|ACJ84565.1|  unknown                                                 111   8e-27   Medicago truncatula
gb|AEV41119.1|  putative cysteine protease                              112   8e-27   Oryza officinalis
gb|AEV41073.1|  putative cysteine protease                              112   9e-27   Oryza minuta
gb|AAW34136.1|  cysteine protease gp3a                                  112   9e-27   Zingiber officinale [ginger]
gb|AEV40975.1|  putative cysteine protease                              112   1e-26   Oryza punctata
emb|CDP01294.1|  unnamed protein product                                112   1e-26   Coffea canephora [robusta coffee]
gb|AEV41026.1|  putative cysteine protease                              111   1e-26   Oryza minuta
ref|XP_002988081.1|  hypothetical protein SELMODRAFT_183539             111   1e-26   Selaginella moellendorffii
ref|XP_002972714.1|  hypothetical protein SELMODRAFT_98707              111   1e-26   Selaginella moellendorffii
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472             112   2e-26   Elaeis guineensis
ref|XP_001755855.1|  predicted protein                                  111   2e-26   Physcomitrella patens
emb|CAB17076.1|  cysteine proteinase precursor                          110   3e-26   Phaseolus vulgaris [French bean]
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             110   3e-26   Phaseolus vulgaris [French bean]
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          110   5e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    110   5e-26   Cucumis melo [Oriental melon]
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...    109   6e-26   Camelina sativa [gold-of-pleasure]
gb|EMS62782.1|  Cysteine protease 1                                     109   6e-26   Triticum urartu
gb|EMT31482.1|  Cysteine protease 1                                     107   1e-25   Aegilops tauschii
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like                108   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX95457.1|  BnaC01g33490D                                          108   2e-25   Brassica napus [oilseed rape]
emb|CDY50157.1|  BnaA01g26170D                                          108   2e-25   Brassica napus [oilseed rape]
gb|AFW62237.1|  hypothetical protein ZEAMMB73_032109                    109   3e-25   Zea mays [maize]
gb|KHN22488.1|  Cysteine proteinase RD21a                               107   3e-25   Glycine soja [wild soybean]
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          107   4e-25   Glycine max [soybeans]
emb|CAA46863.1|  thiolprotease                                          107   5e-25   Pisum sativum [garden pea]
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    107   6e-25   Sesamum indicum [beniseed]
gb|ACB87490.1|  mucunain                                                106   8e-25   Mucuna pruriens
ref|XP_001761481.1|  predicted protein                                  106   9e-25   Physcomitrella patens
sp|P20721.1|CYSPL_SOLLC  RecName: Full=Low-temperature-induced cy...    105   1e-24   Solanum lycopersicum
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                105   1e-24   Zea mays [maize]
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          106   1e-24   Fragaria vesca subsp. vesca
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like          106   1e-24   Glycine max [soybeans]
ref|XP_005651425.1|  hypothetical protein COCSUDRAFT_21961              106   2e-24   Coccomyxa subellipsoidea C-169
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                    105   3e-24   Arabis alpina [alpine rockcress]
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...    105   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_001780740.1|  predicted protein                                  105   4e-24   
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like                103   5e-24   
gb|ACF85649.1|  unknown                                                 102   1e-23   
gb|ACG41708.1|  cysteine proteinase RD21a precursor                     102   1e-23   
gb|EAZ32361.1|  hypothetical protein OsJ_16571                          102   2e-23   
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg             102   2e-23   
gb|AIE88271.1|  hypothetical protein OG_BBa0063K01.2                    103   2e-23   
ref|XP_004963406.1|  PREDICTED: cysteine protease 1-like                102   2e-23   
gb|ACR34737.1|  unknown                                                 103   2e-23   
emb|CAH67695.1|  H0624F09.3                                             102   3e-23   
ref|NP_001054213.1|  Os04g0670500                                       102   3e-23   
gb|EMT09761.1|  Cysteine protease 1                                   99.8    1e-22   
emb|CDX95451.1|  BnaC01g33430D                                        98.2    8e-22   
emb|CDY50154.1|  BnaA01g26140D                                        98.2    8e-22   
gb|AAS20467.1|  cysteine protease-like protein                        95.9    1e-21   
ref|XP_010672523.1|  PREDICTED: ervatamin-B                           97.4    2e-21   
dbj|BAJ53169.1|  JHL18I08.3                                           97.4    2e-21   
ref|XP_004500967.1|  PREDICTED: oryzain alpha chain-like              97.1    2e-21   
emb|CAA07567.1|  cysteine proteinase                                  94.4    3e-21   
ref|NP_001104878.1|  maize insect resistance2 precursor               97.4    3e-21   
ref|XP_011072006.1|  PREDICTED: vignain-like                          95.5    5e-21   
dbj|BAJ85145.1|  predicted protein                                    96.3    5e-21   
tpg|DAA53037.1|  TPA: hypothetical protein ZEAMMB73_586844            97.1    1e-20   
gb|AFW88998.1|  hypothetical protein ZEAMMB73_678859                  97.1    1e-20   
ref|XP_007017656.1|  JHL18I08.3 protein                               94.7    2e-20   
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...  94.0    3e-20   
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...  94.0    3e-20   
ref|XP_005850783.1|  hypothetical protein CHLNCDRAFT_56822            94.0    4e-20   
ref|XP_011048840.1|  PREDICTED: low-temperature-induced cysteine ...  94.4    4e-20   
gb|EMT33622.1|  Cysteine proteinase RD21a                             95.5    4e-20   
ref|XP_002868997.1|  hypothetical protein ARALYDRAFT_912625           88.6    5e-20   
gb|KEH36214.1|  papain family cysteine protease                       93.6    5e-20   
gb|EMS65496.1|  Cysteine proteinase RD21a                             92.0    6e-20   
ref|XP_003599736.1|  Cysteine proteinase                              92.0    6e-20   
ref|XP_008347358.1|  PREDICTED: low-temperature-induced cysteine ...  93.2    6e-20   
ref|XP_002280937.1|  PREDICTED: zingipain-2                           92.8    7e-20   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            91.7    8e-20   
gb|KHN28095.1|  Thiol protease                                        91.7    9e-20   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            91.7    9e-20   
ref|XP_008221336.1|  PREDICTED: low-temperature-induced cysteine ...  93.6    9e-20   
gb|AAB23155.1|  COT44=cysteine proteinase homolog                     91.7    9e-20   
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...  91.7    9e-20   
emb|CDX69285.1|  BnaC01g01680D                                        92.0    9e-20   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                  92.0    1e-19   
gb|EPS62067.1|  cysteine proteinase                                   91.3    1e-19   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            91.7    1e-19   
gb|KHN12137.1|  Thiol protease                                        91.7    1e-19   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            91.7    1e-19   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            91.7    1e-19   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            91.7    1e-19   
emb|CDX75633.1|  BnaA01g00690D                                        91.7    1e-19   
dbj|BAJ90119.1|  predicted protein                                    92.4    1e-19   
ref|XP_002864049.1|  hypothetical protein ARALYDRAFT_495086           91.3    1e-19   
dbj|BAA96443.1|  cysteine protease                                    88.6    2e-19   
gb|AAD54424.1|AF182079_1  thiol protease                              92.4    2e-19   
gb|ACY38051.3|  cysteine proteinase C1A                               90.9    2e-19   
ref|XP_010441769.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  90.9    2e-19   
gb|KJB58177.1|  hypothetical protein B456_009G197900                  91.3    2e-19   
ref|NP_568722.1|  KDEL-tailed cysteine endopeptidase CEP1             90.9    2e-19   
ref|XP_004291399.1|  PREDICTED: low-temperature-induced cysteine ...  91.7    2e-19   
gb|KHG28107.1|  Cysteinease RD21a -like protein                       91.7    2e-19   
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...  90.9    3e-19   
ref|XP_007223363.1|  hypothetical protein PRUPE_ppa005615mg           91.7    3e-19   
ref|XP_010458294.1|  PREDICTED: low-temperature-induced cysteine ...  91.7    3e-19   
ref|XP_010501397.1|  PREDICTED: zingipain-2-like                      91.3    3e-19   
gb|KJB58175.1|  hypothetical protein B456_009G197900                  91.3    3e-19   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  90.1    3e-19   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         93.2    3e-19   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg           90.5    3e-19   
emb|CAA89835.1|  cysteine protease                                    85.1    3e-19   
dbj|BAF56429.1|  cysteine proteinase                                  90.1    4e-19   
ref|XP_007136041.1|  hypothetical protein PHAVU_009G013000g           90.9    4e-19   
emb|CDY34045.1|  BnaC03g27700D                                        90.1    4e-19   
ref|XP_002312656.2|  hypothetical protein POPTR_0008s18350g           90.1    4e-19   
ref|XP_006838704.1|  hypothetical protein AMTR_s00002p00249780        91.7    4e-19   
gb|AFK44139.1|  unknown                                               90.1    4e-19   
ref|XP_010475838.1|  PREDICTED: low-temperature-induced cysteine ...  91.3    4e-19   
emb|CDX83168.1|  BnaA03g23380D                                        90.1    4e-19   
ref|XP_010037483.1|  PREDICTED: vignain-like                          90.1    4e-19   
ref|XP_003607647.1|  Cysteine proteinase                              90.1    4e-19   
ref|XP_009134051.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  90.1    4e-19   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           89.7    5e-19   
ref|XP_009148295.1|  PREDICTED: low-temperature-induced cysteine ...  90.9    5e-19   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1           89.7    5e-19   
gb|AAB60738.1|  Strong similarity to Dianthus cysteine proteinase...  90.5    5e-19   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2           89.7    5e-19   
ref|XP_010110007.1|  Oryzain alpha chain                              91.3    5e-19   
ref|XP_003523725.1|  PREDICTED: oryzain alpha chain-like              90.9    5e-19   
ref|XP_010442505.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  89.7    6e-19   
ref|XP_002437490.1|  hypothetical protein SORBIDRAFT_10g028000        89.7    6e-19   
emb|CDX93470.1|  BnaA06g05780D                                        90.5    6e-19   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       89.4    6e-19   
gb|KHN45886.1|  Oryzain alpha chain                                   90.5    6e-19   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                       89.4    6e-19   
ref|XP_002531152.1|  cysteine protease, putative                      89.4    7e-19   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...  89.7    7e-19   
gb|AER60490.1|  cysteine proteases                                    89.7    7e-19   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...  89.7    7e-19   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...  89.7    7e-19   
ref|NP_563855.1|  papain-like cysteine peptidase                      90.5    7e-19   
ref|XP_004515851.1|  PREDICTED: vignain-like                          89.4    7e-19   
ref|XP_002531151.1|  cysteine protease, putative                      89.4    7e-19   
gb|AAK71314.1|AF388175_1  papain-like cysteine peptidase XBCP3        90.1    8e-19   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like        89.4    8e-19   
gb|KDO84699.1|  hypothetical protein CISIN_1g012960mg                 89.0    8e-19   
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...  89.4    8e-19   
gb|KJB75476.1|  hypothetical protein B456_012G043300                  87.4    8e-19   
ref|NP_195406.2|  cysteine proteinase1                                89.4    8e-19   
emb|CDY44047.1|  BnaA08g15590D                                        89.4    9e-19   
dbj|BAF00916.1|  cysteine proteinase                                  89.4    9e-19   
ref|XP_002889773.1|  hypothetical protein ARALYDRAFT_471096           90.1    1e-18   
gb|AGV54418.1|  oryzain alpha chain-like protein                      90.1    1e-18   
emb|CDY22445.1|  BnaC03g61580D                                        89.4    1e-18   
gb|KFK43284.1|  hypothetical protein AALP_AA1G104100                  89.7    1e-18   
ref|XP_006592475.1|  PREDICTED: vignain-like                          89.0    1e-18   
ref|XP_002307688.2|  cysteine protease family protein                 89.7    1e-18   
emb|CBI21373.3|  unnamed protein product                              88.2    1e-18   
gb|KHN27797.1|  Thiol protease SEN102                                 88.6    1e-18   
ref|XP_006402148.1|  hypothetical protein EUTSA_v10013914mg           89.0    1e-18   
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg           89.0    1e-18   
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like        89.0    1e-18   
ref|XP_006280686.1|  hypothetical protein CARUB_v10026650mg           88.6    1e-18   
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                 89.0    1e-18   
emb|CDX94938.1|  BnaC05g07330D                                        89.7    1e-18   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44             89.0    1e-18   
ref|XP_002510459.1|  cysteine protease, putative                      89.4    1e-18   
ref|XP_003549830.2|  PREDICTED: vignain-like                          89.0    1e-18   
gb|KHN27075.1|  Cysteine proteinase RD21a                             88.6    1e-18   
ref|XP_010271530.1|  PREDICTED: low-temperature-induced cysteine ...  89.7    1e-18   
gb|KJB75473.1|  hypothetical protein B456_012G043000                  88.2    1e-18   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg           88.6    1e-18   
gb|KDO84700.1|  hypothetical protein CISIN_1g012960mg                 89.0    2e-18   
emb|CDP07460.1|  unnamed protein product                              89.4    2e-18   
gb|KHN12823.1|  Cysteine proteinase RD21a                             88.6    2e-18   
ref|XP_002868998.1|  cysteine proteinase                              88.6    2e-18   
ref|XP_008444761.1|  PREDICTED: zingipain-2                           89.4    2e-18   
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor   88.2    2e-18   
gb|ADR32294.1|  C14 cysteine protease                                 87.0    2e-18   
gb|KDO84698.1|  hypothetical protein CISIN_1g012960mg                 89.4    2e-18   
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44             88.2    2e-18   
ref|XP_006435079.1|  hypothetical protein CICLE_v10001178mg           89.0    2e-18   
ref|XP_002954352.1|  hypothetical protein VOLCADRAFT_76255            89.4    2e-18   
gb|KHG00992.1|  Cysteinease RD21a -like protein                       88.2    2e-18   
gb|KDO84697.1|  hypothetical protein CISIN_1g012960mg                 89.0    2e-18   
gb|KJB51148.1|  hypothetical protein B456_008G203800                  87.8    2e-18   
ref|XP_009797968.1|  PREDICTED: vignain-like                          87.8    2e-18   
gb|KHN30007.1|  Cysteine proteinase RD21a                             88.2    2e-18   
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a             87.8    2e-18   
ref|XP_010536661.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  87.8    3e-18   
ref|XP_006307431.1|  hypothetical protein CARUB_v10009056mg           89.0    3e-18   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       87.8    3e-18   
ref|XP_006417526.1|  hypothetical protein EUTSA_v10007640mg           89.0    3e-18   
ref|XP_004289205.2|  PREDICTED: cysteine proteinase COT44             87.8    3e-18   
gb|ADR32295.1|  C14 cysteine protease                                 86.7    3e-18   
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like        87.8    3e-18   
gb|AFR11773.1|  cysteine protease                                     87.8    3e-18   
gb|ADR32298.1|  C14 cysteine protease                                 86.7    3e-18   
ref|XP_008780365.1|  PREDICTED: vignain-like                          85.9    3e-18   
gb|ADR32292.1|  C14 cysteine protease                                 86.7    3e-18   
ref|XP_007050065.1|  Senescence-associated gene 12                    87.4    3e-18   
dbj|BAM66994.1|  germination-specific cysteine protease 1             86.7    3e-18   
ref|XP_010093524.1|  Germination-specific cysteine protease 1         87.4    4e-18   
gb|KJB75474.1|  hypothetical protein B456_012G043100                  87.0    4e-18   
ref|XP_010544099.1|  PREDICTED: low-temperature-induced cysteine ...  88.6    4e-18   
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like        87.4    4e-18   
ref|XP_004961575.1|  PREDICTED: oryzain alpha chain-like              88.6    4e-18   
gb|KJB84212.1|  hypothetical protein B456_N010800                     87.0    4e-18   
gb|KJB75480.1|  hypothetical protein B456_012G043600                  87.0    4e-18   
emb|CAE54307.1|  cysteine proteinase                                  87.4    4e-18   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                      87.4    4e-18   
ref|XP_010682353.1|  PREDICTED: vignain-like                          87.0    5e-18   
gb|KJB84213.1|  hypothetical protein B456_N010900                     86.7    5e-18   
gb|AFW75939.1|  maize insect resistance1                              87.8    6e-18   
ref|XP_003566217.1|  PREDICTED: thiol protease SEN102-like            87.0    6e-18   
ref|XP_008780330.1|  PREDICTED: vignain-like                          85.1    6e-18   
gb|ADR32293.1|  C14 cysteine protease                                 85.9    6e-18   
gb|ABK22314.1|  unknown                                               87.0    6e-18   
gb|ADR32296.1|  C14 cysteine protease                                 85.9    6e-18   
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like        87.0    6e-18   
ref|XP_002523448.1|  cysteine protease, putative                      86.7    6e-18   
emb|CDO96804.1|  unnamed protein product                              88.2    6e-18   
ref|XP_004238304.1|  PREDICTED: zingipain-2                           87.8    7e-18   
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg           86.7    7e-18   
gb|EPS57605.1|  cysteine proteinase                                   85.1    7e-18   
ref|XP_006844723.1|  hypothetical protein AMTR_s00016p00253110        86.7    7e-18   
emb|CDP15086.1|  unnamed protein product                              86.7    8e-18   
gb|KJB75478.1|  hypothetical protein B456_012G0435001                 85.1    8e-18   
ref|XP_006439985.1|  hypothetical protein CICLE_v10020781mg           86.7    8e-18   
emb|CDM84800.1|  unnamed protein product                              86.7    8e-18   
ref|XP_004501841.1|  PREDICTED: vignain-like                          86.7    8e-18   
ref|XP_006476933.1|  PREDICTED: vignain-like                          86.3    9e-18   
ref|XP_007135980.1|  hypothetical protein PHAVU_009G008100g           86.3    9e-18   
dbj|BAF56430.1|  cysteine proteinase                                  86.3    9e-18   
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550        86.3    1e-17   
gb|KJB48627.1|  hypothetical protein B456_008G078300                  85.5    1e-17   
ref|XP_004515849.1|  PREDICTED: vignain-like                          86.3    1e-17   
gb|AFP20583.1|  cysteine endopeptidase                                84.3    1e-17   
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like        86.3    1e-17   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       85.9    1e-17   
ref|XP_010927557.1|  PREDICTED: thiol protease SEN102-like            82.8    1e-17   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                      85.9    1e-17   
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...  85.9    1e-17   
ref|NP_001141813.1|  uncharacterized protein LOC100273952 precursor   87.0    1e-17   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                      85.5    1e-17   
prf||1910332A  Cys endopeptidase                                      85.9    1e-17
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      85.5    1e-17   
gb|AAA92063.1|  cysteinyl endopeptidase                               85.9    1e-17   
gb|KHN27804.1|  KDEL-tailed cysteine endopeptidase CEP1               83.6    1e-17   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                      85.5    1e-17   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg           85.5    1e-17   
ref|XP_008392874.1|  PREDICTED: vignain-like                          85.9    1e-17   
ref|XP_004506025.1|  PREDICTED: vignain-like                          85.5    1e-17   
ref|NP_001105571.1|  maize insect resistance1 precursor               86.3    2e-17   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                      85.5    2e-17   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  88.2    2e-17   
ref|XP_008228922.1|  PREDICTED: vignain-like                          85.5    2e-17   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g           85.5    2e-17   
gb|KJB19532.1|  hypothetical protein B456_003G108200                  85.9    2e-17   
ref|XP_006473576.1|  PREDICTED: cysteine proteinase RD21a-like        86.7    2e-17   
gb|KHG06908.1|  Vignain                                               85.5    2e-17   
gb|KJB48622.1|  hypothetical protein B456_008G078300                  85.9    2e-17   



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/110 (99%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRN+KAKTGLCGIAMEASYPTKKGGDNPP
Sbjct  303  AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAKTGLCGIAMEASYPTKKGGDNPP  362

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSPPSPPSPTPTPPSPSPSVCDKFNACPASTTCCCVFPFGNYCFAWGCCP
Sbjct  363  PSPPSPPSPTPTPPSPSPSVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  412



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENGVDYWIVKNSW   WGEKGY+RMQRN+K K GLCGIA+E SYPTK G     
Sbjct  303  AVGYGTENGVDYWIVKNSWAASWGEKGYLRMQRNVKDKNGLCGIAIEPSYPTKTG-----  357

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P++CD ++ CP STTCCCVFP+G +CFAWGC P
Sbjct  358  -ENPPNPGPSPPSPVSPPNMCDDYDECPTSTTCCCVFPYGEHCFAWGCSP  406



>ref|XP_008796470.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=466

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG  YWIVKNSWG  WGE GY+RM+RN+ A TG CGIAMEASYP KKG     
Sbjct  301  AVGYGSENGQGYWIVKNSWGSEWGESGYIRMERNVNAATGKCGIAMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP STTCCCV+ FGNYCFAWGCCP
Sbjct  356  -QNPPNPGPSPPSPVKPPTVCDNYYSCPESTTCCCVYEFGNYCFAWGCCP  404



>ref|NP_001183396.1| uncharacterized protein LOC100501813 [Zea mays]
 gb|ACR36639.1| unknown [Zea mays]
Length=291

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  121  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGAN---  177

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  178  ---PPNPGPTPPSPTPPPTVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  224



>ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=463

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGEKGY+RM+RN+K+ +G CGIA+E SYP KKG +   
Sbjct  296  AVGYGTENGKDYWIVKNSWGGSWGEKGYIRMERNVKSSSGKCGIAVEPSYPLKKGANP--  353

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P PTP  P+P P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  354  ----PNPGPTPPSPTPPPTVCDNYYSCPESTTCCCIYEYGKYCFAWGCCP  399



>ref|NP_001149658.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG36262.1| cysteine protease 1 precursor [Zea mays]
Length=469

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  299  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGAN---  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  356  ---PPNPGPTPPSPTPPPTVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  402



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG DYWIV+NSWG  WGEKGY+RMQRN++ +TGLCGIA+E SYPTK G +   
Sbjct  305  AVGYGSENGKDYWIVRNSWGSSWGEKGYIRMQRNVEVRTGLCGIAVEPSYPTKTGANP--  362

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P P+P  P   PSVCD +  CP STTCCCV+ +  YCFAWGCCP
Sbjct  363  ----PNPGPSPPSPVTPPSVCDDYYECPESTTCCCVYEYSGYCFAWGCCP  408



>emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYW+V+NSWG  WGE GY+RM+RN+KA +G CGIA+E SYPTK G +   
Sbjct  296  AVGYGTENGKDYWLVRNSWGSVWGEDGYIRMERNIKASSGKCGIAVEPSYPTKTGEN---  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P  SVCD +N CPASTTCCC++ +G  CFAWGCCP
Sbjct  353  ---PPNPGPTPPSPAPPSSVCDSYNECPASTTCCCIYEYGKECFAWGCCP  399



>gb|AFW59668.1| LOW QUALITY PROTEIN: cysteine protease 1 [Zea mays]
Length=469

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  299  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGAN---  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  356  ---PPNPGPTPPSPTPPPTVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  402



>gb|EMS56635.1| Oryzain alpha chain [Triticum urartu]
Length=483

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYW+V+NSWG  WGE GY+RM+RN+KA +G CGIA+E SYPTK G +   
Sbjct  316  AVGYGTENGKDYWLVRNSWGTVWGEDGYIRMERNIKASSGKCGIAVEPSYPTKTGEN---  372

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P  SVCD +N CPASTTCCC++ +G  CFAWGCCP
Sbjct  373  ---PPNPGPTPPSPAPPSSVCDSYNECPASTTCCCIYEYGKECFAWGCCP  419



>ref|XP_003580684.2| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon]
Length=486

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG DYWIVKNSWG  WGE GYVR++RN+KA +G CGIA+E SYP KKG +   
Sbjct  325  AVGYGSENGKDYWIVKNSWGTVWGEDGYVRLERNIKATSGKCGIAIEPSYPLKKGAN---  381

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P  +VCD +N CPASTTCCC++ +G  CFAWGCCP
Sbjct  382  ---PPNPGPTPPSPAPPSTVCDSYNECPASTTCCCIYTYGKECFAWGCCP  428



>dbj|BAF02546.1| triticain alpha [Triticum aestivum]
 gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum turgidum 
subsp. durum]
Length=461

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYW+V+NSWG  WGE GY+RM+RN+KA +G CGIA+E SYPTK G +   
Sbjct  294  AVGYGTENGKDYWLVRNSWGTVWGEDGYIRMERNIKASSGKCGIAVEPSYPTKTGEN---  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P  SVCD +N CPASTTCCC++ +G  CFAWGCCP
Sbjct  351  ---PPNPGPTPPSPAPPSSVCDSYNECPASTTCCCIYEYGKECFAWGCCP  397



>gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii]
Length=463

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYW+V+NSWG  WGE GY+RM+RN+KA +G CGIA+E SYPTK G +   
Sbjct  296  AVGYGTENGKDYWLVRNSWGTVWGEDGYIRMERNIKASSGKCGIAVEPSYPTKTGEN---  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P  SVCD +N CPASTTCCC++ +G  CFAWGCCP
Sbjct  353  ---PPNPGPTPPSPAPPSSVCDSYNECPASTTCCCIYEYGKECFAWGCCP  399



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAME+SYPTKKG     
Sbjct  305  AVGYGTENGKDYWIVRNSWGGDWGESGYIRMERNVNASTGKCGIAMESSYPTKKG-----  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP+ TTCCCV+ FG  CFAWGCCP
Sbjct  360  -QNPPNPGPSPPSPVNHPAVCDNYYSCPSGTTCCCVYEFGRRCFAWGCCP  408



>ref|XP_010927504.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=468

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E+G DYWIVKNSWG  WGE GY+RM+RN  A TG CGIAMEASYP KKG     
Sbjct  305  AVGYGSEDGKDYWIVKNSWGSEWGEGGYIRMERNTNAATGKCGIAMEASYPIKKG-----  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP STTCCCV+ FG YCFAWGCCP
Sbjct  360  -QNPPNPGPSPPSPVKPPTVCDNYYSCPESTTCCCVYDFGRYCFAWGCCP  408



>ref|XP_008796668.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=473

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG +YWIVKNSWG  WGE GYVRM+RN+ A TG CGIAMEASYP KKG     
Sbjct  309  AVGYGSENGKEYWIVKNSWGSEWGEAGYVRMERNINAATGKCGIAMEASYPIKKG-----  363

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP STTCCCV+ FG  CFAWGCCP
Sbjct  364  -QNPPNPGPSPPSPVKPPTVCDNYYSCPESTTCCCVYEFGRNCFAWGCCP  412



>ref|NP_001104879.1| cysteine proteinase Mir3 precursor [Zea mays]
 gb|AAB88263.1| cysteine proteinase Mir3 [Zea mays]
Length=480

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP K+G     
Sbjct  297  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKEG-----  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             + P  P P+P  P+P+P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  352  -ANPPNPGPSPPSPTPAPAVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  400



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN++A TG CGIAMEASYP KKG     
Sbjct  299  AVGYGTENGKDYWIVRNSWGKNWGESGYLRMARNIEASTGKCGIAMEASYPIKKG-----  353

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  354  -QNPPNPGPSPPSPVKPPTVCDNYYTCPESNTCCCLFKYGKYCFAWGCCP  402



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKG-GDNp  177
             VGYGTE GVDYWIV+NSWGD WGEKGY+RM+RN+KAK GLCGIA+E SYP K G     
Sbjct  306  VVGYGTEKGVDYWIVRNSWGDSWGEKGYLRMKRNVKAKEGLCGIAVEPSYPVKSGLNPPK  365

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P   P  PSP P  PS   SVCD + ACP STTCCC++ +  YCF WGCCP
Sbjct  366  PGPSPPTPSPPPPAPSAPSSVCDDYYACPDSTTCCCIYEYHGYCFEWGCCP  416



>ref|NP_001105993.1| cysteine protease component of protease-inhibitor complex precursor 
[Zea mays]
 dbj|BAA88898.1| cysteine protease component of protease-inhibitor complex [Zea 
mays]
Length=465

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP K+G     
Sbjct  297  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKEG-----  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             + P  P P+P  P+P+P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  352  -ANPPNPGPSPPSPTPAPAVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  400



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   TG CGIA+E SYPTKKG +   
Sbjct  305  AVGYGTENGKDYWIVRNSWGGDWGESGYIRMERNVNTSTGKCGIAIEPSYPTKKGQN---  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P+P+P  P   P+VCD + +CP+STTCCCV+ +G YCFAWGCCP
Sbjct  362  ---PPKPAPSPPSPVSPPTVCDNYYSCPSSTTCCCVYEYGRYCFAWGCCP  408



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   TG CGIA+E SYPTKKG +   
Sbjct  305  AVGYGTENGKDYWIVRNSWGGDWGESGYIRMERNVNTSTGKCGIAIEPSYPTKKGQN---  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P+P+P  P   P+VCD + +CP+STTCCCV+ +G YCFAWGCCP
Sbjct  362  ---PPKPAPSPPSPVSPPTVCDNYYSCPSSTTCCCVYEYGRYCFAWGCCP  408



>dbj|BAG92753.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93806.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  97   AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGENP--  154

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  155  ----PNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  200



>tpg|DAA35682.1| TPA: cysteine proteinase Mir3 [Zea mays]
Length=468

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP K+G     
Sbjct  299  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKEG-----  353

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             + P  P P+P  P+P+P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  354  -ANPPNPGPSPPSPTPAPAVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  402



>ref|NP_001148706.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG32602.1| cysteine protease 1 precursor [Zea mays]
Length=463

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP K+G     
Sbjct  294  AVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIAVEPSYPLKEG-----  348

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             + P  P P+P  P+P+P+VCD + +CP STTCCC++ +G YCFAWGCCP
Sbjct  349  -ANPPNPGPSPPSPTPAPAVCDNYYSCPDSTTCCCIYEYGKYCFAWGCCP  397



>gb|ABR26128.1| cysteine proteinase rd21a precursor [Oryza sativa Indica Group]
Length=229

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  97   AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGENP--  154

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  155  ----PNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  200



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN++  TG+CGIAMEASYP KKG +   
Sbjct  293  AVGYGTENGQDYWIVRNSWGKSWGESGYLRMARNIRKPTGICGIAMEASYPIKKGQN---  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD + +CP S TCCC+F + N+CF WGCCP
Sbjct  350  ---PPNPGPSPPSPVKPPSVCDNYFSCPESNTCCCIFEYANFCFEWGCCP  396



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG D+WIV+NSWG  WGE GY+RM+RN+++ TG CGIAMEASYP KKG +   
Sbjct  302  AVGYGTENGKDFWIVRNSWGKSWGEDGYLRMERNIQSPTGKCGIAMEASYPIKKGQN---  358

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD + +CP   TCCC+F +GNYCF WGCCP
Sbjct  359  ---PPNPGPSPPSPVKPPSVCDNYYSCPEGNTCCCIFEYGNYCFEWGCCP  405



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAMEASYP KK      
Sbjct  308  AVGYGTENGTDYWIVRNSWGGDWGEAGYIRMERNVNASTGKCGIAMEASYPVKK------  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP+STTCCCV+ +  YCFAWGCCP
Sbjct  362  SQNPPNPGPSPPSPVNPPTVCDNYYSCPSSTTCCCVYEYNGYCFAWGCCP  411



>emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa Japonica Group]
Length=458

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  293  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  350  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  396



>dbj|BAA14402.1| oryzain alpha precursor [Oryza sativa Japonica Group]
Length=458

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  293  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  350  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  396



>sp|P25776.2|ORYA_ORYSJ RecName: Full=Oryzain alpha chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABB30151.1| oryzain alpha [Oryza sativa Japonica Group]
Length=458

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  293  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  350  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  396



>gb|EEE61807.1| hypothetical protein OsJ_16426 [Oryza sativa Japonica Group]
Length=459

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  294  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  351  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  397



>gb|EEC78138.1| hypothetical protein OsI_17694 [Oryza sativa Indica Group]
Length=458

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  293  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  350  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  396



>emb|CAJ86180.1| H0212B02.7 [Oryza sativa Indica Group]
Length=470

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GYVRM+RN+KA +G CGIA+E SYP KKG +   
Sbjct  305  AVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKKGEN---  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P P+VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  362  ---PPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCP  408



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 6/109 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYGTE+G DYWIV+NSW + WGE GY+RM+RN+K  TG CGIAME SYPTKKG +    
Sbjct  309  VGYGTEDGKDYWIVRNSWANDWGEAGYIRMERNVKTSTGKCGIAMEPSYPTKKGQN----  364

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
              P  P P+P PP   P VCD + +CP+STTCCCV+ +G+YCFAW CCP
Sbjct  365  --PPNPGPSPFPPVNPPIVCDNYYSCPSSTTCCCVYEYGHYCFAWACCP  411



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIVKNSWG  WGE+GY+RM+R+L  + TG CGIAMEASYP KKG    
Sbjct  304  AVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGIAMEASYPIKKG----  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + ACP S+TCCC+F +  YCF WGCCP
Sbjct  360  --QNPPNPGPSPPSPIKPPTVCDNYYACPESSTCCCIFEYAKYCFQWGCCP  408



>gb|KDO84083.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84084.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=190

 Score =   125 bits (313),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  25   AVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  80

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  81   --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  129



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIVKNSWG  WGE+GY+RM+R+L  + TG CGIAMEASYP KKG    
Sbjct  302  AVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGIAMEASYPIKKG----  357

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + ACP S+TCCC+F +  YCF WGCCP
Sbjct  358  --QNPPNPGPSPPSPIKPPTVCDNYYACPESSTCCCIFEYAKYCFQWGCCP  406



>ref|XP_009420643.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG DYWIVKNSWG+ WGE GY+RM+RN+ + TG CGIAMEASYP K+G     
Sbjct  304  AVGYGSENGKDYWIVKNSWGEDWGEDGYIRMERNIASSTGKCGIAMEASYPIKEG-----  358

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD +  C  STTCCCV+ +G YCFAWGCCP
Sbjct  359  -QNPPNPGPSPPSPVKPPTVCDDYYTCEESTTCCCVYEYGKYCFAWGCCP  407



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN++A TG CGIAMEASYP KKG     
Sbjct  297  AVGYGTENGKDYWIVRNSWGKSWGESGYIKMARNIEASTGKCGIAMEASYPIKKG-----  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD +  CP S+TCCC+F +G YC AWGCCP
Sbjct  352  -QNPPNPGPSPPSPVKPPTVCDNYYTCPESSTCCCLFQYGKYCLAWGCCP  400



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYGTE G DYWIV+NSWG  WGEKGY+RM+RN+ +K GLCGIA+E SYPTK G +    
Sbjct  313  VGYGTEKGKDYWIVRNSWGVSWGEKGYLRMERNVASKDGLCGIAIEPSYPTKTGANP---  369

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
              P P    P+PP   PSVCD +  CP STTCCCV+ +G YCFAWGCCP
Sbjct  370  --PKPGPSPPSPPVAPPSVCDDYYECPESTTCCCVYEYGKYCFAWGCCP  416



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN++A TG CGIAMEASYP KKG     
Sbjct  302  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIEAPTGKCGIAMEASYPIKKG-----  356

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC++ +G YCF WGCCP
Sbjct  357  -QNPPNPGPSPPSPIKPPTTCDKYFSCPESNTCCCLYKYGKYCFGWGCCP  405



>emb|CBI19479.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIVKNSWG  WGE+GY+RM+R+L  + TG CGIAMEASYP KKG    
Sbjct  223  AVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGIAMEASYPIKKG----  278

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + ACP S+TCCC+F +  YCF WGCCP
Sbjct  279  --QNPPNPGPSPPSPIKPPTVCDNYYACPESSTCCCIFEYAKYCFQWGCCP  327



>gb|KDO84077.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=219

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  54   AVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  109

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  110  --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  158



>gb|KDO84078.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84079.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84080.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84081.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84082.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=262

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  97   AVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  152

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  153  --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  201



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYGTENG DYWIV+NSW   WGE GY+RM+RNL   TG CGIA+E SYPTKKG +    
Sbjct  305  VGYGTENGKDYWIVRNSWSSDWGEAGYIRMERNLNTSTGKCGIAIEPSYPTKKGQNP---  361

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                 P P+P  P   P  CDK+ +CP+STTCCCV+ +G++CFAWGCCP
Sbjct  362  ---PNPGPSPPSPVSPPITCDKYFSCPSSTTCCCVYEYGSHCFAWGCCP  407



>gb|KEH44128.1| papain family cysteine protease [Medicago truncatula]
Length=473

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
             VGYGTENG+DYW+V+NSWG  WGE GY++M+RNL  K TG CGIAMEASYP KKG +  
Sbjct  303  VVGYGTENGIDYWLVRNSWGSSWGENGYIKMERNLLTKETGKCGIAMEASYPIKKGQN--  360

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD++ +C A TTCCC+F +GN+CFAWGCCP
Sbjct  361  ----PPNPGPSPPSPVQPSTVCDEYYSCSAGTTCCCLFEYGNFCFAWGCCP  407



>gb|AAC49455.1| Pseudotzain [Pseudotsuga menziesii]
Length=454

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 7/110 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNpp  180
            VGYG+E+G+DYW+VKNSWG+ WGEKG++++QRNL+ A TG+CGIAMEASYP KKG     
Sbjct  297  VGYGSESGIDYWLVKNSWGNSWGEKGFIKLQRNLEGASTGMCGIAMEASYPVKKGA----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP S TCCC++ FG YC+AWGCCP
Sbjct  353  --NPPNPGPSPPSPVKPPTVCDNYYSCPESNTCCCMYDFGGYCYAWGCCP  400



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  303  AVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  358

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  359  --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  407



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
             VGYGTENGVDYW+V+NSWG  WGE GY+RM+RN+ + +TG CGIAMEASYPTKKG + P
Sbjct  302  VVGYGTENGVDYWVVRNSWGPAWGENGYIRMERNVASTETGKCGIAMEASYPTKKGANPP  361

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P P  P    P+PP  S   CD + +CPA +TCCC++P+G+YCF WGCCP
Sbjct  362  NPGPSPPSPVNPSPPPSSE--CDDYYSCPAGSTCCCIYPYGDYCFGWGCCP  410



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG++NG DYWIV+NSWG  WGE GY+RM+RN+KA TG CGIAME SYP KKG +   
Sbjct  304  VVGYGSDNGKDYWIVRNSWGGDWGEAGYIRMERNIKASTGKCGIAMEPSYPIKKGKN---  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD++ +CP +TTCCC++ +G+YCFAWGCCP
Sbjct  361  ---PPHPGPSPPSPVSPPTVCDEYYSCPPATTCCCLYEYGSYCFAWGCCP  407



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGTE  VDYWIV+NSWGD WGEKGY+RMQRN+K+ +GLCGI  E SYP K G +   
Sbjct  302  VVGYGTEKNVDYWIVRNSWGDSWGEKGYIRMQRNVKSASGLCGITSEPSYPVKNGENP--  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P P+P  P   PSVCD++  CPAS+TCCCV+ F N CF WGCCP
Sbjct  360  ----PNPGPSPPSPVKPPSVCDEYYTCPASSTCCCVYEFYNECFEWGCCP  405



>gb|KDO84085.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=244

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  97   AVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  152

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  153  --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  201



>ref|XP_006434710.1| hypothetical protein CICLE_v100010542mg, partial [Citrus clementina]
 gb|ESR47950.1| hypothetical protein CICLE_v100010542mg, partial [Citrus clementina]
Length=307

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+    TG CGIAMEASYP KKG    
Sbjct  142  AVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYPIKKG----  197

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+  P+VCD + +CP S TCCCVF +GN CFAWGCCP
Sbjct  198  --QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCP  246



>dbj|BAH11164.1| cysteine protease [Hordeum vulgare]
Length=462

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYW+V+NSWG  WGE GY+RM+RN+KA +G CGIA+E SYPTK G +   
Sbjct  295  AVGYGTENGKDYWLVRNSWGSVWGENGYIRMERNIKASSGKCGIAVEPSYPTKTGEN---  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+P+ SVC   N CPASTTCCC++ +G  CFAWGCCP
Sbjct  352  ---PPNPGPTPPSPAPTSSVCYSHNECPASTTCCCIYEYGKECFAWGCCP  398



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   TG CGI ME SYPTKKG     
Sbjct  304  AVGYGTENGKDYWIVRNSWGGDWGESGYIRMERNVNISTGKCGITMEPSYPTKKG-----  358

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P+P+P  P   P+VCDK+ +CP+ TTCCCV+ +G  CFAWGCCP
Sbjct  359  -QNPPKPAPSPPSPVNPPTVCDKYYSCPSGTTCCCVYEYGRSCFAWGCCP  407



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  306  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  361  -QNPPNPGPSPPSPIKPPTQCDKYFSCPESNTCCCLFKYGKYCFGWGCCP  409



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  350  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  404

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  405  -QNPPNPGPSPPSPIKPPTQCDKYFSCPESNTCCCLFQYGKYCFGWGCCP  453



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  305  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  360  -QNPPNPGPSPPSPIKPPTQCDKYFSCPESNTCCCLFKYGKYCFGWGCCP  408



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIVKNSWG  WGE+GY++M RN+  + TG CGIAMEASYP KKG    
Sbjct  313  AVGYGTENGVDYWIVKNSWGGSWGEQGYIKMARNVANSPTGKCGIAMEASYPIKKG----  368

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ + NYCFAWGCCP
Sbjct  369  --QNPPNPGPSPPSPVKPPTVCDNYYSCPESNTCCCVYEYANYCFAWGCCP  417



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIVKNSWG  WGE+GY++M RN+  + TG CGIAMEASYP KKG    
Sbjct  313  AVGYGTENGVDYWIVKNSWGGSWGEQGYIKMARNVANSPTGKCGIAMEASYPIKKG----  368

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ + NYCFAWGCCP
Sbjct  369  --QNPPNPGPSPPSPVKPPTVCDNYYSCPESNTCCCVYEYANYCFAWGCCP  417



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY+R++RN+  A TG CGIA+EASYPTKKG +  
Sbjct  293  AVGYGTENGVDYWIVRNSWGPSWGEAGYIRLERNVASANTGKCGIAIEASYPTKKGQNP-  351

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  PP P   PP   P+VCD++ +CP  TTCCC + +GN+CF WGCCP
Sbjct  352  ---PRPPPYPPSPPPVKPPTVCDEYYSCPVGTTCCCAYEYGNHCFGWGCCP  399



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY+R++RN+ +  TG CGIA+EASYPTKKG +  
Sbjct  310  AVGYGTENGVDYWIVRNSWGPNWGEAGYIRLERNVASTNTGKCGIAIEASYPTKKGQN--  367

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P   PSP   PP   P+VCD++ +CP  TTCCC + +GNYCF WGCCP
Sbjct  368  --PPRPLPSPPSPPPVKPPTVCDEYYSCPLGTTCCCAYEYGNYCFGWGCCP  416



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   TG CGIA+E SYP KKG +   
Sbjct  305  AVGYGTENGKDYWIVRNSWGKSWGESGYIRMERNIATATGKCGIAIEPSYPIKKGQN---  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD + +CP STTCCC+F +  YCF WGCCP
Sbjct  362  ---PPNPGPSPPSPIKPPSVCDSYFSCPESTTCCCIFEYAKYCFEWGCCP  408



>ref|XP_010932205.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis]
Length=469

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            A+GYG+ENG  YWIVKNSWG  WGE GY+RM+RN+ + TG CGIAMEASYP K G +   
Sbjct  304  AIGYGSENGKYYWIVKNSWGSDWGESGYIRMERNINSATGKCGIAMEASYPIKNGQN---  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  PS  P+VCD + +CP S TCCCV+ FG+YCFAWGCCP
Sbjct  361  ---PPNPGPSPPSPSKPPTVCDSYYSCPESMTCCCVYEFGSYCFAWGCCP  407



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYW+V+NSWG  WGE GY+RM+RN+ + +TG CGIAMEASYPTKKG + P
Sbjct  313  AVGYGTENGVDYWVVRNSWGPAWGENGYIRMERNVASTETGKCGIAMEASYPTKKGANPP  372

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P P  P    P+PP  S   CD + +CPA +TCCC++ +G+YCF WGCCP
Sbjct  373  NPGPSPPSPVNPSPPPSSE--CDDYYSCPAGSTCCCIYQYGDYCFGWGCCP  421



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRN-LKAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYW+V+NSWG  WGE GY++++RN L +KTG CGIAMEASYP KKG +  
Sbjct  304  AVGYGTENGTDYWLVRNSWGPSWGENGYIKLERNLLTSKTGKCGIAMEASYPIKKGQN--  361

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P PTP  P    +VCD + +C A TTCCC+F +G+YCFAWGCCP
Sbjct  362  ----PPNPGPTPPSPVKPSTVCDDYYSCSAGTTCCCLFEYGSYCFAWGCCP  408



>gb|AAD28476.1|AF133838_1 papain-like cysteine protease [Sandersonia aurantiaca]
Length=370

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E+G DYWIV+NSWG+ WGEKGY+RM RN+ + +G+CGIAMEASYP KKG +   
Sbjct  205  VVGYGSESGKDYWIVRNSWGESWGEKGYIRMARNIDSPSGICGIAMEASYPIKKGQNP--  262

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P P+P  P   PSVCD + +CP S+TCCC+F +G  CFAWGCCP
Sbjct  263  ----PNPGPSPPSPVKPPSVCDNYYSCPESSTCCCLFQYGRSCFAWGCCP  308



>ref|XP_004496966.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Cicer arietinum]
Length=474

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRN-LKAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYW+V+NSWG  WGE GY++++RN L +KTG CGIAMEASYP KKG +  
Sbjct  306  AVGYGTENGTDYWLVRNSWGPSWGENGYIKLERNLLTSKTGKCGIAMEASYPIKKGQN--  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P PTP  P    +VCD + +C A TTCCC+F +G+YCFAWGCCP
Sbjct  364  ----PPNPGPTPPSPVKPSTVCDDYYSCSAGTTCCCLFEYGSYCFAWGCCP  410



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  302  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  356

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC++ +G YCF WGCCP
Sbjct  357  -QNPPNPGPSPPSPIKPPTTCDKYFSCPESNTCCCLYKYGKYCFGWGCCP  405



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYG+ENGVDYWIVKNSWG  WGE+GY+RM+RNL +  TG CGIAM+ASYP K+G    
Sbjct  307  AVGYGSENGVDYWIVKNSWGGSWGEEGYIRMERNLASGLTGKCGIAMQASYPIKQG----  362

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC+F FG YCF WGCCP
Sbjct  363  --QNPPNPGPSPPSPVKPPTVCDGYYSCPESNTCCCLFEFGKYCFEWGCCP  411



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTE G DYWIV+NSWG  WGE GY+RM+RN+ + TG CGIA+E SYP KKG +   
Sbjct  301  AVGYGTEKGKDYWIVRNSWGKSWGESGYIRMERNIASPTGKCGIAIEPSYPIKKGQN---  357

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD + +CP S+TCCC+F +G YCFAWGCCP
Sbjct  358  ---PPNPGPSPPSPVKPPSVCDNYFSCPDSSTCCCIFEYGKYCFAWGCCP  404



>gb|AEV40973.1| putative oryzain beta chain precursor [Oryza punctata]
Length=461

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+ A TG CGIAM ASYPTK G + P 
Sbjct  301  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINATTGKCGIAMMASYPTKSGANPPK  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PP+    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  361  PSPAPPTPPTPPPPAAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  410



>gb|AEV41024.1| putative oryzain beta chain precursor [Oryza minuta]
Length=493

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+ A TG CGIAM ASYPTK G + P 
Sbjct  333  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINATTGKCGIAMMASYPTKSGANPPK  392

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PP+    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  393  PSPTPPTPPTPPPPAAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  442



>gb|ABK24233.1| unknown [Picea sitchensis]
Length=463

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNpp  180
            VGYG+E+G DYWIVKNSWG  WGEKG++R+QRN++   TG+CGIAMEASYP KKG     
Sbjct  297  VGYGSESGTDYWIVKNSWGKSWGEKGFIRLQRNIEGVSTGMCGIAMEASYPLKKGA----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP S TCCC++ FG YC+AWGCCP
Sbjct  353  --NPPNPGPSPPSPVKPPTVCDNYYSCPESNTCCCMYDFGGYCYAWGCCP  400



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  301  AVGYGTENGKDYWIVRNSWGGSWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  356  -QNPPNPGPSPPSPIKPPTQCDKYYSCPESNTCCCLFKYGKYCFGWGCCP  404



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  301  AVGYGTENGKDYWIVRNSWGGSWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  356  -QNPPNPGPSPPSPIKPPTQCDKYYSCPESNTCCCLFKYGKYCFGWGCCP  404



>dbj|BAF01762.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
Length=300

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG  YWIV+NSWG+ WGE GY++M RN++A TG CGIAMEASYP KKG     
Sbjct  139  AVGYGTENGKGYWIVRNSWGNRWGESGYIKMARNIEAPTGKCGIAMEASYPIKKG-----  193

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC++ +G YCF WGCCP
Sbjct  194  -QNPPNPGPSPPSPIKPPTTCDKYFSCPESNTCCCLYKYGKYCFGWGCCP  242



>ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda]
 gb|ERN16692.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda]
Length=538

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTE GV YWIVKNSWG  WGE GY++++RN K+KTG CGIAMEASYP KKG     
Sbjct  373  AVGYGTEKGVHYWIVKNSWGGSWGESGYIKLERNAKSKTGKCGIAMEASYPIKKGD----  428

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P++CD +  CP S TCCCV+ +G YCF+WGCCP
Sbjct  429  --NPPNPGPSPPSPVKPPTMCDNYYTCPESNTCCCVYEYGPYCFSWGCCP  476



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M+RN+   TG CGIA+EASYP KKG     
Sbjct  298  AVGYGTENGKDYWIVRNSWGKSWGESGYIKMERNIAEPTGKCGIAVEASYPIKKG-----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +G YCF WGCCP
Sbjct  353  -QNPPNPGPSPPSPIKPPTQCDKYYSCPESNTCCCLFKYGKYCFGWGCCP  401



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTE G DYWIV+NSWG  WGE GY+RM+RN+ + TG CGIA+E SYP KKG +   
Sbjct  301  AVGYGTEKGKDYWIVRNSWGKSWGESGYIRMERNIASPTGKCGIAIEPSYPIKKGQN---  357

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD + +CP S TCCC+F +G YCFAWGCCP
Sbjct  358  ---PPNPGPSPPSPVKPPSVCDNYFSCPDSNTCCCIFEYGKYCFAWGCCP  404



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM R++ + TG+CGIAMEASYP KKG +   
Sbjct  303  AVGYGTENGKDYWIVRNSWGKSWGENGYLRMARSINSPTGICGIAMEASYPIKKGQN---  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P+P P  P   P+VCD + +CP + TCCC+F +GN+CF WGCCP
Sbjct  360  ---PPNPAPLPPSPVTPPTVCDNYYSCPDNNTCCCLFEYGNFCFEWGCCP  406



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY++++RN+ +  TG CGIA+EASYPTKKG +  
Sbjct  312  AVGYGTENGVDYWIVRNSWGPNWGEAGYIKLERNVASINTGKCGIAIEASYPTKKGQNP-  370

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P PP   P+PP   P+VCD++ +CP  TTCCC + +GNYCF WGCCP
Sbjct  371  ----PRPPPSPPSPPVKPPTVCDEYYSCPMGTTCCCAYEYGNYCFGWGCCP  417



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY++++RN+ +  TG CGIA+EASYPTKKG +  
Sbjct  312  AVGYGTENGVDYWIVRNSWGPNWGEAGYIKLERNVASINTGKCGIAIEASYPTKKGQNP-  370

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P PP   P+PP   P+VCD++ +CP  TTCCC + +GNYCF WGCCP
Sbjct  371  ----PRPPPSPPSPPVKPPTVCDEYYSCPMGTTCCCAYEYGNYCFGWGCCP  417



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT+ G+DYWIV+NSWG  WGEKGY+RMQRNL     G+CGIAME SYP KKG +  
Sbjct  308  VVGYGTDKGLDYWIVRNSWGASWGEKGYIRMQRNLGNTANGICGIAMEPSYPIKKGQN--  365

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +CP S TCCC++ FGNYCF WGCCP
Sbjct  366  ----PPNPGPSPPSPIKPPSVCDNYYSCPESNTCCCIYQFGNYCFDWGCCP  412



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
             VGYGTE+GVDYWIV+NSWG  WGE GY+RM+R++ + +TG CGIAMEASYPTKK  + P
Sbjct  302  TVGYGTEHGVDYWIVRNSWGPAWGENGYIRMERDVASTETGKCGIAMEASYPTKKSANPP  361

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P P  P    P PP    S CD + +CPA +TCCC++ +G+YCF WGCCP
Sbjct  362  NPGPSPPSPVNPPPPEKPSSECDDYYSCPAGSTCCCIYQYGDYCFGWGCCP  412



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG+DYWIV+NSWG  WGE GY+RM+RN+ +  TG CGIAMEASYPTKKG +  
Sbjct  306  AVGYGTENGIDYWIVRNSWGPKWGESGYIRMERNVASTDTGKCGIAMEASYPTKKGQNP-  364

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   P+VCD++ + P +TTCCCV+ +G +CF WGCCP
Sbjct  365  -----PKPGPSPPSPVRPPTVCDEYYSRPEATTCCCVYEYGGFCFGWGCCP  410



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNpp  180
            VGYGTE+GVDYWIV+NSWG  WGE GY+RM+R++ + +TG CGIAMEASYPTKK  + P 
Sbjct  303  VGYGTEHGVDYWIVRNSWGPAWGENGYIRMERDVASTETGKCGIAMEASYPTKKSANPPN  362

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P PP    S CD + +CPA +TCCC++ +G+YCF WGCCP
Sbjct  363  PGPSPPSPVNPPPPEKPSSECDDYYSCPAGSTCCCIYQYGDYCFGWGCCP  412



>dbj|BAH08632.1| daikon cysteine protease RD21 [Raphanus sativus]
Length=289

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+   TG CGIAMEASYP KKG + P 
Sbjct  167  AVGYGTENGKDYWIVRNSWGGSWGESGYIKMARNIAEATGKCGIAMEASYPIKKGQNPPQ  226

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CDK+ +CP   TCCC+F +G YCF WGCCP
Sbjct  227  PGPSPPSPIKPPTQ------CDKYYSCPEGNTCCCLFKYGKYCFGWGCCP  270



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGE GY+RMQRN+    GLCGIA  ASYP K G + P 
Sbjct  309  AVGYGSENGMDYWIVRNSWGASWGENGYLRMQRNIGNPKGLCGIATIASYPVKTGQNPPK  368

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P    P         CD +N CPA TTCCCV+ + NYCFAWGCCP
Sbjct  369  PAPSPPSPVKPPTQ------CDDYNECPAGTTCCCVYKYYNYCFAWGCCP  412



>gb|AIE88288.1| hypothetical protein OG_BBa0063K01.19 [Oryza glaberrima]
Length=479

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  319  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  378

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  379  PSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  428



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGE GY+RMQRN+    GLCGIA  ASYP K G + P 
Sbjct  308  AVGYGSENGMDYWIVRNSWGASWGENGYLRMQRNIGNPKGLCGIATIASYPVKTGQNPPK  367

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P    P         CD +N CPA TTCCCV+ + NYCFAWGCCP
Sbjct  368  PAPSPPSPVKPPTQ------CDDYNECPAGTTCCCVYKYYNYCFAWGCCP  411



>ref|XP_003579458.1| PREDICTED: oryzain beta chain-like [Brachypodium distachyon]
Length=470

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM +SYPTKKG + P 
Sbjct  310  AVGYGTENGKDYWIVRNSWGPKWGEAGYLRMERNINATTGKCGIAMMSSYPTKKGANPPK  369

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PP     VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  370  PSPTPPTPPTPPPPVAPDHVCDENVSCAAGSTCCCAFGFRNMCLVWGCCP  419



>dbj|BAA14403.1| oryzain beta precursor [Oryza sativa Japonica Group]
Length=471

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  305  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  364

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  365  PSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  414



>gb|AAU81588.1| cysteine proteinase, partial [Petunia x hybrida]
Length=173

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWI++NSWG  WGEKGY+R+QRN+ ++ GLCG+A+E SYP K G     
Sbjct  9    AVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASRQGLCGLAIEPSYPVKTG-----  63

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD+++ CP STTCCCVF + + CF+WGCCP
Sbjct  64   -QNPPNPGPSPPSPVTPPTVCDEYSECPESTTCCCVFEYYHSCFSWGCCP  112



>gb|ACI00280.1| triticain beta 2 [Hordeum vulgare]
Length=473

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  313  AVGYGTENGKDYWIVRNSWGPNWGEAGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  372

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  373  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  422



>dbj|BAK03074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  313  AVGYGTENGKDYWIVRNSWGPNWGEAGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  372

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  373  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  422



>ref|NP_001054211.2| Os04g0670200 [Oryza sativa Japonica Group]
 sp|P25777.2|ORYB_ORYSJ RecName: Full=Oryzain beta chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa Japonica Group]
 emb|CAJ86092.1| H0818H01.14 [Oryza sativa Indica Group]
 gb|EAY95991.1| hypothetical protein OsI_17862 [Oryza sativa Indica Group]
 dbj|BAG98700.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF16125.2| Os04g0670200 [Oryza sativa Japonica Group]
Length=466

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  306  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  365

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  366  PSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  415



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGEKGY+RMQRN+    GLCGIA  ASYP K G + P 
Sbjct  309  AVGYGSENGMDYWIVRNSWGASWGEKGYLRMQRNIGNPKGLCGIATIASYPVKTGQNPPK  368

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  PP   PT        CD +N CPA TTCCCV+ +  YCFAWGCCP
Sbjct  369  PAPSPPPVKPPTQ-------CDDYNECPAGTTCCCVYEYYKYCFAWGCCP  411



>gb|EMS68758.1| Oryzain beta chain [Triticum urartu]
Length=472

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  312  AVGYGTENGKDYWIVRNSWGPNWGESGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  371

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  372  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  421



>dbj|BAF02547.1| triticain beta [Triticum aestivum]
Length=472

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  312  AVGYGTENGKDYWIVRNSWGPNWGESGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  371

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  372  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  421



>ref|XP_006652923.1| PREDICTED: oryzain alpha chain-like [Oryza brachyantha]
Length=461

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ NG DYWIVKNSWG  WGE GYVRM+RN+KA +G CGIA+E SYP K G     
Sbjct  294  AVGYGSANGKDYWIVKNSWGASWGESGYVRMERNIKASSGKCGIAVEPSYPLKTG-----  348

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P    +VCD +  CP STTCCC++ +G YC+AWGCCP
Sbjct  349  -ENPPNPGPTPPSPPSPATVCDDYYTCPDSTTCCCIYEYGKYCYAWGCCP  397



>gb|EAZ32359.1| hypothetical protein OsJ_16569 [Oryza sativa Japonica Group]
Length=480

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  320  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  379

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS    VCD   +CPA +TCCC F F N C  WGCCP
Sbjct  380  PSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCP  429



>emb|CAQ00106.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  313  AVGYGTENGKDYWIVRNSWGPNWGEAGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  372

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  373  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  422



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+ENGVDYWIV+NSWG  WGEKGYVRMQRN+K+KTGLCGIA+E SYP K   +   
Sbjct  307  VVGYGSENGVDYWIVRNSWGASWGEKGYVRMQRNIKSKTGLCGIAVEPSYPIKTSQNP--  364

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P P+P  P   PSVCD + +CP S TCCC+F +   C  WGCCP
Sbjct  365  ----PNPGPSPPSPVKPPSVCDDYYSCPESDTCCCIFEYYGECLEWGCCP  410



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENGVDYWIV+NSWG  WGE+GYVRM+RN+++  G CGIA+E SYP KKG     
Sbjct  298  AVGYGSENGVDYWIVRNSWGKNWGEEGYVRMERNIESAAGKCGIAIEPSYPIKKG-----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P VCD +  CP S TCCCV  +G YCF WGCCP
Sbjct  353  -QNPPNPGPSPPSPVKPPVVCDSYTTCPTSNTCCCVLGYGTYCFEWGCCP  401



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+K  +G CGIA+E SYP K G     
Sbjct  298  AVGYGTENGKDYWIVRNSWGTSWGESGYIRMERNIKDSSGKCGIAIEPSYPIKNG-----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  353  -QNPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  401



>dbj|BAF93840.1| triticain beta 2 [Triticum aestivum]
Length=469

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  309  AVGYGTENGKDYWIVRNSWGPNWGEAGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  368

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  369  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  418



>gb|ABK24495.1| unknown [Picea sitchensis]
 gb|ACN40861.1| unknown [Picea sitchensis]
Length=452

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNpp  180
            VGYG+E+G DYW VKNSWG  WGE+G++R+QRN++ A TG+CGIAMEASYP KKG     
Sbjct  294  VGYGSESGTDYWTVKNSWGKSWGEEGFIRLQRNIEVASTGMCGIAMEASYPVKKGA----  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP S TCCC++ FG YC+AWGCCP
Sbjct  350  --NPPNPGPSPPSPIKPPTVCDNYYSCPESNTCCCMYDFGGYCYAWGCCP  397



>gb|AEV41071.1| putative oryzain beta chain precursor [Oryza minuta]
Length=464

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  304  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  363

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS +  VCD   +CP  +TCCC F F N C  WGCCP
Sbjct  364  PSPTPPTPPTPPPPSATDHVCDDNFSCPVGSTCCCAFGFRNLCLVWGCCP  413



>gb|AAU81595.1| cysteine proteinase, partial [Petunia x hybrida]
Length=178

 Score =   119 bits (299),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGEKGY+RMQRN+    GLC IA  ASYP K G + P 
Sbjct  14   AVGYGSENGMDYWIVRNSWGASWGEKGYLRMQRNIAKPAGLCAIAKMASYPVKTGQNPPK  73

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P    P         CD +  CPA TTCCCV+ + +YCFAWGCCP
Sbjct  74   PAPSPPSPIKPPSQ------CDDYYQCPAGTTCCCVYEYHSYCFAWGCCP  117



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ + +G CGIA+E SYP K G + P 
Sbjct  299  AVGYGTENGKDYWIVKNSWGASWGESGYIRMERNIASSSGKCGIAIEPSYPIKNGANPPN  358

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  359  PGPSPPSPIKPPTQ------CDSYYTCPESNTCCCLFEYGKYCFAWGCCP  402



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
             +GYGTENGVDYW V+NSWG  WGE GY+RM+RNL  A  G CGIAME+SYP KKG    
Sbjct  309  VIGYGTENGVDYWKVRNSWGPSWGENGYIRMERNLAGASHGKCGIAMESSYPIKKG----  364

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
              +PP+P    P+PP   P+VCD++ +CP S+TCCC++ +G YCFAWGCCP
Sbjct  365  -QNPPNPGPSPPSPPVKPPAVCDEYYSCPESSTCCCIYEYGKYCFAWGCCP  414



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  301  AVGYGTENGKDYWIVRNSWGGSWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP   TCCC+F +G YCF WGCCP
Sbjct  356  -QNPPNPGPSPPSPIKPPTQCDKYYSCPEGNTCCCLFKYGKYCFGWGCCP  404



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+   TG CGIAMEASYP KKG     
Sbjct  301  AVGYGTENGKDYWIVRNSWGGSWGESGYIKMARNIAEPTGKCGIAMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP   TCCC+F +G YCF WGCCP
Sbjct  356  -QNPPNPGPSPPSPIKPPTQCDKYYSCPEGNTCCCLFKYGKYCFGWGCCP  404



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNpp  180
            VGYG+ENGVDYWIV+NSWG  WGE+GY+RM+RNL +   G CGIAMEASYP KKG     
Sbjct  308  VGYGSENGVDYWIVRNSWGSSWGEEGYIRMERNLASTDNGKCGIAMEASYPIKKG-----  362

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD + +CP S TCCCV+ FG++CFAWGCCP
Sbjct  363  -QNPPNPGPSPPSPVTPPTVCDGYYSCPESNTCCCVYQFGSFCFAWGCCP  411



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG E+G++YWIVKNSWG+ WGEKGY+RM+RN K  TGLCGIAMEASYP K G +   
Sbjct  301  AVGYGEEDGMEYWIVKNSWGESWGEKGYIRMERNTKY-TGLCGIAMEASYPIKDGMNP--  357

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P P+P  P   PSVCD + +CP   TCCC++ + NYCF+WGCCP
Sbjct  358  ----PNPGPSPPSPVQPPSVCDSYYSCPEGDTCCCIYEYANYCFSWGCCP  403



>gb|AEV41117.1| putative oryzain beta chain precursor [Oryza officinalis]
Length=465

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GYVRM+RN+   TG CGIAM ASYPTK G + P 
Sbjct  305  AVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTKSGANPPK  364

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P  PTP PPS    VCD   +CP  +TCCC F F N C  WGCCP
Sbjct  365  PSPTPPTPPTPPPPSAPDHVCDDNFSCPVGSTCCCAFGFRNLCLVWGCCP  414



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ A  G CGIA+E SYP K G     
Sbjct  298  AVGYGTENGKDYWIVKNSWGSSWGESGYIRMERNIAASAGKCGIAVEPSYPIKNG-----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F FG YC +WGCCP
Sbjct  353  -QNPPNPGPSPPSPIKPPTQCDSYYTCPQSNTCCCLFEFGKYCLSWGCCP  401



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            A GYGTE+G DYW+VKNSWG  WGE GY++M+RN+  K+G CGIAMEASYP  K GDN  
Sbjct  304  AAGYGTEDGKDYWLVKNSWGAEWGEGGYLKMERNIADKSGKCGIAMEASYPI-KNGDN--  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P+    VCD+++ CP STTCCC++ +  YCFAWGCCP
Sbjct  361  ---PPNPGPTPPSPAAPEVVCDEYSTCPESTTCCCIYEYYGYCFAWGCCP  407



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 77/111 (69%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE GY+R++RNL    TG CGIA+EASYP K G  N 
Sbjct  298  AVGYGTENGKDYWIVRNSWGSSWGENGYIRLERNLANTTTGKCGIAVEASYPVKNGDTN-  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P+P+P  P    +VCD +  CP  TTCCCV+ +G YCF WGCCP
Sbjct  357  ----PPKPAPSPPTPVKPATVCDDYYTCPEGTTCCCVYEYGKYCFGWGCCP  403



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG  YWIV+NSWG  WGE GY+RM+R++ A  G CGIAMEASYPTKKG     
Sbjct  308  AVGYGTENGKGYWIVRNSWGGDWGESGYIRMERDVNASAGKCGIAMEASYPTKKG-----  362

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD   +CP+ TTCCCV  FG  CFAWGCCP
Sbjct  363  -QNPPNPGPSPPSPVNPPAVCDSSYSCPSGTTCCCVSEFGRRCFAWGCCP  411



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GY+RM+RNL   TG CGIAMEASYP K G +   
Sbjct  305  AVGYGTQNGEDYWIVRNSWGGDWGEAGYIRMERNLNTSTGKCGIAMEASYPIKNGEN---  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P   P+VCD +  CP+ TTCCCV+ +G  CFAWGCCP
Sbjct  362  ---PPNPGPTPPSPVSPPTVCDNYYTCPSHTTCCCVYEYGGTCFAWGCCP  408



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY++++RN+ +  TG CGIA+EASYPTKKG +  
Sbjct  299  AVGYGTENGVDYWIVRNSWGPSWGEAGYIKLERNVASTNTGKCGIAIEASYPTKKGQN--  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  PPSP   PP     VCD + +CP  TTCCC + +GN CF WGCCP
Sbjct  357  --PPRPPPSPPSPPPVKPTIVCDDYYSCPVGTTCCCTYEYGNLCFGWGCCP  405



>gb|EMT10724.1| Oryzain beta chain [Aegilops tauschii]
Length=401

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GY+RM+RN+   +G CGIAM +SYPTKKG + P 
Sbjct  241  AVGYGTDNGKDYWIVRNSWGPNWGEAGYLRMERNINVTSGKCGIAMMSSYPTKKGANPPK  300

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P  PTP PP     VCD+  +CPA +TCCC F F N C  WGCCP
Sbjct  301  PAPTPPSPPTPPPPVAPDHVCDENFSCPAGSTCCCSFGFRNLCLVWGCCP  350



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT++G+DYWIV+NSWG  WGE+GY+RMQRNL     G+CGIAME SYP KKG +  
Sbjct  311  VVGYGTDDGLDYWIVRNSWGGSWGEEGYIRMQRNLGNTANGICGIAMEPSYPIKKGQN--  368

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD   +CP S TCCC++ + NYCFAWGCCP
Sbjct  369  ----PPNPGPSPPSPVKPPSVCDNHYSCPESNTCCCIYEYANYCFAWGCCP  415



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGV+YWIV+NSWG  WGE GY+RM+RN+   KTG CGIA++ SYPTKKG + P
Sbjct  302  AVGYGTENGVNYWIVRNSWGSAWGESGYIRMERNVANTKTGKCGIAIQPSYPTKKGANPP  361

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P P  P    P PP    +VCD + +CP   TCCC++ +  YCF WGCCP
Sbjct  362  NPGPSPPSPVNPPPPVSPSTVCDDYFSCPDGNTCCCIYEYSGYCFGWGCCP  412



>ref|XP_008452589.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=495

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E GVDYWIV+NSWG  WGE GYVRMQRN+ + TGLCGIAME SYPTK       
Sbjct  328  VVGYGSEGGVDYWIVRNSWGANWGESGYVRMQRNIDSPTGLCGIAMEPSYPTKS------  381

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P   PSVCD++  CPA+ TCCC+F F N C  WGCCP
Sbjct  382  GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAETCCCIFEFSNLCLEWGCCP  431



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+   TG CGIA+EASYP KKG + P 
Sbjct  307  AVGYGTENGKDYWIVRNSWGGNWGESGYIRMARNIAEPTGKCGIAVEASYPIKKGQNPPN  366

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CDK+  CP S TCCC++ +G YCF WGCCP
Sbjct  367  PGPSPPSPIKPPTK------CDKYFTCPESNTCCCLYKYGKYCFGWGCCP  410



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGTE+G DYWIV+NSWGD WGE GY+RM+RNL  + TG CGIAME SYP K G    
Sbjct  304  VVGYGTEHGSDYWIVRNSWGDSWGESGYIRMERNLGNSATGKCGIAMEPSYPVKIG----  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  360  --QNPPNPGPSPPSPIKPPQVCDNYFSCPESNTCCCIYQYQNYCFAWGCCP  408



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT++G+DYWIV+NSWG  WGE+GY+RMQRNL     G+CGIAME SYP K+G +  
Sbjct  310  VVGYGTDDGLDYWIVRNSWGGSWGEEGYIRMQRNLGNTANGICGIAMEPSYPIKEGQN--  367

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  368  ----PPNPGPSPPSPVKPPSVCDNYYSCPESNTCCCIYEYANYCFAWGCCP  414



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT+ GVDYWIV+NSWG  WGE+GY+RM+RNL     G+CGIAMEASYP K G    
Sbjct  308  VVGYGTDKGVDYWIVRNSWGGSWGEEGYIRMERNLGNTAHGICGIAMEASYPVKSG----  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  364  --LNPPNPGPSPPSPVQPPSVCDNYYSCPESNTCCCIYEYANYCFAWGCCP  412



>gb|AAD56028.1|AF181567_1 cysteine protease CYP1 [Solanum chacoense]
Length=210

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
              GYGTENG+DYWIV+NSWG  WGEKGY+R+QRN+   +GLCG+A+E SYP K G + P 
Sbjct  97   VAGYGTENGMDYWIVRNSWGANWGEKGYLRVQRNVARSSGLCGLAIEPSYPVKTGANPPK  156

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P    P         CD+++ CP  TTCCC+  F N CF+WGCCP
Sbjct  157  PTPSPPSPVKPPTE------CDEYSQCPIGTTCCCILQFHNSCFSWGCCP  200



>dbj|BAD29954.1| cysteine protease [Daucus carota]
Length=474

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYG+ENG DYWIV+NSWG  WGE GY+R++RN+ +  TG CGIAM+ASYPTK  GDN 
Sbjct  314  AVGYGSENGKDYWIVRNSWGPDWGESGYIRLERNVASTSTGKCGIAMQASYPTKT-GDN-  371

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD + +CP STTCCC++  G YCF WGCCP
Sbjct  372  ----PPKPGPSPPSPVKPQTVCDDYYSCPESTTCCCLYEIGQYCFGWGCCP  418



>dbj|BAE98640.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=202

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGIA+E SYP K G     
Sbjct  41   AVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNG-----  95

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  96   -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  144



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT+ GVDYWIV+NSWG  WGE+GY+RM+RNL     G+CGIAMEASYP K G    
Sbjct  308  VVGYGTDKGVDYWIVRNSWGGSWGEEGYIRMERNLGNTAHGICGIAMEASYPVKSG----  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  364  --LNPPNPGPSPPSPVQPPSVCDNYYSCPESNTCCCIYEYANYCFAWGCCP  412



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT+ G+DYWIV+NSWG+ WGEKGY+RMQRNL     G+CGIAME SYP K G    
Sbjct  308  VVGYGTDKGLDYWIVRNSWGESWGEKGYIRMQRNLGNTANGICGIAMEPSYPIKNG----  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P      P    SVCD++ +CP S TCCC++  G YCF WGCCP
Sbjct  364  -----QNPPNPGPSPPSPISVCDEYYSCPESNTCCCIYQIGTYCFTWGCCP  409



>ref|XP_008357442.1| PREDICTED: oryzain alpha chain-like, partial [Malus domestica]
Length=381

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGT+ G+DYWIV+NSWG  WGEKGY+RMQRNL     G+CGIAME SYP KKG +  
Sbjct  217  VVGYGTDKGLDYWIVRNSWGASWGEKGYIRMQRNLGNTANGICGIAMEPSYPIKKGQN--  274

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +CP S TCCC++  GNYCF WGCCP
Sbjct  275  ----PPNPGPSPPSPIKPPSVCDNYYSCPESNTCCCIYQXGNYCFDWGCCP  321



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG+ WGE+GY+RM+RNL    TG CGIA+EASYP K G    
Sbjct  287  AVGYGTENGKDYWIVRNSWGNQWGEEGYIRMERNLANTATGKCGIAIEASYPIKNG----  342

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ +  YCFAWGCCP
Sbjct  343  --QNPPNPGPSPPSPIKPPTVCDNYYSCPESNTCCCVYEYYGYCFAWGCCP  391



>dbj|BAH20390.1| AT1G47128 [Arabidopsis thaliana]
Length=178

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGIA+E SYP K G     
Sbjct  17   AVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNG-----  71

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  72   -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  120



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGTENG DYWIV+NSWG  WGE GY+RM+R + +KTG+CGIA+E SYP K G     
Sbjct  297  VVGYGTENGKDYWIVRNSWGADWGENGYLRMERGISSKTGICGIAIEPSYPVKTG-----  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P    SVCD++  CP STTCCC++ +  YCFAWGCCP
Sbjct  352  -VNPPNPGPSPPTPKTPESVCDEYYTCPMSTTCCCMYEYYGYCFAWGCCP  400



>ref|XP_002448736.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
 gb|EES13064.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
Length=467

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +   
Sbjct  310  AVGYGTENGKDYWIVRNSWGPKWGEAGYIRMERNINATTGKCGIAMMASYPTKKGAN---  366

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  PSP  PTP PP     VCD+   C A +TCCC F F N C  WGCCP
Sbjct  367  PPKPSPTPPTPPPPVAPDHVCDENFVCSAGSTCCCAFGFRNVCLVWGCCP  416



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG+ WGE+GY+RM+RNL    TG CGIA+EASYP K G    
Sbjct  302  AVGYGTENGKDYWIVRNSWGNQWGEEGYIRMERNLANTATGKCGIAIEASYPIKNG----  357

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ +  YCFAWGCCP
Sbjct  358  --QNPPNPGPSPPSPIKPPTVCDNYYSCPESNTCCCVYEYYGYCFAWGCCP  406



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +  P
Sbjct  364  AVGYGTENGKDYWIVRNSWGAKWGEDGYIRMERNVNATTGKCGIAMMASYPTKKGAN--P  421

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P   P   P PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  422  PKPSPTPPTPPPPPVAPDNVCDENFSCAAGSTCCCAFGFRNVCLVWGCCP  471



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG+ WGE+GY+RM+RNL    TG CGIA+EASYP K G    
Sbjct  302  AVGYGTENGKDYWIVRNSWGNQWGEEGYIRMERNLANTATGKCGIAIEASYPIKNG----  357

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ +  YCFAWGCCP
Sbjct  358  --QNPPNPGPSPPSPIKPPTVCDNYYSCPESNTCCCVYEYYGYCFAWGCCP  406



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +  P
Sbjct  307  AVGYGTENGKDYWIVRNSWGAKWGEDGYIRMERNVNATTGKCGIAMMASYPTKKGAN--P  364

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P   P   P PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  365  PKPSPTPPTPPPPPVAPDNVCDENFSCAAGSTCCCAFGFRNVCLVWGCCP  414



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GY++++RN+ +  TG CGIA+EASYP+K+G +  
Sbjct  309  AVGYGTENGVDYWIVRNSWGPSWGEAGYIKLERNVASTNTGKCGIAIEASYPSKQGQN--  366

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  PPSP   PP     VCD + +CP  TTCCC + +GN+CF WGCCP
Sbjct  367  --PPRPPPSPPSPPPVKPTIVCDDYYSCPLGTTCCCTYEYGNFCFGWGCCP  415



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +  P
Sbjct  304  AVGYGTENGKDYWIVRNSWGAKWGEDGYIRMERNVNATTGKCGIAMMASYPTKKGAN--P  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P   P   P PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  362  PKPSPTPPTPPPPPVAPDNVCDENFSCAAGSTCCCAFGFRNVCLVWGCCP  411



>gb|AAP41847.1| senescence-associated cysteine protease [Anthurium andraeanum]
Length=460

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE+G DYWIV+NSWG  WGE GY+RM+RNL  + +G CGIA+E SYP KKG + P
Sbjct  294  AVGYGTESGKDYWIVRNSWGKSWGEAGYIRMERNLPSSSSGKCGIAIEPSYPIKKGQNPP  353

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P+P  P    P         CD + +CP STTCCCV+ +G YCFAWGCCP
Sbjct  354  KPAPSPPSPVKPPTE------CDNYYSCPESTTCCCVYEYGKYCFAWGCCP  398



>dbj|BAD95392.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=433

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGIA+E SYP K G     
Sbjct  301  AVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  356  -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  404



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  296  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  351  -QNPPNPGPSPPSPVTPPTQCDSYYTCPESNTCCCLFDYGKYCLAWGCCP  399



>emb|CDY17044.1| BnaA08g04080D [Brassica napus]
Length=459

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTE+G DYWIVKNSWG  WGE GY+RM+RN+ A  G CGIA+E SYP K G     
Sbjct  298  AVGYGTESGKDYWIVKNSWGSSWGESGYIRMERNIAASAGKCGIAVEPSYPIKNG-----  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F FG YC +WGCCP
Sbjct  353  -QNPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEFGKYCLSWGCCP  401



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGIA+E SYP K G     
Sbjct  301  AVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  356  -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  404



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  296  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  351  -QNPPNPGPSPPSPVKPPTQCDSYYTCPESNTCCCLFDYGKYCLAWGCCP  399



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGIA+E SYP K G     
Sbjct  301  AVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  356  -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  404



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  290  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  344

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  345  -QNPPNPGPSPPSPVKPPTQCDSYYTCPESNTCCCLFDYGKYCLAWGCCP  393



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +  P
Sbjct  307  AVGYGTENGKDYWIVRNSWGAKWGEDGYIRMERNVNATTGKCGIAMMASYPTKKGAN--P  364

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P   P   P PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  365  PKPSPTPPTPPPPPVAPDNVCDENFSCAAGSTCCCAFGFRNVCLVWGCCP  414



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  290  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  344

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  345  -QNPPNPGPSPPSPVTPPTQCDSYYTCPESNTCCCLFDYGKYCLAWGCCP  393



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG+ WGE GY++M RN+   TG CGIA+EASYP KKG     
Sbjct  306  AVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIAEPTGKCGIAIEASYPIKKG-----  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP S TCCC+F +  YCF W CCP
Sbjct  361  -QNPPNPGPSPPSPIKPPTQCDKYFSCPESNTCCCLFKYRKYCFGWECCP  409



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  296  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  351  -QNPPNPGPSPPSPVKPPTQCDSYYTCPESNTCCCLFDYGKYCLAWGCCP  399



>gb|KGN55227.1| hypothetical protein Csa_4G641600 [Cucumis sativus]
Length=459

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E GVDYWIV+NSWG  WGE GYV+MQRN+ + TGLCGIAME SYPTK       
Sbjct  292  VVGYGSEGGVDYWIVRNSWGGSWGESGYVKMQRNIASPTGLCGIAMEPSYPTKT------  345

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P   PSVCD++  CPA+ TCCC+F F N C  WGCCP
Sbjct  346  GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAETCCCIFQFSNLCLEWGCCP  395



>ref|XP_004169515.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=459

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E GVDYWIV+NSWG  WGE GYV+MQRN+ + TGLCGIAME SYPTK       
Sbjct  292  VVGYGSEGGVDYWIVRNSWGGSWGESGYVKMQRNIASPTGLCGIAMEPSYPTKT------  345

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P   PSVCD++  CPA+ TCCC+F F N C  WGCCP
Sbjct  346  GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAETCCCIFQFSNLCLEWGCCP  395



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT-GLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  WGE GYVRM+RNL A   G CGI M++SYP KKG    
Sbjct  309  AVGYGTENGVDYWIVRNSWGKSWGESGYVRMERNLAASVAGKCGIVMQSSYPIKKG----  364

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VC ++++C +STTCCCVF  G  CF+WGCCP
Sbjct  365  --QNPPNPGPSPPSPVNPPNVCSRYHSCASSTTCCCVFGIGKLCFSWGCCP  413



>dbj|BAD29956.1| cysteine protease [Daucus carota]
Length=423

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKA-KTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE+G DYWIV+NSWG  WGE GY+R++RN+ +  TG CGIAM+ SYPTK G    
Sbjct  257  AVGYGTEDGKDYWIVRNSWGPNWGENGYIRLERNVASTNTGKCGIAMQPSYPTKTG----  312

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    SVCD +  CPASTTCCCV+ +G YCF WGCCP
Sbjct  313  --VNPPKPGPSPPSPVKPQSVCDDYYTCPASTTCCCVYEYGKYCFGWGCCP  361



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 76/110 (69%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTEN VDYWIVKNSWG  WGE GY+RM+RN  A TG CGIA+E SYP K       
Sbjct  298  AVGYGTENSVDYWIVKNSWGSSWGESGYIRMERNTGA-TGKCGIAVEPSYPIK------T  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+VCD +  CP S+TCCCV+ +G YCFAWGCCP
Sbjct  351  SQNPPNPGPSPPSPIKPPTVCDDYYTCPESSTCCCVYEYGKYCFAWGCCP  400



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            A GYG+ENG+DYWIV+NSWG  WGEKGY+R+QRN+ + +GLCG+A E SYP K G + P 
Sbjct  302  AAGYGSENGMDYWIVRNSWGAKWGEKGYLRVQRNVASSSGLCGLATEPSYPVKTGANPPK  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P  P    P         CD+++ CP  TTCCCV  F   CF+WGCCP
Sbjct  362  PAPSPPSPVKPPTE------CDEYSQCPVGTTCCCVLEFRRSCFSWGCCP  405



>gb|KJB14608.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=341

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  185  AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  240

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  241  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  289



>ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
 gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
Length=509

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M+RN+ +  G CGIA+E SYP K G     
Sbjct  348  AVGYGTENGKDYWIVRNSWGKSWGESGYLKMERNIASSAGKCGIAIEPSYPVKNG-----  402

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  403  -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  451



>ref|XP_004960237.1| PREDICTED: oryzain beta chain-like isoform X2 [Setaria italica]
Length=461

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG   P 
Sbjct  304  AVGYGTENGKDYWIVRNSWGPNWGESGYIRMERNINAITGKCGIAMMASYPTKKG---PN  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  PSP  PTP PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  361  PPKPSPTPPTPPPPVAPDNVCDENYSCSAGSTCCCAFGFRNVCLVWGCCP  410



>emb|CDY25228.1| BnaC02g30040D [Brassica napus]
Length=460

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTE+G DYWIV+NSWG  WGE GY++M RN+   TG CGI MEASYP KKG     
Sbjct  301  AVGYGTEDGKDYWIVRNSWGGSWGESGYIKMARNIAEPTGKCGITMEASYPIKKG-----  355

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CDK+ +CP   TCCC+F +G YCF WGCCP
Sbjct  356  -QNPPNPGPSPPSPIKPPTKCDKYYSCPEGNTCCCLFKYGKYCFGWGCCP  404



>ref|XP_004141271.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=458

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E GVDYWIV+NSWG  WGE GYV+MQRN+ + TGLCGIAME SYPTK       
Sbjct  291  VVGYGSEGGVDYWIVRNSWGGSWGESGYVKMQRNIASPTGLCGIAMEPSYPTKT------  344

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P PTP  P   PSVCD++  CPA+ TCCC+F F N C  WGCCP
Sbjct  345  GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAETCCCIFQFSNLCLEWGCCP  394



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  301  AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  357  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  405



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIVKNSWG  WGE GY+RM+RN+ +  G CGIA+E SYP K G     
Sbjct  296  AVGYGTENGKDYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIKNG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YC AWGCCP
Sbjct  351  -QNPPNPGPSPPSPVTPPTQCDSYYTCPESNTCCCLFGYGKYCLAWGCCP  399



>ref|XP_007145379.1| hypothetical protein PHAVU_007G234100g [Phaseolus vulgaris]
 gb|ESW17373.1| hypothetical protein PHAVU_007G234100g [Phaseolus vulgaris]
Length=460

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGTENG DYW+V+NSWG  WGE GY+++QRN+ ++TG CGIAMEASYPTK G     
Sbjct  297  VVGYGTENGTDYWLVRNSWGPAWGENGYIKLQRNVNSETGKCGIAMEASYPTKSG-----  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             + P  P P+P  P+   +VCD++ +C   TTCCC+F +  +CF WGCCP
Sbjct  352  -ANPPNPGPSPPAPAAPSTVCDEYYSCSPGTTCCCLFEYRGFCFGWGCCP  400



>ref|XP_004960236.1| PREDICTED: oryzain beta chain-like isoform X1 [Setaria italica]
Length=489

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG   P 
Sbjct  304  AVGYGTENGKDYWIVRNSWGPNWGESGYIRMERNINAITGKCGIAMMASYPTKKG---PN  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  PSP  PTP PP    +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  361  PPKPSPTPPTPPPPVAPDNVCDENYSCSAGSTCCCAFGFRNVCLVWGCCP  410



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  7    GYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppps  186
            GYGTENG+DYWI++NSWG  WGEKGY+R+QRN+   +GLCG+A+E SYP K G + P P+
Sbjct  304  GYGTENGMDYWIIRNSWGAKWGEKGYLRVQRNVARSSGLCGLAIEPSYPVKTGANPPKPA  363

Query  187  ppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  P    P         CD+ + CP  TTCCC+  F N CF+WGCCP
Sbjct  364  PSPPSPVKPPTE------CDESSQCPVGTTCCCILQFHNSCFSWGCCP  405



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYG+E+G DYWIV+NSWG  WGE GY+RM+RNL     G CGIAMEASYP KKG    
Sbjct  308  AVGYGSEDGKDYWIVRNSWGLSWGEDGYIRMERNLAGTANGKCGIAMEASYPIKKG----  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ +G YCF+WGCCP
Sbjct  364  --QNPPNPGPSPPSPIKPPAVCDNYYSCPDSNTCCCLYEYGKYCFSWGCCP  412



>ref|XP_010500237.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M+RN+ +  G CGIA+E SYP K G + P 
Sbjct  301  AVGYGTENGKDYWIVRNSWGKSWGESGYLKMERNIASSAGKCGIAIEPSYPVKNGANPPN  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CD +  CP + TCCC+F +G YCFAWGCCP
Sbjct  361  PGPSPPSPIKPPTQ------CDSYYTCPDTATCCCLFEYGKYCFAWGCCP  404



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWI++NSWG  WGEKGY+R+QRN+ +  GLCG+A+E SYP K G + P 
Sbjct  302  AVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASSKGLCGLAIEPSYPVKTGVNPPK  361

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            PSP  P    P         CD +  CP  TTCCCVF + N CF+WGCCP
Sbjct  362  PSPSPPSPIKPPTQ------CDDYAQCPEGTTCCCVFEYYNSCFSWGCCP  405



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWI++NSWG  WGEKGY+R+QRN+ +  GLCG+A+E SYP K G + P 
Sbjct  306  AVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASSKGLCGLAIEPSYPVKTGVNPPK  365

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CD +  CP  TTCCCVF + N CF+WGCCP
Sbjct  366  PGPSPPSPIKPPTQ------CDDYAQCPEGTTCCCVFEYYNSCFSWGCCP  409



>ref|XP_010479116.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=462

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            A+GYGTENG DYWIV+NSWG  WGE GY++M+RN+ + +G CGIA+E SYP K G + P 
Sbjct  301  AIGYGTENGKDYWIVRNSWGKSWGESGYLKMERNIASSSGKCGIAIEPSYPVKNGANPPN  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CD +  CP + TCCC+F +G YCFAWGCCP
Sbjct  361  PGPSPPSPIKPPTQ------CDSYYTCPDTATCCCLFEYGKYCFAWGCCP  404



>ref|NP_001150196.1| cysteine protease 1 precursor [Zea mays]
 gb|ACF84983.1| unknown [Zea mays]
 gb|ACF86484.1| unknown [Zea mays]
 gb|ACG38208.1| cysteine protease 1 precursor [Zea mays]
 gb|AFW59827.1| cysteine protease 1 [Zea mays]
Length=470

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG ENG DYWIV+NSWG  WGE GY+RM+RN+ A TG CGIAM ASYPTKKG +   
Sbjct  315  AVGYGAENGKDYWIVRNSWGPKWGEAGYIRMERNVNASTGKCGIAMMASYPTKKGAN---  371

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
              PP P    PTPP+   +VCD+  +C A +TCCC F F N C  WGCCP
Sbjct  372  --PPRPSPTPPTPPAAPDNVCDENFSCSAGSTCCCAFGFRNVCLVWGCCP  419



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYW V+NSWG  WGE GY+R++RN+    TG CGIA+E SYP K G +  
Sbjct  296  AVGYGTENGVDYWTVRNSWGPSWGENGYIRLERNVANVTTGKCGIAIEPSYPVKTGANP-  354

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   PSVCD +  CP ++TCCCV+ +GNYCF WGCCP
Sbjct  355  -----PNPGPSPPSPVKPPSVCDDYYTCPEASTCCCVYEYGNYCFGWGCCP  400



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENG DYWIV+NSWG  WGE GY++M RN+ + +G CGIA+E SYP K G     
Sbjct  294  AVGYGTENGKDYWIVRNSWGKSWGESGYLKMARNIASSSGKCGIAIEPSYPIKNG-----  348

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP S TCCC+F +G YCFAWGCCP
Sbjct  349  -ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCP  397



>gb|KJB14607.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=253

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  97   AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  152

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  153  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  201



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYG+++G DYWIV+NSWG  WGE GY+RM+RNL+  KTG CGIA+E SYP K   ++ 
Sbjct  311  AVGYGSDDGKDYWIVRNSWGADWGESGYIRMERNLETVKTGKCGIAIEPSYPIK---NSQ  367

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P  P P  P+P  P+ +   CD++  CP+STTCCCV+ +G YCFAWGCCP
Sbjct  368  NPPNPGPTPPSPPSPASADVTCDEYYTCPSSTTCCCVYEYGPYCFAWGCCP  418



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  301  AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  357  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  405



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGTE+G+DYWIV+NSWGD WGE GY+RMQRN K  +G+CGIA+E SYP K G     
Sbjct  296  VVGYGTEDGLDYWIVRNSWGDTWGEGGYIRMQRNTKLPSGICGIAIEPSYPIKSG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   PSVCD   +C   TTCCC+F + +YC++WGCCP
Sbjct  351  -LNPPNPGPSPPSPVQPPSVCDDNYSCAERTTCCCLFEYAHYCYSWGCCP  399



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAK-TGLCGIAMEASYPTKKGGDNp  177
             VGYGTENG+DYWIV+NSWG  WGE GY+RM+RNL +  TG CGIA+E SYP KKG    
Sbjct  298  VVGYGTENGLDYWIVRNSWGSNWGEDGYIRMERNLASTPTGKCGIAIEPSYPIKKG----  353

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +C  S TCCCVF +G YCF+WGCCP
Sbjct  354  --QNPPNPGPSPPSPVKPPTVCDNYYSCADSDTCCCVFEWGRYCFSWGCCP  402



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  301  AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  357  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  405



>gb|KJB14606.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=303

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE GY+RM RN+    TG CGIAMEASYP K G    
Sbjct  147  AVGYGTEKGKDYWIVKNSWGSSWGEAGYIRMARNVANTVTGKCGIAMEASYPIKTG----  202

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCC++ + NYCFAWGCCP
Sbjct  203  --ENPPNPGPSPPSPIKPPTVCDSYYSCPESNTCCCIYEYYNYCFAWGCCP  251



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG+ WGE+GY+RM+RNL    TG CGIA+EASYP K G    
Sbjct  302  AVGYGTENGKDYWIVRNSWGNQWGEEGYIRMERNLANTATGKCGIAIEASYPIKNG----  357

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP S TCCCV+ +  YCFAWGCCP
Sbjct  358  --QNPPNPGPSPPSPIKPPTVCDNYYSCPESNTCCCVYEYYGYCFAWGCCP  406



>ref|XP_010461511.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 73/110 (66%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            A+GYGTENG DYWIV+NSWG  WGE GY++M+RN+ +  G CGIA+E SYP K G + P 
Sbjct  301  AIGYGTENGKDYWIVRNSWGKSWGESGYLKMERNIASSAGKCGIAIEPSYPVKNGANPPN  360

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P P  P    P         CD +  CP + TCCC+F +G YCFAWGCCP
Sbjct  361  PGPSPPSPVKPPTQ------CDSYYTCPDTATCCCLFEYGKYCFAWGCCP  404



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+  +DYWIV+NSWG  WGE GY+RM+RN+  KTG CGIA+E SYP KKG    P
Sbjct  309  AVGYGTDGHLDYWIVRNSWGPDWGESGYIRMERNVNTKTGKCGIAIEPSYPIKKG--QNP  366

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P   P     PP  SP+VCD +  CP+ +TCCC++ +G++CF WGCCP
Sbjct  367  PNPGPSPPSPVNPPPSSPTVCDDYYTCPSGSTCCCMYEYGDFCFGWGCCP  416



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+  +DYWIV+NSWG  WGE GY+RM+RN+  KTG CGIA+E SYP KKG    P
Sbjct  302  AVGYGTDGHLDYWIVRNSWGPDWGESGYIRMERNVNTKTGKCGIAIEPSYPIKKG--QNP  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P   P     PP  SP+VCD +  CP+ +TCCC++ +G++CF WGCCP
Sbjct  360  PNPGPSPPSPVNPPPSSPTVCDDYYTCPSGSTCCCMYEYGDFCFGWGCCP  409



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+  +DYWIV+NSWG  WGE GY+RM+RN+  KTG CGIA+E SYP KKG    P
Sbjct  302  AVGYGTDGHLDYWIVRNSWGPDWGESGYIRMERNVNTKTGKCGIAIEPSYPIKKG--QNP  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P+P   P     PP  SP+VCD +  CP+ +TCCC++ +G++CF WGCCP
Sbjct  360  PNPGPSPPSPVNPPPSSPTVCDDYYTCPSGSTCCCMYEYGDFCFGWGCCP  409



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGTENG DYWIV+NSWG  WGEKGY+RM+R + +K G+CGI  E SYP K G     
Sbjct  296  VVGYGTENGKDYWIVRNSWGADWGEKGYLRMERGISSKAGICGITSEPSYPVKSG-----  350

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P    SVCD++  CP STTCCC++ +  YCFAWGCCP
Sbjct  351  -VNPPNPGPSPPSPKSPESVCDEYYTCPMSTTCCCMYEYYGYCFAWGCCP  399



>ref|NP_566633.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB02463.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAL32803.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAM13349.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AEE76234.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=452

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E G DYWIV+NSWG  WGE GY +++RN+K  +G CG+AM ASYPTK  G N  
Sbjct  294  AVGYGSEGGQDYWIVRNSWGSNWGESGYFKLERNIKESSGKCGVAMMASYPTKSSGSN--  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP+PSP VCDK N CPA +TCCC++ +   C++WGCCP
Sbjct  352  ---------PPKPPAPSPVVCDKSNTCPAKSTCCCLYEYNGKCYSWGCCP  392



>ref|XP_006652996.1| PREDICTED: oryzain beta chain-like [Oryza brachyantha]
Length=460

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 78/110 (71%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT+NG DYWIV+NSWG  WGE GY+RM+RN+   TG CGIAM ASYPTK G +   
Sbjct  303  AVGYGTDNGKDYWIVRNSWGPKWGESGYIRMERNINVTTGKCGIAMMASYPTKSGAN---  359

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  PSP  PTP PPSP   VCD+  +CPA +TCCC F F   C  WGCCP
Sbjct  360  PPQPSPSPPTPPPPSPPDHVCDENFSCPAGSTCCCAFGFKKLCLVWGCCP  409



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGTENG DYWIV+NSWG  WGE GY+++QRN   + TG CGIAM+ASYP K G +  
Sbjct  302  VVGYGTENGEDYWIVRNSWGPNWGESGYIKLQRNFANSTTGKCGIAMQASYPLKSGAN--  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD++ +CP  TTCCC++ +G YCF WGCCP
Sbjct  360  ----PPNPGPSPPTPVTPPTVCDEYYSCPQGTTCCCIYQYGEYCFGWGCCP  406



>gb|AAA79915.1| cysteine proteinase, partial [Dianthus caryophyllus]
Length=427

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    AVGYGT-ENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGT ++G DYWIV+NSWGD WGE GY+RM+RN ++K+G CGIA+E SYP K      
Sbjct  259  AVGYGTTDDGKDYWIVRNSWGDDWGEDGYIRMERNTESKSGKCGIAIEPSYPVK-----T  313

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P+PP+P    P+PP     VCD +++CP++TTCCCV+ +G YC+ WGCCP
Sbjct  314  SPNPPNPGPSPPSPPPAPKVVCDSYSSCPSATTCCCVYEYGPYCYMWGCCP  364



>ref|XP_002980210.1| hypothetical protein SELMODRAFT_153766 [Selaginella moellendorffii]
 gb|EFJ18470.1| hypothetical protein SELMODRAFT_153766 [Selaginella moellendorffii]
Length=479

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 71/109 (65%), Gaps = 6/109 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYG E+G  YWI+KNSWG  WGEKGYV+M RN     GLCGI MEASYPTK G + P P
Sbjct  317  VGYGKEDGKAYWIIKNSWGSNWGEKGYVKMARNTGLAAGLCGINMEASYPTKTGANPPNP  376

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P  P    P         CD +  CP S+TCCC+F +G YCFAWGCCP
Sbjct  377  GPTPPSPAPPPNE------CDDYYTCPESSTCCCLFNYGKYCFAWGCCP  419



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT-GLCGIAMEASYPTKKGGDNp  177
            A+GYGT+NG DYWIV+NSWG  WGE GY+R++RNL   T G CGIAME SYP K G +  
Sbjct  302  AIGYGTDNGSDYWIVRNSWGPNWGESGYIRLERNLANSTSGKCGIAMEPSYPLKNGAN--  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD++ +C A TTCCC++ +G+YCF WGCCP
Sbjct  360  ----PPNPGPSPPSPVAPSTVCDEYYSCTAGTTCCCIYKYGDYCFGWGCCP  406



>ref|XP_002963113.1| hypothetical protein SELMODRAFT_270344 [Selaginella moellendorffii]
 gb|EFJ36576.1| hypothetical protein SELMODRAFT_270344 [Selaginella moellendorffii]
Length=479

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 71/109 (65%), Gaps = 6/109 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYG E+G  YWI+KNSWG  WGEKGY++M RN     GLCGI MEASYPTK G + P P
Sbjct  317  VGYGKEDGKAYWIIKNSWGSNWGEKGYIKMARNTGLAAGLCGINMEASYPTKTGANPPNP  376

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P  P    P         CD +  CP S+TCCC+F +G YCFAWGCCP
Sbjct  377  GPTPPSPVPPPNE------CDDYYTCPESSTCCCLFNYGKYCFAWGCCP  419



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRN-LKAKTGLCGIAMEASYPTKKGGDNpp  180
            VGYGTENG DYWIV+NSWGD WGE GYVRM+RN +  KTG CGIAMEASYP K G     
Sbjct  303  VGYGTENGKDYWIVRNSWGDNWGEAGYVRMERNVVDTKTGKCGIAMEASYPIKTG-----  357

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCC  327
               P  P P+P  P   P+VCD + +CP S TCCCV+    YC AWGCC
Sbjct  358  -RNPPNPGPSPPSPVKPPTVCDNYYSCPESNTCCCVYEHYGYCLAWGCC  405



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENGVDYWIV+NSWG  W E GY+R++RN+  A TG CGIA+EASYPTKK     
Sbjct  299  AVGYGTENGVDYWIVRNSWGPSWVEAGYIRLERNVASANTGKCGIAIEASYPTKK----G  354

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  PP P   PP   P++CD++ +CP  TTCCC + +GNYCF WGCCP
Sbjct  355  XNPPKPPPYPPSPPPMKPPTMCDEYYSCPVGTTCCCAYEYGNYCFGWGCCP  405



>dbj|BAD29957.1| cysteine protease [Daucus carota]
Length=437

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYG+E G+DYWIV+NSWG  WGE GY++MQRN+   +GLCGI +E SYP K G     
Sbjct  302  VVGYGSEEGMDYWIVRNSWGAAWGEAGYLKMQRNVGKSSGLCGITIEPSYPVKNGD---N  358

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  P P  P+P  PS   +VCD + +CPA TTCCC++ FG  CF WGCCP
Sbjct  359  PPNPGPTPPSPPSPSLPDNVCDAYTSCPAHTTCCCLYTFGKQCFYWGCCP  408



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRN-LKAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G DYWIVKNSWG  WGE+GY+RM RN   + TG CGIA+EASYP KKG    
Sbjct  301  AVGYGTEKGKDYWIVKNSWGSSWGEEGYIRMARNEANSVTGKCGIAIEASYPIKKG----  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD +  CP S TCCCV+ +  YCFAWGCCP
Sbjct  357  --QNPPNPGPSPPSPIKPPTVCDSYYTCPESNTCCCVYEYYGYCFAWGCCP  405



>gb|AAL60578.1|AF454956_1 senescence-associated cysteine protease [Brassica oleracea]
Length=445

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT  G DYWI++NSWG  WGE GY+++QRN+K  +G CG+AM ASYPTK  G N  
Sbjct  287  AVGYGTSEGQDYWIIRNSWGSNWGESGYIKLQRNIKDSSGKCGVAMMASYPTKSSGSN--  344

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP P+P VCDK   CPA +TCCC++ +   C++WGCCP
Sbjct  345  ---------PPKPPPPAPVVCDKSYTCPAKSTCCCLYEYKGKCYSWGCCP  385



>emb|CDX99227.1| BnaC05g33420D [Brassica napus]
Length=507

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT  G DYWI++NSWG  WGE GY+++QRN+K  +G CG+AM ASYPTK  G N  
Sbjct  292  AVGYGTSEGQDYWIIRNSWGSNWGESGYIKLQRNIKDSSGKCGVAMMASYPTKSSGSN--  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP P+P VCDK   CPA +TCCC++ +   C++WGCCP
Sbjct  350  ---------PPKPPPPAPVVCDKSYTCPAKSTCCCLYEYKGKCYSWGCCP  390



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
             VGYGTENG DYWIV+NSWG  WGE GY+++QRN   + TG CGIAM+ASYP K G +  
Sbjct  302  VVGYGTENGEDYWIVRNSWGANWGESGYIKLQRNFANSTTGKCGIAMQASYPLKSGAN--  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD++ +CP  TTCCC++ +G YCF WGCCP
Sbjct  360  ----PPNPGPSPPTPVTPSTVCDEYYSCPQGTTCCCIYQYGEYCFGWGCCP  406



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT-GLCGIAMEASYPTKKGGDNp  177
            AVGYGT+NG DYWIV+NSWG  WGE GY+R++RNL   T G CGIAME SYP K G +  
Sbjct  302  AVGYGTDNGSDYWIVRNSWGPNWGESGYIRLERNLANSTSGKCGIAMEPSYPLKNGAN--  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD++ +C   TTCCC++ +G+YCF WGCCP
Sbjct  360  ----PPNPGPSPPSPVAPSTVCDEYYSCTEGTTCCCIYKYGDYCFGWGCCP  406



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGE GY+RMQRN+    GLCGIA   SYP K G +   
Sbjct  307  AVGYGSENGMDYWIVRNSWGASWGEHGYLRMQRNIANPKGLCGIATVVSYPVKTGQN---  363

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P+P+P  P   P+ CD   +CP+ TTCCCV+ + + CFAWGCCP
Sbjct  364  ---PPKPAPSPPSPVKPPTTCDDMYSCPSGTTCCCVYEYYHMCFAWGCCP  410



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+ENG+DYWIV+NSWG  WGE GY+RMQRN+    GLCGIA   SYP K G +   
Sbjct  306  AVGYGSENGMDYWIVRNSWGASWGEHGYLRMQRNIANPKGLCGIATGVSYPVKTGQNP--  363

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                  P+P+P  P   P+ CD   +CP+ TTCCCV+ + + CFAWGCCP
Sbjct  364  ----PKPAPSPPSPVKPPTTCDDMYSCPSGTTCCCVYEYYHMCFAWGCCP  409



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE+GVDYW VKNSWG  WGE GY+RM+RN+    TG CGIA  ASYP KKG +  
Sbjct  415  AVGYGTEDGVDYWTVKNSWGPDWGENGYIRMERNVAGTSTGKCGIATMASYPIKKGQN--  472

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  PSP+P  P   P+VCD + +CP  +TCCC++ FG +CF WGCCP
Sbjct  473  ----PPKPSPSPPSPVKPPTVCDDYYSCPEGSTCCCLYEFGKFCFGWGCCP  519



>ref|XP_006364868.1| PREDICTED: uncharacterized protein LOC102583833 [Solanum tuberosum]
Length=695

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT-GLCGIAMEASYPTKKGGDNp  177
            AVGYGT+NG DYWIV+NSWG  WGE GY+R++RNL   T G CGIAME SYP K G +  
Sbjct  60   AVGYGTDNGSDYWIVRNSWGPNWGESGYIRLERNLANSTSGKCGIAMEPSYPLKNGAN--  117

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P    +VCD++ +C   TTCCC++ +G+YCF WGCCP
Sbjct  118  ----PPNPGPSPPSPVAPSTVCDEYYSCTEGTTCCCIYKYGDYCFGWGCCP  164



>emb|CDY46179.1| BnaA05g20660D [Brassica napus]
Length=450

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT  G DYWI++NSWG  WGE GY++++RN+K  +G CG+AM ASYPTK  G N  
Sbjct  292  AVGYGTSEGQDYWIIRNSWGSNWGESGYIKLERNIKDSSGKCGVAMMASYPTKSSGSN--  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP P+P VCDK   CPA +TCCC++ +   C++WGCCP
Sbjct  350  ---------PPKPPPPAPVVCDKSYNCPAKSTCCCLYEYKGKCYSWGCCP  390



>ref|XP_009145796.1| PREDICTED: probable cysteine proteinase At3g19400 [Brassica rapa]
Length=450

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGT  G DYWI++NSWG  WGE GY++++RN+K  +G CG+AM ASYPTK  G N  
Sbjct  292  AVGYGTSEGQDYWIIRNSWGSNWGESGYIKLERNIKDSSGKCGVAMMASYPTKSSGSN--  349

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP P+P VCDK   CPA +TCCC++ +   C++WGCCP
Sbjct  350  ---------PPKPPPPAPVVCDKSYNCPAKSTCCCLYEYKGKCYSWGCCP  390



>ref|XP_001781010.1| predicted protein [Physcomitrella patens]
 gb|EDQ54194.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 72/111 (65%), Gaps = 8/111 (7%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT--GLCGIAMEASYPTKKGGDN  174
            AVGYG+E G+DYWIVKNSWG+YWGE GY+RMQRNLK     GLCGI +E SY  K     
Sbjct  297  AVGYGSEKGLDYWIVKNSWGEYWGESGYLRMQRNLKDDNGYGLCGINIEPSYAVKT----  352

Query  175  pppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCC  327
                 P  P PTP  P P   +CDK+  CPA  TCCC FP G  C AWGCC
Sbjct  353  --SPNPPNPGPTPPSPPPPEVICDKWRTCPAENTCCCTFPVGKSCLAWGCC  401



>ref|XP_001783545.1| predicted protein [Physcomitrella patens]
 gb|EDQ51634.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 74/112 (66%), Gaps = 9/112 (8%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT---GLCGIAMEASYPTKKGGD  171
            AVGYGTE+GVDYWIVKNSWG+YWGE GY+RM+RN+K      GLCGI +E SY  K    
Sbjct  301  AVGYGTEDGVDYWIVKNSWGEYWGESGYLRMKRNMKDSNDGPGLCGINIEPSYAVKT---  357

Query  172  NpppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCC  327
                  P  P PTP  P+P   +CDK+  CP+  TCCC FP G  C AWGCC
Sbjct  358  ---SPNPPNPGPTPPSPTPPEVICDKWRTCPSENTCCCTFPMGKMCLAWGCC  406



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE GY+R++RNL  +++G CGIA+E SYP K G +  
Sbjct  307  AVGYGTENGKDYWIVRNSWGSSWGEAGYIRLERNLASSRSGKCGIAIEPSYPIKNGQN--  364

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +C   TTCCC++ +G  CF WGCCP
Sbjct  365  ----PPNPGPSPPSPVKPPSVCDSYYSCAEGTTCCCIYEYGRSCFEWGCCP  411



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTEN VDYWIV+NSWG  WGE GY++++RNL   +TG CGIA+E SYP K G +  
Sbjct  306  AVGYGTENSVDYWIVRNSWGPNWGESGYIKLERNLAGTETGKCGIAIEPSYPIKNGQN--  363

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  PS    VCD++  CP  +TCCC++ +  +CF WGCCP
Sbjct  364  ----PPNPGPSPPSPSKPSVVCDEYYTCPEESTCCCIYEYAGFCFEWGCCP  410



>ref|XP_002447300.1| hypothetical protein SORBIDRAFT_06g032360 [Sorghum bicolor]
 gb|EES11628.1| hypothetical protein SORBIDRAFT_06g032360 [Sorghum bicolor]
Length=471

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 13/112 (12%)
 Frame = +1

Query  1    AVGYGTE--NGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDN  174
            AVGYGTE   G DYW+V+NSWG  WGE GY+RM+RN+ A+ G CGIAMEASYP K G + 
Sbjct  306  AVGYGTEADGGRDYWLVRNSWGADWGEGGYIRMERNVGARAGKCGIAMEASYPVKSGANP  365

Query  175  pppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                        P+P  P+P  CD+++ACPA +TCCC +   N C  WGCCP
Sbjct  366  -----------DPSPSPPTPVTCDRYSACPAGSTCCCTYGVRNVCLVWGCCP  406



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE GY+R++RNL  +++G CGIA+E SYP K G +  
Sbjct  330  AVGYGTENGKDYWIVRNSWGSSWGEAGYIRLERNLASSRSGKCGIAIEPSYPIKNGQNP-  388

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   PSVCD + +C   TTCCC++ +G  CF WGCCP
Sbjct  389  -----PNPGPSPPSPVKPPSVCDSYYSCAEGTTCCCIYEYGRSCFEWGCCP  434



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYW+V+NSWG  WGE GY++++RN++  +TG CGIA+EASYP K G +  
Sbjct  272  AVGYGTENGTDYWLVRNSWGSAWGENGYIKLERNVQNTETGKCGIAIEASYPIKNGAN--  329

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P+    VCD++ +C + TTCCC+F +  +CF WGCCP
Sbjct  330  ----PPNPGPSPPSPATPSIVCDEYYSCNSGTTCCCLFEYRGFCFGWGCCP  376



>emb|CBI40282.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTEN VDYWIV+NSWG  WGE GY++++RNL   +TG CGIA+E SYP K G +  
Sbjct  223  AVGYGTENSVDYWIVRNSWGPNWGESGYIKLERNLAGTETGKCGIAIEPSYPIKNGQN--  280

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  PS    VCD++  CP  +TCCC++ +  +CF WGCCP
Sbjct  281  ----PPNPGPSPPSPSKPSVVCDEYYTCPEESTCCCIYEYAGFCFEWGCCP  327



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  7    GYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppps  186
            GYGTENG+DYWIV+NSWG  WGE GY+R+QRN+ + +GLCG+A+E SYP K G + P P+
Sbjct  304  GYGTENGMDYWIVRNSWGANWGENGYLRVQRNVASSSGLCGLAIEPSYPVKTGPNPPKPA  363

Query  187  ppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P  P    P         CD+++ C   TTCCC+  F   CF+WGCCP
Sbjct  364  PSPPSPVKPPTE------CDEYSQCAVGTTCCCILQFRRSCFSWGCCP  405



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLK-AKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV NSWG  WGE GY+RM+RNL  + +G CGIA+  SYP K      
Sbjct  302  AVGYGTENGQDYWIVGNSWGKNWGEDGYIRMERNLAGSSSGKCGIAIGPSYPIKN-----  356

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD + +CP  TTCCC++ +G YCFAWGCCP
Sbjct  357  -GPNPPNPGPSPPSPVQPPTVCDNYYSCPERTTCCCIYEYGKYCFAWGCCP  406



>ref|XP_002883178.1| hypothetical protein ARALYDRAFT_479457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59437.1| hypothetical protein ARALYDRAFT_479457 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E G DYWIV+NSWG  WGE GY +++RN+K  +G CG+AM ASYPTK       
Sbjct  294  AVGYGSEGGQDYWIVRNSWGSNWGESGYFKLERNIKESSGKCGVAMMASYPTKS------  347

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   S  P PP PSP VCDK N CPA +TCCC++ +   C++WGCCP
Sbjct  348  -----SGSNPPKPPPPSPVVCDKSNTCPAKSTCCCLYEYNGKCYSWGCCP  392



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYGTENGVDYW V+NSWG  WGE GY++++RN+ A +G CGIA  ASYPTK       
Sbjct  298  AVGYGTENGVDYWTVRNSWGPKWGENGYIKLERNINATSGKCGIASMASYPTK------T  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             S P  P P+P  P   P+VCD + +CP  +TCCCV+ +G++C  WGCCP
Sbjct  352  GSNPPNPGPSPPTPVNPPTVCDDYYSCPEGSTCCCVYQYGDFCIGWGCCP  401



>ref|XP_004173252.1| PREDICTED: oryzain alpha chain-like [Cucumis sativus]
Length=321

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGT+NG DYWIV+NSWG  WGE GY+R++RN+    TG CGIA++ SYPTK G + P
Sbjct  155  AVGYGTDNGTDYWIVRNSWGKDWGESGYIRLERNVANITTGKCGIAVQPSYPTKSGANPP  214

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             PS   P    P         CD++ +C   +TCCC++ FG+ CFAWGCCP
Sbjct  215  KPSASPPSPVKPPTE------CDEYFSCEEGSTCCCIYQFGSTCFAWGCCP  259



>ref|XP_010466084.1| PREDICTED: probable cysteine proteinase At3g19400 isoform X1 
[Camelina sativa]
Length=452

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E G DYWI++NSWG  WGE GYV+++RN+   +G CG+AM ASYPTK  G N  
Sbjct  294  AVGYGSEGGKDYWIIRNSWGSNWGESGYVKLERNINESSGKCGVAMMASYPTKSSGSN--  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP PSP VCDK   CP  +TCCC++ +   C++WGCCP
Sbjct  352  ---------PPKPPLPSPVVCDKSYTCPPKSTCCCLYEYEGKCYSWGCCP  392



>ref|XP_010466085.1| PREDICTED: probable cysteine proteinase At3g19400 isoform X2 
[Camelina sativa]
Length=451

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E G DYWI++NSWG  WGE GYV+++RN+   +G CG+AM ASYPTK  G N  
Sbjct  294  AVGYGSEGGKDYWIIRNSWGSNWGESGYVKLERNINESSGKCGVAMMASYPTKSSGSN--  351

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP PSP VCDK   CP  +TCCC++ +   C++WGCCP
Sbjct  352  ---------PPKPPLPSPVVCDKSYTCPPKSTCCCLYEYEGKCYSWGCCP  392



>ref|XP_006297656.1| hypothetical protein CARUB_v10013678mg [Capsella rubella]
 gb|EOA30554.1| hypothetical protein CARUB_v10013678mg [Capsella rubella]
Length=455

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 11/110 (10%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
            AVGYG+E G DYWI++NSWG  WGE GYV+++RN+   +G CG+AM ASYPTK  G N  
Sbjct  297  AVGYGSEGGRDYWIIRNSWGSNWGESGYVKLERNINESSGKCGVAMMASYPTKSSGSN--  354

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                      P PP PSP VCDK   CP  +TCCC++ +   C++WGCCP
Sbjct  355  ---------PPKPPLPSPVVCDKSYTCPPKSTCCCLYEYEGKCYSWGCCP  395



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G++YWIVKNSWG  WGE+GY+RM+R+L    TG CGIAMEASYP K      
Sbjct  305  AVGYGTEKGMNYWIVKNSWGKSWGEQGYIRMERSLTNTITGKCGIAMEASYPIKN-----  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+ CD++ +C  STTCCCV+ + NYCFAWGCCP
Sbjct  360  -GPNPPNPGPSPPSPIKPPTTCDRYYSCAESTTCCCVYQYANYCFAWGCCP  409



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTE G++YWIVKNSWG  WGE+GY+RM+R+L    TG CGIAMEASYP K      
Sbjct  305  AVGYGTEKGMNYWIVKNSWGKSWGEQGYIRMERSLTNTITGKCGIAMEASYPIKN-----  359

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+ CD++ +C  STTCCCV+ + NYCFAWGCCP
Sbjct  360  -GPNPPNPGPSPPSPIKPPTTCDRYYSCAESTTCCCVYQYANYCFAWGCCP  409



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGT+NG DYWIV+NSWG  WGE GY+R++RN+    TG CGIA++ SYPTK G + P
Sbjct  313  AVGYGTDNGTDYWIVRNSWGKDWGESGYIRLERNVANITTGKCGIAVQPSYPTKSGANPP  372

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             PS   P    P         CD++ +C   +TCCC++ FG+ CFAWGCCP
Sbjct  373  KPSASPPSPVKPPTE------CDEYFSCEEGSTCCCIYQFGSTCFAWGCCP  417



>ref|XP_006653861.1| PREDICTED: cysteine protease 1-like [Oryza brachyantha]
Length=402

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  1    AVGYGTEN-GVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGT+  G  YW V+NSWG +WGE GY+RM+RN+ A+TG CGIAM ASYP KKG +  
Sbjct  249  AVGYGTDAAGRGYWTVRNSWGPHWGEHGYIRMERNVTARTGKCGIAMAASYPVKKGPNPK  308

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
            P   PSPP+P+P  P+     CD+ N CPA TTCCC +   N+C  WGCCP
Sbjct  309  PSPSPSPPAPSPPSPARQ---CDRHNKCPAGTTCCCNYGIRNHCLVWGCCP  356



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE+GY+R++RNL  ++ G CGIA+E SYP K G +  
Sbjct  309  AVGYGTENGKDYWIVRNSWGGSWGEQGYIRLERNLASSRAGKCGIAIEPSYPIKNGQN--  366

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   PSVCD + +C   +TCCC++ +G  CF WGCCP
Sbjct  367  ----PPNPGPSPPSPIKPPSVCDSYYSCAEGSTCCCIYEYGRSCFEWGCCP  413



>gb|AAW34137.1| cysteine protease gp3b [Zingiber officinale]
Length=466

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGT NG DYWIVKNSWG+ WG+ GY+ M+RN+   +G CGIA+  SYP K+G  N  
Sbjct  297  VVGYGTVNGNDYWIVKNSWGESWGDSGYILMERNIAESSGKCGIAISPSYPIKEGATN--  354

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P+  S +      S + CD +  C  STTCCC++  GN CFAWGCCP
Sbjct  355  LRNPTTSSSSVPSLVESLTACDNYYTCAGSTTCCCMYERGNRCFAWGCCP  404



>ref|XP_003589136.1| Cysteine proteinase [Medicago truncatula]
Length=295

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE+GY+R++RNL  ++ G CGIA+E SYP K G +  
Sbjct  130  AVGYGTENGKDYWIVRNSWGGSWGEQGYIRLERNLASSRAGKCGIAIEPSYPIKNGQNP-  188

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   PSVCD + +C   +TCCC++ +G  CF WGCCP
Sbjct  189  -----PNPGPSPPSPIKPPSVCDSYYSCAEGSTCCCIYEYGRSCFEWGCCP  234



>ref|XP_003589135.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59386.1| papain family cysteine protease [Medicago truncatula]
Length=457

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE+GY+R++RNL  ++ G CGIA+E SYP K G +  
Sbjct  309  AVGYGTENGKDYWIVRNSWGGSWGEQGYIRLERNLASSRAGKCGIAIEPSYPIKNGQNP-  367

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   PSVCD + +C   +TCCC++ +G  CF WGCCP
Sbjct  368  -----PNPGPSPPSPIKPPSVCDSYYSCAEGSTCCCIYEYGRSCFEWGCCP  413



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKT-GLCGIAMEASYPTKKGGDNp  177
             VGYGTE G DYWIV+NSWG  WGE GY+RM+RNL   + G CGIAME SYP K G +  
Sbjct  300  VVGYGTEKGKDYWIVRNSWGSSWGEAGYIRMERNLAGTSVGKCGIAMEPSYPLKNGQN--  357

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                P  P P+P  P   P+VCD +  CP S+TCCCV+ +  YCF+WGCCP
Sbjct  358  ----PPNPGPSPPTPVRPPTVCDDYYTCPESSTCCCVYEYYGYCFSWGCCP  404



>gb|ACJ84565.1| unknown [Medicago truncatula]
Length=328

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNL-KAKTGLCGIAMEASYPTKKGGDNp  177
            AVGYGTENG DYWIV+NSWG  WGE+GY+R++RNL  ++ G CGIA+E SYP K G +  
Sbjct  188  AVGYGTENGKDYWIVRNSWGGSWGEQGYIRLERNLASSRAGKCGIAIEPSYPIKNGQNP-  246

Query  178  ppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
                   P P+P  P   PSVCD + +C   +TCCC++ +G  CF WGCCP
Sbjct  247  -----PNPGPSPPSPIKPPSVCDSYYSCAEGSTCCCIYEYGRSCFEWGCCP  292



>gb|AEV41119.1| putative cysteine protease [Oryza officinalis]
Length=499

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  1    AVGYGTE--NGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDN  174
            AVGYGT+   G DYW V+NSWG  WGE GY+RM+RN+ A+TG CGIAM ASYP KKG + 
Sbjct  322  AVGYGTDAATGTDYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMASYPIKKGPNP  381

Query  175  pppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P   P+P  P+P P  P    CD+++ CPA TTCCC +   N+C  WGCCP
Sbjct  382  KPSPSPAPAPPSPAPSPPQQ--CDRYSKCPAGTTCCCNYGIRNHCIVWGCCP  431



>gb|AEV41073.1| putative cysteine protease [Oryza minuta]
Length=499

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  1    AVGYGTE--NGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDN  174
            AVGYGT+   G DYW V+NSWG  WGE GY+RM+RN+ A+TG CGIAM ASYP KKG + 
Sbjct  322  AVGYGTDAATGTDYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMASYPIKKGPNP  381

Query  175  pppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P   P+P   +P P  P    CD+++ CPA TTCCC +   N+C  WGCCP
Sbjct  382  KPSPSPAPAPLSPAPSPPQQ--CDRYSKCPAGTTCCCNYGIRNHCIVWGCCP  431



>gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale]
Length=475

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +1

Query  4    VGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNppp  183
            VGYGTENG DYWIVKNSWG+ WG  GY+ M+RN+   +G CGIA+  SYP K G  N   
Sbjct  307  VGYGTENGNDYWIVKNSWGENWGNSGYILMERNIAESSGKCGIAISPSYPIKVGATN--L  364

Query  184  sppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
              P+  S +      S + CD +  C  STTCCC+   GN CFAWGCCP
Sbjct  365  RNPTTSSSSVPSLVESLTACDNYYTCSGSTTCCCMHERGNRCFAWGCCP  413



>gb|AEV40975.1| putative cysteine protease [Oryza punctata]
Length=464

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  1    AVGYGTE--NGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDN  174
            AVGYGT+   G DYW V+NSWG  WGE GY+RM+RN+ A+TG CGIAM ASYP KKG + 
Sbjct  323  AVGYGTDAATGTDYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMASYPIKKGPNP  382

Query  175  pppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
             P   P P  P+P P  P    CD+++ CPA TTCCC +   N+C  WGCCP
Sbjct  383  KPSPSPKPSPPSPAPSPPQQ--CDRYSKCPAGTTCCCNYGIRNHCIVWGCCP  432



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +1

Query  1    AVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNLKAKTGLCGIAMEASYPTKKGGDNpp  180
             VGYGT NG DYWIV+NSWG  WGE GY+RM+RN+KA +GLCGI  E SYP KK      
Sbjct  299  VVGYGTANGKDYWIVRNSWGAEWGEDGYIRMERNVKATSGLCGITSEPSYPVKK------  352

Query  181  psppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCP  330
               P  P P+P  P   P+ CD +  CP   TCCCVF F   CF WGCCP
Sbjct  353  GPNPPNPGPSPPSPIKPPAACDNYYECPQDNTCCCVFEFYGSCFEWGCCP  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564723838400