BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006C05 628 bp,

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46304.1|  cysteine proteinase precursor                          376   8e-126   Ipomoea nil [qian niu]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    273   1e-85    Sesamum indicum [beniseed]
gb|AAK48495.1|AF259983_1  putative cysteine protease                    271   4e-85    Ipomoea batatas [batate]
gb|ABR19827.1|  cysteine proteinase                                     271   6e-85    Elaeis guineensis
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                270   8e-85    Elaeis guineensis
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                269   3e-84    Phoenix dactylifera
gb|KDO84078.1|  hypothetical protein CISIN_1g024783mg                   259   4e-83    Citrus sinensis [apfelsine]
ref|XP_006434710.1|  hypothetical protein CICLE_v100010542mg            260   1e-82    Citrus clementina
gb|ABG33750.1|  cysteine protease                                       264   1e-82    Hevea brasiliensis [jebe]
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like                265   1e-82    Elaeis guineensis
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                264   2e-82    Elaeis guineensis
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          264   2e-82    Citrus sinensis [apfelsine]
gb|KDO84077.1|  hypothetical protein CISIN_1g024783mg                   256   2e-82    Citrus sinensis [apfelsine]
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                264   3e-82    Erythranthe guttata [common monkey flower]
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...    263   4e-82    Phoenix dactylifera
gb|AAX84673.1|  cysteine protease CP1                                   263   6e-82    Manihot esculenta [manioc]
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                261   2e-81    Setaria italica
ref|XP_002510170.1|  cysteine protease, putative                        261   3e-81    Ricinus communis
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                261   6e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like                260   6e-81    Elaeis guineensis
gb|KDO84083.1|  hypothetical protein CISIN_1g024783mg                   251   1e-80    Citrus sinensis [apfelsine]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         259   1e-80    Jatropha curcas
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like                259   1e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like                259   2e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like                259   3e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                259   3e-80    Phoenix dactylifera
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          258   6e-80    Nelumbo nucifera [Indian lotus]
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     258   7e-80    
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    256   2e-79    Nicotiana tomentosiformis
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    256   2e-79    Solanum tuberosum [potatoes]
emb|CBI19479.3|  unnamed protein product                                254   2e-79    Vitis vinifera
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          256   3e-79    Nelumbo nucifera [Indian lotus]
gb|ABQ10204.1|  cysteine protease Cp6                                   256   3e-79    Actinidia deliciosa [Chinese gooseberry]
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          256   3e-79    Tarenaya hassleriana [spider flower]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    256   4e-79    Eucalyptus grandis [rose gum]
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220          258   4e-79    
emb|CAN61026.1|  hypothetical protein VITISV_001146                     256   4e-79    Vitis vinifera
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     256   4e-79    Eucalyptus grandis [rose gum]
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    256   4e-79    Vitis vinifera
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...    255   6e-79    Nicotiana sylvestris
ref|XP_006374886.1|  cysteine proteinase                                255   6e-79    Populus trichocarpa [western balsam poplar]
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               255   6e-79    Populus euphratica
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                255   7e-79    Erythranthe guttata [common monkey flower]
dbj|BAG92753.1|  unnamed protein product                                248   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like          255   1e-78    Populus euphratica
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    254   1e-78    Solanum tuberosum [potatoes]
ref|NP_001183396.1|  uncharacterized protein LOC100501813               249   1e-78    Zea mays [maize]
emb|CAQ00105.1|  papain-like cysteine proteinase                        254   2e-78    Hordeum vulgare subsp. vulgare [barley]
gb|EMT10408.1|  Oryzain alpha chain                                     254   2e-78    Aegilops tauschii
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    253   3e-78    
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...    253   3e-78    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF02546.1|  triticain alpha                                        253   3e-78    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001149658.1|  cysteine protease 1 precursor                      253   4e-78    Zea mays [maize]
gb|EMS56635.1|  Oryzain alpha chain                                     253   5e-78    Triticum urartu
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g             253   5e-78    Populus trichocarpa [western balsam poplar]
emb|CAE04498.2|  OSJNBb0059K02.8                                        252   7e-78    Oryza sativa Japonica Group [Japonica rice]
gb|AGV15823.1|  cysteine protease CP15                                  253   8e-78    Nicotiana tabacum [American tobacco]
ref|NP_001148706.1|  cysteine protease 1 precursor                      252   8e-78    Zea mays [maize]
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          252   9e-78    Zea mays [maize]
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    252   1e-77    Nicotiana sylvestris
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          252   1e-77    Malus domestica [apple tree]
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                252   1e-77    Zea mays [maize]
dbj|BAA14402.1|  oryzain alpha precursor                                252   1e-77    Oryza sativa Japonica Group [Japonica rice]
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...    251   1e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EEC78138.1|  hypothetical protein OsI_17694                          251   1e-77    Oryza sativa Indica Group [Indian rice]
gb|EEE61807.1|  hypothetical protein OsJ_16426                          251   1e-77    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86180.1|  H0212B02.7                                             252   1e-77    Oryza sativa Indica Group [Indian rice]
gb|EPS63305.1|  hypothetical protein M569_11479                         251   2e-77    Genlisea aurea
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    252   2e-77    Nicotiana tomentosiformis
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    251   2e-77    Solanum lycopersicum
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like                251   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD29960.1|  cysteine protease                                      251   3e-77    Daucus carota [carrots]
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          251   3e-77    Populus euphratica
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          250   5e-77    Tarenaya hassleriana [spider flower]
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like                250   5e-77    Oryza brachyantha
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    250   5e-77    Pyrus x bretschneideri [bai li]
dbj|BAD16614.1|  cysteine proteinase                                    250   6e-77    Dianthus caryophyllus [carnation]
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    250   7e-77    Pyrus x bretschneideri [bai li]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             250   7e-77    Prunus persica
gb|AAD28476.1|AF133838_1  papain-like cysteine protease                 247   7e-77    Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    250   8e-77    Sesamum indicum [beniseed]
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             249   1e-76    Prunus persica
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like                249   1e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like                249   1e-76    Brachypodium distachyon [annual false brome]
dbj|BAH11164.1|  cysteine protease                                      249   2e-76    Hordeum vulgare [barley]
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    249   2e-76    Theobroma cacao [chocolate]
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          249   2e-76    Prunus mume [ume]
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             248   3e-76    Arabidopsis lyrata subsp. lyrata
gb|KJB58558.1|  hypothetical protein B456_009G214900                    247   5e-76    Gossypium raimondii
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             248   6e-76    Populus trichocarpa [western balsam poplar]
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    247   9e-76    Prunus mume [ume]
gb|AEZ65083.1|  cysteine protease                                       247   1e-75    Carica papaya [mamon]
gb|KJB58557.1|  hypothetical protein B456_009G214900                    247   1e-75    Gossypium raimondii
gb|KJB14608.1|  hypothetical protein B456_002G133800                    243   1e-75    Gossypium raimondii
dbj|BAC75923.1|  cysteine protease-1                                    246   2e-75    Helianthus annuus
ref|XP_010094652.1|  Cysteine proteinase RD21a                          246   2e-75    Morus notabilis
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      246   3e-75    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD29956.1|  cysteine protease                                      244   3e-75    Daucus carota [carrots]
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    246   3e-75    Malus domestica [apple tree]
dbj|BAF01762.1|  cysteine protease component of protease-inhibito...    240   4e-75    Arabidopsis thaliana [mouse-ear cress]
gb|KJB14607.1|  hypothetical protein B456_002G133800                    238   4e-75    Gossypium raimondii
gb|KJB14606.1|  hypothetical protein B456_002G133800                    240   6e-75    Gossypium raimondii
sp|P20721.1|CYSPL_SOLLC  RecName: Full=Low-temperature-induced cy...    241   6e-75    Solanum lycopersicum
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    245   8e-75    Pyrus x bretschneideri [bai li]
ref|XP_003603086.1|  Cysteine proteinase                                244   1e-74    Medicago truncatula
gb|KHG05637.1|  Cysteinease RD21a -like protein                         243   2e-74    Gossypium arboreum [tree cotton]
gb|KJB14610.1|  hypothetical protein B456_002G133800                    243   3e-74    Gossypium raimondii
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a               243   3e-74    Fragaria vesca subsp. vesca
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...    243   3e-74    Malus domestica [apple tree]
gb|AAP41847.1|  senescence-associated cysteine protease                 243   4e-74    Anthurium andraeanum [flamingo-lily]
ref|XP_003589136.1|  Cysteine proteinase                                237   4e-74    
dbj|BAE98640.1|  cysteine proteinase RD21A                              234   7e-74    Arabidopsis thaliana [mouse-ear cress]
gb|KHG12125.1|  Cysteinease RD21a -like protein                         246   8e-74    Gossypium arboreum [tree cotton]
gb|AEZ65082.1|  cysteine protease                                       242   8e-74    Carica papaya [mamon]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          242   1e-73    Citrus sinensis [apfelsine]
ref|XP_008357442.1|  PREDICTED: oryzain alpha chain-like                239   1e-73    Malus domestica [apple tree]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             242   1e-73    Citrus clementina
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like          241   1e-73    Tarenaya hassleriana [spider flower]
ref|XP_010107858.1|  Cysteine proteinase RD21a                          242   1e-73    Morus notabilis
gb|KEH44128.1|  papain family cysteine protease                         241   2e-73    Medicago truncatula
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    241   2e-73    Arabis alpina [alpine rockcress]
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             241   2e-73    Eutrema salsugineum
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...    241   2e-73    Pyrus x bretschneideri [bai li]
ref|XP_003589133.1|  Cysteine proteinase                                241   2e-73    Medicago truncatula
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...    241   3e-73    Eucalyptus grandis [rose gum]
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                     241   3e-73    Eucalyptus grandis [rose gum]
ref|XP_002518705.1|  cysteine protease, putative                        241   3e-73    Ricinus communis
emb|CDY63586.1|  BnaCnng42340D                                          240   3e-73    Brassica napus [oilseed rape]
gb|AFO83614.1|  papain-like cysteine protease                           240   3e-73    Fagopyrum esculentum
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   240   5e-73    Citrus sinensis [apfelsine]
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    240   5e-73    Arabis alpina [alpine rockcress]
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             241   6e-73    Capsella rubella
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 240   7e-73    
gb|ABK24495.1|  unknown                                                 239   9e-73    Picea sitchensis
ref|NP_564497.1|  cysteine proteinase RD21a                             239   1e-72    Arabidopsis thaliana [mouse-ear cress]
gb|AAK62661.1|  F2G19.31/F2G19.31                                       239   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    239   1e-72    Solanum lycopersicum
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             238   1e-72    Eutrema salsugineum
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...    239   2e-72    
gb|ABK24233.1|  unknown                                                 238   2e-72    Picea sitchensis
gb|ACB87490.1|  mucunain                                                237   2e-72    Mucuna pruriens
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like          238   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          238   4e-72    
gb|KJB63901.1|  hypothetical protein B456_010G022700                    238   4e-72    Gossypium raimondii
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          237   5e-72    Camelina sativa [gold-of-pleasure]
emb|CDY17093.1|  BnaC06g00260D                                          236   8e-72    Brassica napus [oilseed rape]
emb|CDY17044.1|  BnaA08g04080D                                          236   8e-72    Brassica napus [oilseed rape]
gb|AAC49455.1|  Pseudotzain                                             236   8e-72    Pseudotsuga menziesii
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like          236   8e-72    
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  236   9e-72    Arabidopsis lyrata subsp. lyrata
gb|KGN55227.1|  hypothetical protein Csa_4G641600                       236   9e-72    Cucumis sativus [cucumbers]
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       236   1e-71    Brassica oleracea
emb|CDX71540.1|  BnaC04g17750D                                          236   1e-71    Brassica napus [oilseed rape]
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               236   1e-71    Camelina sativa [gold-of-pleasure]
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    236   1e-71    Cicer arietinum [garbanzo]
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    236   2e-71    
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like          236   2e-71    
emb|CDY06760.1|  BnaA10g05390D                                          236   2e-71    Brassica napus [oilseed rape]
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    236   2e-71    Malus domestica [apple tree]
dbj|BAD29954.1|  cysteine protease                                      236   3e-71    Daucus carota [carrots]
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          235   4e-71    Cicer arietinum [garbanzo]
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             235   4e-71    Phaseolus vulgaris [French bean]
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg             236   5e-71    Capsella rubella
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          234   6e-71    Nicotiana sylvestris
emb|CAB17076.1|  cysteine proteinase precursor                          234   6e-71    Phaseolus vulgaris [French bean]
gb|AJA74414.1|  cysteine protease                                       234   1e-70    Cicer arietinum [garbanzo]
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               234   1e-70    Brassica rapa
emb|CDY22370.1|  BnaA06g36920D                                          234   1e-70    Brassica napus [oilseed rape]
emb|CDP01294.1|  unnamed protein product                                233   1e-70    Coffea canephora [robusta coffee]
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    233   2e-70    Sesamum indicum [beniseed]
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like          233   2e-70    Camelina sativa [gold-of-pleasure]
emb|CAA46863.1|  thiolprotease                                          233   2e-70    Pisum sativum [garden pea]
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like          233   2e-70    Camelina sativa [gold-of-pleasure]
dbj|BAE80740.1|  cysteine proteinase                                    233   3e-70    Platycodon grandiflorus [balloon-flower]
emb|CDO97206.1|  unnamed protein product                                233   3e-70    Coffea canephora [robusta coffee]
emb|CBI40282.3|  unnamed protein product                                231   3e-70    Vitis vinifera
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like                 233   3e-70    Brachypodium distachyon [annual false brome]
gb|AEV40973.1|  putative oryzain beta chain precursor                   232   4e-70    Oryza punctata
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          233   4e-70    Vitis vinifera
dbj|BAH20463.1|  cysteine protease                                      232   5e-70    Spinacia oleracea
gb|KHN22488.1|  Cysteine proteinase RD21a                               232   5e-70    Glycine soja [wild soybean]
ref|XP_004173252.1|  PREDICTED: oryzain alpha chain-like                228   7e-70    
emb|CDY25228.1|  BnaC02g30040D                                          231   8e-70    Brassica napus [oilseed rape]
gb|ABR26128.1|  cysteine proteinase rd21a precursor                     224   9e-70    Oryza sativa Indica Group [Indian rice]
gb|AIE88288.1|  hypothetical protein OG_BBa0063K01.19                   231   1e-69    Oryza glaberrima
gb|ACI00280.1|  triticain beta 2                                        231   1e-69    Hordeum vulgare [barley]
dbj|BAK03074.1|  predicted protein                                      231   1e-69    Hordeum vulgare subsp. vulgare [barley]
ref|NP_001054211.2|  Os04g0670200                                       231   1e-69    
dbj|BAA14403.1|  oryzain beta precursor                                 231   1e-69    Oryza sativa Japonica Group [Japonica rice]
dbj|BAF93840.1|  triticain beta 2                                       231   1e-69    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          232   1e-69    Glycine max [soybeans]
gb|EMS68758.1|  Oryzain beta chain                                      231   1e-69    Triticum urartu
dbj|BAF02547.1|  triticain beta                                         231   1e-69    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a               231   2e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          231   2e-69    Camelina sativa [gold-of-pleasure]
gb|AEV41071.1|  putative oryzain beta chain precursor                   231   2e-69    Oryza minuta
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          230   2e-69    Nicotiana tomentosiformis
gb|EAZ32359.1|  hypothetical protein OsJ_16569                          231   3e-69    Oryza sativa Japonica Group [Japonica rice]
gb|AEV41024.1|  putative oryzain beta chain precursor                   231   3e-69    Oryza minuta
dbj|BAD29958.1|  cysteine protease                                      231   4e-69    Daucus carota [carrots]
gb|KDO84085.1|  hypothetical protein CISIN_1g024783mg                   223   4e-69    Citrus sinensis [apfelsine]
gb|EMT10724.1|  Oryzain beta chain                                      228   4e-69    Aegilops tauschii
gb|AEV41117.1|  putative oryzain beta chain precursor                   229   5e-69    Oryza officinalis
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             228   1e-68    Phaseolus vulgaris [French bean]
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    231   1e-68    Theobroma cacao [chocolate]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          229   1e-68    Cucumis sativus [cucumbers]
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like          228   2e-68    Glycine max [soybeans]
gb|ABQ10202.1|  cysteine protease Cp4                                   228   2e-68    Actinidia deliciosa [Chinese gooseberry]
gb|ACR34204.1|  unknown                                                 228   3e-68    Zea mays [maize]
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg                227   4e-68    Erythranthe guttata [common monkey flower]
tpg|DAA35450.1|  TPA: cysteine protease 1                               228   5e-68    Zea mays [maize]
ref|NP_001150266.1|  cysteine protease 1 precursor                      226   6e-68    Zea mays [maize]
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320          227   6e-68    Sorghum bicolor [broomcorn]
gb|AAU81588.1|  cysteine proteinase                                     217   8e-68    Petunia x hybrida [garden petunia]
ref|NP_001150196.1|  cysteine protease 1 precursor                      226   8e-68    Zea mays [maize]
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like                 225   2e-67    Oryza brachyantha
gb|AAU81595.1|  cysteine proteinase                                     216   2e-67    Petunia x hybrida [garden petunia]
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          225   3e-67    Fragaria vesca subsp. vesca
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      224   3e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          225   4e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    225   4e-67    Cucumis melo [Oriental melon]
ref|XP_001781010.1|  predicted protein                                  224   4e-67    Physcomitrella patens
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          224   7e-67    Solanum lycopersicum
dbj|BAH20390.1|  AT1G47128                                              214   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783545.1|  predicted protein                                  223   2e-66    Physcomitrella patens
ref|XP_001755855.1|  predicted protein                                  223   2e-66    Physcomitrella patens
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like                223   2e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          223   3e-66    Solanum tuberosum [potatoes]
emb|CDY46179.1|  BnaA05g20660D                                          222   3e-66    Brassica napus [oilseed rape]
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    222   3e-66    Brassica rapa
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       221   4e-66    Brassica oleracea
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       222   5e-66    Brassica oleracea
gb|KHN08598.1|  Cysteine proteinase RD21a                               220   8e-66    Glycine soja [wild soybean]
emb|CDX99227.1|  BnaC05g33420D                                          222   1e-65    Brassica napus [oilseed rape]
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...    220   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344             220   2e-65    Selaginella moellendorffii
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2      220   2e-65    Setaria italica
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg             219   2e-65    Capsella rubella
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...    218   7e-65    Camelina sativa [gold-of-pleasure]
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766             219   8e-65    Selaginella moellendorffii
emb|CAQ00106.1|  papain-like cysteine proteinase                        219   8e-65    Hordeum vulgare subsp. vulgare [barley]
ref|XP_001761481.1|  predicted protein                                  217   3e-64    Physcomitrella patens
gb|ACF85649.1|  unknown                                                 211   3e-64    Zea mays [maize]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1          216   4e-64    Zea mays [maize]
gb|ACJ84565.1|  unknown                                                 213   5e-64    Medicago truncatula
gb|KJB58559.1|  hypothetical protein B456_009G214900                    216   5e-64    Gossypium raimondii
gb|KJB14609.1|  hypothetical protein B456_002G133800                    217   5e-64    Gossypium raimondii
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             216   7e-64    Arabidopsis lyrata subsp. lyrata
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...    215   1e-63    Camelina sativa [gold-of-pleasure]
gb|AAW34136.1|  cysteine protease gp3a                                  216   1e-63    Zingiber officinale [ginger]
gb|AAA79915.1|  cysteine proteinase                                     214   1e-63    Dianthus caryophyllus [carnation]
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    215   2e-63    Brassica rapa
gb|AAW34137.1|  cysteine protease gp3b                                  214   5e-63    Zingiber officinale [ginger]
gb|ACG41708.1|  cysteine proteinase RD21a precursor                     208   5e-63    Zea mays [maize]
emb|CDX95457.1|  BnaC01g33490D                                          213   9e-63    Brassica napus [oilseed rape]
ref|XP_001780740.1|  predicted protein                                  213   1e-62    Physcomitrella patens
gb|ACR34737.1|  unknown                                                 213   2e-62    Zea mays [maize]
gb|AEV41073.1|  putative cysteine protease                              213   2e-62    Oryza minuta
dbj|BAG16371.1|  cysteine protease                                      212   2e-62    Brassica oleracea var. italica [asparagus broccoli]
gb|AEV41119.1|  putative cysteine protease                              213   2e-62    Oryza officinalis
emb|CDY50157.1|  BnaA01g26170D                                          212   2e-62    Brassica napus [oilseed rape]
dbj|BAG16377.1|  cysteine protease                                      211   3e-62    Brassica rapa var. perviridis [kabuna]
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472             211   1e-61    Elaeis guineensis
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                    209   3e-61    Arabis alpina [alpine rockcress]
gb|EMS62782.1|  Cysteine protease 1                                     207   4e-61    Triticum urartu
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...    209   4e-61    Tarenaya hassleriana [spider flower]
ref|XP_002447300.1|  hypothetical protein SORBIDRAFT_06g032360          209   5e-61    Sorghum bicolor [broomcorn]
dbj|BAH08632.1|  daikon cysteine protease RD21                          202   2e-60    Raphanus sativus
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg             206   3e-60    Eutrema salsugineum
ref|XP_003589135.1|  Cysteine proteinase                                206   3e-60    Medicago truncatula
ref|NP_001104878.1|  maize insect resistance2 precursor                 207   4e-60    
dbj|BAD95392.1|  cysteine proteinase RD21A                              204   1e-59    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD29957.1|  cysteine protease                                      204   1e-59    Daucus carota [carrots]
emb|CAH67695.1|  H0624F09.3                                             205   2e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1      204   4e-59    
ref|XP_006653861.1|  PREDICTED: cysteine protease 1-like                201   7e-59    
ref|NP_001054213.1|  Os04g0670500                                       201   4e-58    
gb|EAZ32361.1|  hypothetical protein OsJ_16571                          199   5e-58    Oryza sativa Japonica Group [Japonica rice]
emb|CDY50154.1|  BnaA01g26140D                                          200   7e-58    Brassica napus [oilseed rape]
emb|CDX95451.1|  BnaC01g33430D                                          199   1e-57    
ref|XP_002988081.1|  hypothetical protein SELMODRAFT_183539             198   2e-57    
gb|AEV40975.1|  putative cysteine protease                              196   2e-56    
gb|AEV41026.1|  putative cysteine protease                              196   2e-56    
ref|XP_002972714.1|  hypothetical protein SELMODRAFT_98707              192   6e-55    
ref|XP_006364868.1|  PREDICTED: uncharacterized protein LOC102583833    195   1e-54    
gb|EMT09761.1|  Cysteine protease 1                                     185   8e-54    
gb|EMT31482.1|  Cysteine protease 1                                     182   7e-53    
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...    186   2e-52    
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...    186   2e-52    
gb|AAD56028.1|AF181567_1  cysteine protease CYP1                        177   6e-52    
gb|AFW88998.1|  hypothetical protein ZEAMMB73_678859                    187   2e-50    
ref|XP_004963406.1|  PREDICTED: cysteine protease 1-like                179   9e-50    
ref|XP_005651425.1|  hypothetical protein COCSUDRAFT_21961              174   6e-48    
gb|AFW62237.1|  hypothetical protein ZEAMMB73_032109                    176   6e-48    
gb|EMS65496.1|  Cysteine proteinase RD21a                               169   2e-47    
ref|XP_011048840.1|  PREDICTED: low-temperature-induced cysteine ...    172   3e-47    
ref|XP_007017656.1|  JHL18I08.3 protein                                 170   1e-46    
emb|CDP07460.1|  unnamed protein product                                170   1e-46    
ref|XP_010501397.1|  PREDICTED: zingipain-2-like                        169   2e-46    
ref|XP_010271530.1|  PREDICTED: low-temperature-induced cysteine ...    169   2e-46    
ref|XP_010458294.1|  PREDICTED: low-temperature-induced cysteine ...    169   2e-46    
dbj|BAJ90119.1|  predicted protein                                      170   2e-46    
ref|XP_010475838.1|  PREDICTED: low-temperature-induced cysteine ...    169   3e-46    
gb|EMT33622.1|  Cysteine proteinase RD21a                               173   3e-46    
dbj|BAJ53169.1|  JHL18I08.3                                             169   5e-46    
ref|XP_004500967.1|  PREDICTED: oryzain alpha chain-like                168   7e-46    
ref|NP_563855.1|  papain-like cysteine peptidase                        167   1e-45    
ref|XP_008347358.1|  PREDICTED: low-temperature-induced cysteine ...    167   2e-45    
ref|XP_002307688.2|  cysteine protease family protein                   167   2e-45    
gb|KHG28107.1|  Cysteinease RD21a -like protein                         166   3e-45    
gb|AAK71314.1|AF388175_1  papain-like cysteine peptidase XBCP3          166   5e-45    
gb|AEQ61829.1|  cysteine protease                                       157   5e-45    
ref|XP_006417526.1|  hypothetical protein EUTSA_v10007640mg             166   6e-45    
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like           171   6e-45    
ref|XP_003523725.1|  PREDICTED: oryzain alpha chain-like                165   1e-44    
ref|XP_010672523.1|  PREDICTED: ervatamin-B                             165   1e-44    
ref|XP_002510459.1|  cysteine protease, putative                        164   1e-44    
gb|KHN45886.1|  Oryzain alpha chain                                     165   1e-44    
ref|XP_009148295.1|  PREDICTED: low-temperature-induced cysteine ...    165   1e-44    
emb|CDX93470.1|  BnaA06g05780D                                          164   1e-44    
ref|XP_010061259.1|  PREDICTED: low-temperature-induced cysteine ...    164   2e-44    
gb|KJB58177.1|  hypothetical protein B456_009G197900                    164   2e-44    
gb|KJB58175.1|  hypothetical protein B456_009G197900                    164   3e-44    
emb|CDX94938.1|  BnaC05g07330D                                          164   4e-44    
ref|XP_006838704.1|  hypothetical protein AMTR_s00002p00249780          164   6e-44    
ref|XP_010923265.1|  PREDICTED: zingipain-2                             163   6e-44    
ref|XP_008796612.1|  PREDICTED: low-temperature-induced cysteine ...    162   1e-43    
ref|XP_010544099.1|  PREDICTED: low-temperature-induced cysteine ...    162   1e-43    
gb|EYU36745.1|  hypothetical protein MIMGU_mgv1a006749mg                162   1e-43    
emb|CAQ00107.1|  papain-like cysteine proteinase                        162   1e-43    
ref|XP_010110007.1|  Oryzain alpha chain                                162   3e-43    
ref|XP_004291399.1|  PREDICTED: low-temperature-induced cysteine ...    160   5e-43    
gb|ABK93304.1|  unknown                                                 152   6e-43    
ref|XP_005850783.1|  hypothetical protein CHLNCDRAFT_56822              160   9e-43    
ref|XP_004961575.1|  PREDICTED: oryzain alpha chain-like                160   9e-43    
ref|XP_004238304.1|  PREDICTED: zingipain-2                             159   1e-42    
ref|NP_001141813.1|  uncharacterized protein LOC100273952 precursor     159   1e-42    
ref|XP_007223363.1|  hypothetical protein PRUPE_ppa005615mg             159   2e-42    
ref|XP_009771293.1|  PREDICTED: zingipain-2                             159   2e-42    
ref|XP_002280937.1|  PREDICTED: zingipain-2                             159   2e-42    
gb|AAD54424.1|AF182079_1  thiol protease                                159   2e-42    
gb|KDO84699.1|  hypothetical protein CISIN_1g012960mg                   156   3e-42    
ref|XP_010109882.1|  Oryzain alpha chain                                159   4e-42    
gb|KEH36214.1|  papain family cysteine protease                         158   4e-42    
gb|KFK43284.1|  hypothetical protein AALP_AA1G104100                    157   7e-42    
ref|XP_009597081.1|  PREDICTED: zingipain-2                             157   8e-42    
ref|XP_008221336.1|  PREDICTED: low-temperature-induced cysteine ...    158   1e-41    
gb|KDO84698.1|  hypothetical protein CISIN_1g012960mg                   157   1e-41    
gb|KDO84697.1|  hypothetical protein CISIN_1g012960mg                   156   2e-41    
ref|XP_008444761.1|  PREDICTED: zingipain-2                             156   2e-41    
ref|XP_006435079.1|  hypothetical protein CICLE_v10001178mg             156   3e-41    
gb|KDO77866.1|  hypothetical protein CISIN_1g043774mg                   156   4e-41    
gb|AED99251.1|  cysteine protease                                       147   5e-41    
gb|AAB60738.1|  Strong similarity to Dianthus cysteine proteinase...    154   6e-41    
ref|XP_006449509.1|  hypothetical protein CICLE_v10015066mg             155   7e-41    
gb|KDO84700.1|  hypothetical protein CISIN_1g012960mg                   154   8e-41    
ref|XP_002317418.2|  hypothetical protein POPTR_0011s07310g             155   8e-41    
ref|XP_006467643.1|  PREDICTED: cysteine proteinase RD21a-like          155   9e-41    
ref|XP_007025364.1|  Xylem bark cysteine peptidase 3 isoform 2          152   9e-41    
ref|XP_006655467.1|  PREDICTED: cysteine proteinase RD21a-like          153   1e-40    
ref|XP_002440039.1|  hypothetical protein SORBIDRAFT_09g024940          154   1e-40    
ref|XP_006473576.1|  PREDICTED: cysteine proteinase RD21a-like          154   1e-40    
ref|XP_011074626.1|  PREDICTED: zingipain-2                             154   2e-40    
ref|XP_006341989.1|  PREDICTED: cysteine proteinase RD21a-like          153   3e-40    
tpg|DAA35683.1|  TPA: hypothetical protein ZEAMMB73_501593              145   3e-40    
gb|KDD75417.1|  papain family cysteine protease                         151   4e-40    
ref|XP_007025363.1|  Xylem bark cysteine peptidase 3 isoform 1          153   5e-40    
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                150   1e-39    
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like                150   1e-39    
gb|AIE88271.1|  hypothetical protein OG_BBa0063K01.2                    152   1e-39    
ref|XP_011039436.1|  PREDICTED: low-temperature-induced cysteine ...    152   1e-39    
gb|AAS20467.1|  cysteine protease-like protein                          146   2e-39    
ref|XP_010915506.1|  PREDICTED: low-temperature-induced cysteine ...    151   3e-39    
emb|CDO96804.1|  unnamed protein product                                151   3e-39    
emb|CAA07567.1|  cysteine proteinase                                    144   7e-39    
ref|XP_008789986.1|  PREDICTED: low-temperature-induced cysteine ...    150   9e-39    
ref|XP_010277012.1|  PREDICTED: low-temperature-induced cysteine ...    150   9e-39    
ref|XP_004152671.1|  PREDICTED: cysteine proteinase RD21a-like          149   1e-38    
ref|XP_009397024.1|  PREDICTED: low-temperature-induced cysteine ...    148   2e-38    
ref|XP_004233043.1|  PREDICTED: low-temperature-induced cysteine ...    149   2e-38    
gb|KJB66820.1|  hypothetical protein B456_010G159600                    145   4e-38    
ref|XP_002954352.1|  hypothetical protein VOLCADRAFT_76255              148   4e-38    
emb|CDY27951.1|  BnaCnng05360D                                          147   5e-38    
gb|EPS62067.1|  cysteine proteinase                                     144   7e-38    
ref|XP_001697622.1|  cysteine endopeptidase                             147   8e-38    
ref|XP_006362441.1|  PREDICTED: oryzain alpha chain-like                148   8e-38    
gb|EPS60205.1|  hypothetical protein M569_14597                         145   1e-37    
gb|KJB66817.1|  hypothetical protein B456_010G159600                    146   2e-37    
gb|EAY98636.1|  hypothetical protein OsI_20560                          145   2e-37    
ref|NP_001055994.1|  Os05g0508300                                       145   2e-37    
gb|KJB66815.1|  hypothetical protein B456_010G159600                    146   2e-37    
ref|XP_011039435.1|  PREDICTED: low-temperature-induced cysteine ...    146   2e-37    
gb|KJB66818.1|  hypothetical protein B456_010G159600                    146   2e-37    
gb|KJB75476.1|  hypothetical protein B456_012G043300                    139   3e-37    
gb|AAP41846.1|  cysteine protease                                       145   3e-37    
ref|XP_007148042.1|  hypothetical protein PHAVU_006G175500g             145   4e-37    
gb|KDP21101.1|  hypothetical protein JCGZ_21572                         145   4e-37    
ref|XP_002317417.2|  hypothetical protein POPTR_0011s07300g             144   6e-37    
gb|ABK95906.1|  unknown                                                 144   9e-37    
gb|KHG12401.1|  hypothetical protein F383_03889                         144   1e-36    
ref|XP_007211825.1|  hypothetical protein PRUPE_ppa004381mg             144   1e-36    
ref|XP_008225294.1|  PREDICTED: cysteine proteinase COT44-like          144   1e-36    
ref|XP_002531152.1|  cysteine protease, putative                        141   2e-36    
dbj|BAJ85145.1|  predicted protein                                      142   2e-36    
gb|KJB75473.1|  hypothetical protein B456_012G043000                    140   3e-36    
gb|KEH36615.1|  cysteine proteinase superfamily protein                 138   3e-36    
gb|KJB75474.1|  hypothetical protein B456_012G043100                    139   3e-36    
ref|XP_006362397.1|  PREDICTED: oryzain alpha chain-like                142   4e-36    
gb|AHM88211.1|  CAC1 protein                                            142   4e-36    
tpg|DAA53037.1|  TPA: hypothetical protein ZEAMMB73_586844              145   4e-36    
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         140   4e-36    
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         140   4e-36    
ref|XP_008371471.1|  PREDICTED: low-temperature-induced cysteine ...    142   5e-36    
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         139   8e-36    
gb|KJB84213.1|  hypothetical protein B456_N010900                       139   9e-36    
ref|XP_002531151.1|  cysteine protease, putative                        139   1e-35    
ref|XP_011072006.1|  PREDICTED: vignain-like                            139   1e-35    
gb|KJB84212.1|  hypothetical protein B456_N010800                       139   1e-35    
gb|KJB75480.1|  hypothetical protein B456_012G043600                    139   1e-35    
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    139   1e-35    
ref|XP_004485897.1|  PREDICTED: cysteine proteinase RD21a-like          141   1e-35    
ref|XP_008780330.1|  PREDICTED: vignain-like                            135   1e-35    
gb|AFP20583.1|  cysteine endopeptidase                                  134   1e-35    
ref|XP_010927557.1|  PREDICTED: thiol protease SEN102-like              132   3e-35    
ref|XP_002305743.2|  hypothetical protein POPTR_0004s05640g             140   4e-35    
ref|XP_004233038.1|  PREDICTED: low-temperature-induced cysteine ...    140   4e-35    
ref|XP_003636796.1|  Cysteine proteinase                                139   5e-35    
gb|KEH36599.1|  papain family cysteine protease                         139   6e-35    
ref|XP_008780633.1|  PREDICTED: vignain-like                            133   7e-35    
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         136   8e-35    
emb|CBI21975.3|  unnamed protein product                                135   9e-35    
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...    135   9e-35    
gb|KJB75478.1|  hypothetical protein B456_012G0435001                   133   9e-35    
ref|XP_007050065.1|  Senescence-associated gene 12                      136   9e-35    
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        136   1e-34    
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             135   1e-34    
ref|XP_003590277.1|  Cysteine protease                                  138   1e-34    
emb|CBI21976.3|  unnamed protein product                                136   1e-34    
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    137   1e-34    
ref|XP_010999738.1|  PREDICTED: low-temperature-induced cysteine ...    138   1e-34    
ref|XP_009613579.1|  PREDICTED: low-temperature-induced cysteine ...    138   1e-34    
ref|XP_008780365.1|  PREDICTED: vignain-like                            132   1e-34    
gb|ABQ10203.1|  cysteine protease Cp5                                   138   1e-34    
ref|XP_010248729.1|  PREDICTED: vignain-like                            136   1e-34    
gb|AGV15822.1|  cysteine protease CP14                                  138   1e-34    
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    136   1e-34    
gb|KJB66816.1|  hypothetical protein B456_010G159600                    137   2e-34    
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             135   2e-34    
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    135   2e-34    
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     134   2e-34    
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            135   3e-34    
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             135   3e-34    
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             135   3e-34    
ref|XP_008228922.1|  PREDICTED: vignain-like                            135   3e-34    
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             135   3e-34    
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             135   3e-34    
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    135   3e-34    
ref|XP_010037483.1|  PREDICTED: vignain-like                            135   4e-34    
ref|XP_007048792.1|  Senescence-associated gene 12                      135   4e-34    
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        135   4e-34    
ref|XP_009420878.1|  PREDICTED: vignain-like                            135   4e-34    
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        135   4e-34    
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    135   4e-34    
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         135   5e-34    
tpg|DAA42119.1|  TPA: hypothetical protein ZEAMMB73_388689              132   5e-34    
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        134   5e-34    
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             134   5e-34    
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...    132   5e-34    
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            135   5e-34    
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             134   6e-34    
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             134   6e-34    
ref|XP_004306813.1|  PREDICTED: senescence-specific cysteine prot...    134   6e-34    
gb|ADR32294.1|  C14 cysteine protease                                   131   6e-34    
ref|XP_002864049.1|  hypothetical protein ARALYDRAFT_495086             134   7e-34    
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        134   7e-34    
ref|NP_568722.1|  KDEL-tailed cysteine endopeptidase CEP1               134   7e-34    
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    135   7e-34    
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        134   7e-34    
ref|XP_004308524.1|  PREDICTED: senescence-specific cysteine prot...    134   8e-34    
dbj|BAF56430.1|  cysteine proteinase                                    134   8e-34    
ref|XP_004306836.1|  PREDICTED: senescence-specific cysteine prot...    134   8e-34    
emb|CAN62459.1|  hypothetical protein VITISV_015168                     132   8e-34    
ref|XP_010441769.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    134   8e-34    
gb|KHN30007.1|  Cysteine proteinase RD21a                               134   9e-34    
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a               134   9e-34    
gb|AAB23155.1|  COT44=cysteine proteinase homolog                       133   1e-33    
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...    133   1e-33    
ref|XP_004515851.1|  PREDICTED: vignain-like                            134   1e-33    
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    133   1e-33    
ref|XP_009361500.1|  PREDICTED: vignain-like                            133   1e-33    
ref|XP_009797968.1|  PREDICTED: vignain-like                            133   1e-33    
gb|ADR32295.1|  C14 cysteine protease                                   130   1e-33    
emb|CBI21973.3|  unnamed protein product                                133   1e-33    
ref|XP_009359967.1|  PREDICTED: vignain-like                            133   1e-33    
ref|XP_006469011.1|  PREDICTED: vignain-like                            133   1e-33    
gb|ADR32298.1|  C14 cysteine protease                                   130   2e-33    
gb|ADR32292.1|  C14 cysteine protease                                   130   2e-33    
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    133   2e-33    
gb|ADR32296.1|  C14 cysteine protease                                   130   2e-33    
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             133   2e-33    



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   376 bits (965),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM
Sbjct  274  IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  333

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNVKAKTGLCGIAMEASYPTKKGGDNPPPSPPSPPSPTPTPPSPSPSVCDKFNACPAST
Sbjct  334  QRNVKAKTGLCGIAMEASYPTKKGGDNPPPSPPSPPSPTPTPPSPSPSVCDKFNACPAST  393

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM
Sbjct  394  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  453

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
            TRIPAQPMWAFKNAGKKGTSS
Sbjct  454  TRIPAQPMWAFKNAGKKGTSS  474



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 155/200 (78%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLY SGIFTG CGT LDHGVAAVGYG+ENG DYWIV+NSWG  WGEKGY+RM
Sbjct  276  IEAGGRDFQLYESGIFTGKCGTSLDHGVAAVGYGSENGKDYWIVRNSWGSSWGEKGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV+ +TGLCGIA+E SYPTK G +         P P+P  P   PSVCD +  CP ST
Sbjct  336  QRNVEVRTGLCGIAVEPSYPTKTGANP------PNPGPSPPSPVTPPSVCDDYYECPEST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +  YCFAWGCCPL+ A CC+DHYSCCPH+YPVCH++SGTC+  K+NPLGVKAM
Sbjct  390  TCCCVYEYSGYCFAWGCCPLEGATCCEDHYSCCPHEYPVCHIQSGTCSISKDNPLGVKAM  449

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI A+P+  F   G+K +S
Sbjct  450  KRILAKPVGTFGKEGRKSSS  469



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 149/188 (79%), Gaps = 6/188 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLYSSGIFTGSCGTDLDHGV AVGYGTENGVDYWIVKNSW   WGEKGY+RM
Sbjct  274  IEAGGRDFQLYSSGIFTGSCGTDLDHGVTAVGYGTENGVDYWIVKNSWAASWGEKGYLRM  333

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNVK K GLCGIA+E SYPTK G        P  P P+P  P   P++CD ++ CP ST
Sbjct  334  QRNVKDKNGLCGIAIEPSYPTKTG------ENPPNPGPSPPSPVSPPNMCDDYDECPTST  387

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCVFP+G +CFAWGC PL+SAVCC+DHYSCCPHDYPVCHV  GTC   KN+PLGVK M
Sbjct  388  TCCCVFPYGEHCFAWGCSPLESAVCCEDHYSCCPHDYPVCHVSQGTCPMSKNSPLGVKPM  447

Query  542  TRIPAQPM  565
             R PA+ +
Sbjct  448  RRTPAKKI  455



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 153/197 (78%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGTDLDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  276  IEAGGREFQLYHSGIFTGRCGTDLDHGVVAVGYGTENGKDYWIVRNSWGGDWGESGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV   TG CGIA+E SYPTKKG + P P+P  P   +P        VCD + +CP+ST
Sbjct  336  ERNVNTSTGKCGIAIEPSYPTKKGQNPPKPAPSPPSPVSPPT------VCDNYYSCPSST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCFAWGCCPL+ A CC+DHYSCCPHDYPVC+V++GTC   K+NPLGVKA+
Sbjct  390  TCCCVYEYGRYCFAWGCCPLEGATCCEDHYSCCPHDYPVCNVKAGTCQLSKDNPLGVKAL  449

Query  542  TRIPAQPMWAFKNAGKK  592
             R PA+P WAF  AG K
Sbjct  450  ARTPAKPHWAFLGAGGK  466



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 153/197 (78%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGTDLDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  276  IEAGGREFQLYHSGIFTGRCGTDLDHGVVAVGYGTENGKDYWIVRNSWGGDWGESGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV   TG CGIA+E SYPTKKG + P P+P  P   +P        VCD + +CP+ST
Sbjct  336  ERNVNTSTGKCGIAIEPSYPTKKGQNPPKPAPSPPSPVSPPT------VCDNYYSCPSST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCFAWGCCPL+ A CC+DHYSCCPHDYPVC+V++GTC   K+NPLGVKA+
Sbjct  390  TCCCVYEYGRYCFAWGCCPLEGATCCEDHYSCCPHDYPVCNVKAGTCQLSKDNPLGVKAL  449

Query  542  TRIPAQPMWAFKNAGKK  592
             R PA+P WAF  AG K
Sbjct  450  ARTPAKPHWAFLGAGGK  466



>ref|XP_008796470.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=466

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT+LDHGV AVGYG+ENG  YWIVKNSWG  WGE GY+RM
Sbjct  272  IEAGGRAFQLYQSGIFTGYCGTELDHGVTAVGYGSENGQGYWIVKNSWGSEWGESGYIRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP ST
Sbjct  332  ERNVNAATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCPEST  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ FGNYCFAWGCCPL+ A CC+DHYSCCP DYP+C+V+ GTC   KNNPLGVKAM
Sbjct  386  TCCCVYEFGNYCFAWGCCPLEGATCCEDHYSCCPQDYPICNVQEGTCLVSKNNPLGVKAM  445

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R PA+P WA+  A  K +S+
Sbjct  446  KRTPAKPYWAYSGAEGKWSSA  466



>gb|KDO84078.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84079.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84080.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84081.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84082.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=262

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 152/202 (75%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  68   IEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRM  127

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S
Sbjct  128  ERNVAGTLTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPES  181

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCVF +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   K+NPLGV+A
Sbjct  182  NTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA  241

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+P WA  N G  G+SS
Sbjct  242  LRRTPAKPYWAHGNQG--GSSS  261



>ref|XP_006434710.1| hypothetical protein CICLE_v100010542mg, partial [Citrus clementina]
 gb|ESR47950.1| hypothetical protein CICLE_v100010542mg, partial [Citrus clementina]
Length=307

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 152/202 (75%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  113  IEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRM  172

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S
Sbjct  173  ERNVAGTLTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPES  226

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCVF +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   K+NPLGV+A
Sbjct  227  NTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA  286

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+P WA  N G  G+SS
Sbjct  287  LRRTPAKPYWAHGNQG--GSSS  306



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 150/200 (75%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLYSSG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  264  IEAGGRDFQLYSSGVFSGRCGTALDHGVVAVGYGTENGQDYWIVRNSWGKSWGESGYLRM  323

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN++  TG+CGIAMEASYP KKG +      P  P P+P  P   PSVCD + +CP S 
Sbjct  324  ARNIRKPTGICGIAMEASYPIKKGQN------PPNPGPSPPSPVKPPSVCDNYFSCPESN  377

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F + N+CF WGCCPL+ A CCDDHYSCCPHDYP+C+V  GTC   K+NPLGVKA+
Sbjct  378  TCCCIFEYANFCFEWGCCPLEGATCCDDHYSCCPHDYPICNVNQGTCLMSKDNPLGVKAI  437

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             R  A+P WA    GKK ++
Sbjct  438  RRTRAKPHWALGAEGKKSST  457



>ref|XP_010927504.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=468

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 145/196 (74%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQ Y SGIFTG CGT LDHGV AVGYG+E+G DYWIVKNSWG  WGE GY+RM
Sbjct  276  IEGGGTAFQFYESGIFTGYCGTALDHGVTAVGYGSEDGKDYWIVKNSWGSEWGEGGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN  A TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP ST
Sbjct  336  ERNTNAATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCPEST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ FG YCFAWGCCPL+ A CC+DHYSCCPHDYP+C+VR GTC   KNNPLGVKAM
Sbjct  390  TCCCVYDFGRYCFAWGCCPLEGATCCEDHYSCCPHDYPICNVREGTCLTSKNNPLGVKAM  449

Query  542  TRIPAQPMWAFKNAGK  589
             R PA P WA+   GK
Sbjct  450  KRTPAMPYWAYSAQGK  465



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 149/191 (78%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGTDLDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  276  IEAGGREFQLYHSGIFTGRCGTDLDHGVVAVGYGTENGKDYWIVRNSWGGDWGESGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAME+SYPTKKG        P  P P+P  P   P+VCD + +CP+ T
Sbjct  336  ERNVNASTGKCGIAMESSYPTKKG------QNPPNPGPSPPSPVNHPAVCDNYYSCPSGT  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ FG  CFAWGCCPL+ A CC+D YSCCPHDYPVC+V++GTC   K+NPLGVKA+
Sbjct  390  TCCCVYEFGRRCFAWGCCPLEGATCCEDRYSCCPHDYPVCNVKAGTCQLSKDNPLGVKAL  449

Query  542  TRIPAQPMWAF  574
             RIPA+  WAF
Sbjct  450  VRIPAKAHWAF  460



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 152/202 (75%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  274  IEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRM  333

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S
Sbjct  334  ERNVAGTLTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPES  387

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCVF +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   K+NPLGV+A
Sbjct  388  NTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA  447

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+P WA  N G  G+SS
Sbjct  448  LRRTPAKPYWAHGNQG--GSSS  467



>gb|KDO84077.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=219

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 150/201 (75%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+ GG  FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  25   IDGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRM  84

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S
Sbjct  85   ERNVAGTLTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPES  138

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCVF +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   K+NPLGV+A
Sbjct  139  NTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA  198

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+P WA  N G   ++
Sbjct  199  LRRTPAKPYWAHGNQGGSSSA  219



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 153/200 (77%), Gaps = 5/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +EAGG DFQLY+SGIF+G CG +LDHGV+ VGYGTE G DYWIV+NSWG  WGEKGY+RM
Sbjct  283  VEAGGRDFQLYNSGIFSGKCGVELDHGVSVVGYGTEKGKDYWIVRNSWGVSWGEKGYLRM  342

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV +K GLCGIA+E SYPTK G + P P P  P  P   P      VCD +  CP ST
Sbjct  343  ERNVASKDGLCGIAIEPSYPTKTGANPPKPGPSPPSPPVAPPS-----VCDDYYECPEST  397

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCFAWGCCPL+ A CC+DHYSCCPH+YPVC++R+GTC+  KNNPLGV+AM
Sbjct  398  TCCCVYEYGKYCFAWGCCPLEGATCCEDHYSCCPHEYPVCNIRAGTCSISKNNPLGVQAM  457

Query  542  TRIPAQPMWAFKNAGKKGTS  601
              I A+P+ AF   GKK +S
Sbjct  458  KSILAKPIGAFGKQGKKSSS  477



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIF G CGTDLDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  275  IEAGGREFQLYHSGIFNGRCGTDLDHGVVAVGYGTENGKDYWIVRNSWGGDWGESGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV   TG CGI ME SYPTKKG        P  P+P+P  P   P+VCDK+ +CP+ T
Sbjct  335  ERNVNISTGKCGITMEPSYPTKKG------QNPPKPAPSPPSPVNPPTVCDKYYSCPSGT  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G  CFAWGCCPL+ A CC+DHYSCCPHDYPVC+V++GTC   K+NPLGVKA+
Sbjct  389  TCCCVYEYGRSCFAWGCCPLEGATCCEDHYSCCPHDYPVCNVKAGTCQLSKDNPLGVKAL  448

Query  542  TRIPAQPMWAFKNA-GKK  592
             R PA+P WAF  A GKK
Sbjct  449  ARAPAKPHWAFSGAEGKK  466



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y+SGIF+G CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  274  IEAGGRDFQFYASGIFSGRCGTQLDHGVAAVGYGTENGKDYWIVRNSWGKSWGENGYLRM  333

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             R++ + TG+CGIAMEASYP KKG +      P  P+P P  P   P+VCD + +CP + 
Sbjct  334  ARSINSPTGICGIAMEASYPIKKGQN------PPNPAPLPPSPVTPPTVCDNYYSCPDNN  387

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +GN+CF WGCCPL+ A CC+DHYSCCPHDYP+C++  GTC   K+NPL VKAM
Sbjct  388  TCCCLFEYGNFCFEWGCCPLEGATCCEDHYSCCPHDYPICNINQGTCLMSKDNPLAVKAM  447

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RIPA+P WA   A KK ++
Sbjct  448  IRIPAKPHWALGAAAKKSSA  467



>ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=463

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTG+CGT LDHGV AVGYGTENG DYWIVKNSWG  WGEKGY+RM
Sbjct  267  IEASGRAFQLYSSGIFTGTCGTALDHGVTAVGYGTENGKDYWIVKNSWGGSWGEKGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNVK+ +G CGIA+E SYP KKG + P P P  P    P        VCD + +CP ST
Sbjct  327  ERNVKSSSGKCGIAVEPSYPLKKGANPPNPGPTPPSPTPPPT------VCDNYYSCPEST  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYPVC+V+ GTC   K++PL VKA+
Sbjct  381  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPVCNVQQGTCLTSKDSPLSVKAL  440

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P WAF      G  S
Sbjct  441  KRTLAKPHWAFSGNSADGMKS  461



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQ Y SGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  276  IEAGGREFQFYQSGIFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIA+E SYP KKG +      P  P P+P  P   PSVCD + +CP ST
Sbjct  336  ERNIATATGKCGIAIEPSYPIKKGQN------PPNPGPSPPSPIKPPSVCDSYFSCPEST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +  YCF WGCCPL+ A CCDDHYSCCPHDYPVC++  GTC   K+NP GVKAM
Sbjct  390  TCCCIFEYAKYCFEWGCCPLEGATCCDDHYSCCPHDYPVCNINEGTCLIGKDNPFGVKAM  449

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             R PA+P WA+   G+K ++
Sbjct  450  RRTPAKPHWAYGLEGRKNSA  469



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 153/197 (78%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT+LDHGV  VGYGTE+G DYWIV+NSW + WGE GY+RM
Sbjct  279  IEAGGREFQLYQSGIFTGRCGTELDHGVVVVGYGTEDGKDYWIVRNSWANDWGEAGYIRM  338

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNVK  TG CGIAME SYPTKKG +      P  P P+P PP   P VCD + +CP+ST
Sbjct  339  ERNVKTSTGKCGIAMEPSYPTKKGQN------PPNPGPSPFPPVNPPIVCDNYYSCPSST  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G+YCFAW CCPL+ A CC+DHYSCCPHD+PVC+V++GTC   K+NPLGVKA+
Sbjct  393  TCCCVYEYGHYCFAWACCPLEGATCCEDHYSCCPHDHPVCNVQAGTCQMSKDNPLGVKAL  452

Query  542  TRIPAQPMWAFKNAGKK  592
              IPA+P WA+ +   K
Sbjct  453  AWIPAKPHWAYLDGKSK  469



>ref|XP_010932205.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis]
Length=469

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 149/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT+LDHGV A+GYG+ENG  YWIVKNSWG  WGE GY+RM
Sbjct  275  IEAGGRAFQLYESGIFTGYCGTELDHGVTAIGYGSENGKYYWIVKNSWGSDWGESGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + TG CGIAMEASYP K G + P P P  P    P        VCD + +CP S 
Sbjct  335  ERNINSATGKCGIAMEASYPIKNGQNPPNPGPSPPSPSKPPT------VCDSYYSCPESM  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ FG+YCFAWGCCPL+ A CC+DHYSCCPHDYP+C+V+ GTC   KNNPLGVKA 
Sbjct  389  TCCCVYEFGSYCFAWGCCPLEGATCCEDHYSCCPHDYPICNVQEGTCLVSKNNPLGVKAT  448

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             RIPA+P WA+  A  + +S+
Sbjct  449  KRIPAKPYWAYFGAQGERSSA  469



>gb|KDO84083.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
 gb|KDO84084.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=190

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +2

Query  23   FQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAK  202
            FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM+RNV   
Sbjct  3    FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT  62

Query  203  -TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPASTTCCCVF  379
             TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S TCCCVF
Sbjct  63   LTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVF  116

Query  380  PFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAMTRIPAQ  559
             +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   K+NPLGV+A+ R PA+
Sbjct  117  EYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAK  176

Query  560  PMWAFKNAGKKGTS  601
            P WA  N G   ++
Sbjct  177  PYWAHGNQGGSSSA  190



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQ YSSGIFTG CGT LDHGV AVGYGTENG D+WIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGREFQFYSSGIFTGKCGTSLDHGVVAVGYGTENGKDFWIVRNSWGKSWGEDGYLRM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+++ TG CGIAMEASYP KKG +      P  P P+P  P   PSVCD + +CP   
Sbjct  333  ERNIQSPTGKCGIAMEASYPIKKGQN------PPNPGPSPPSPVKPPSVCDNYYSCPEGN  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +GNYCF WGCCPL+ A CC+DHYSCCP +YPVC++  GTC   K+NPLGVKAM
Sbjct  387  TCCCIFEYGNYCFEWGCCPLEGATCCEDHYSCCPKEYPVCNINQGTCLMSKDNPLGVKAM  446

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             R  A P WA  N  KK ++
Sbjct  447  RRTRALPHWALANGSKKSSA  466



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQ Y SGIFTG CGT+LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  279  IEAGGREFQFYQSGIFTGRCGTELDHGVAAVGYGTENGTDYWIVRNSWGGDWGEAGYIRM  338

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAMEASYP KK         P  P P+P  P   P+VCD + +CP+ST
Sbjct  339  ERNVNASTGKCGIAMEASYPVKK------SQNPPNPGPSPPSPVNPPTVCDNYYSCPSST  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +  YCFAWGCCPL++A CCDDH SCCP DYPVC+  +GTC   K NPLGVKA+
Sbjct  393  TCCCVYEYNGYCFAWGCCPLEAATCCDDHSSCCPRDYPVCNTEAGTCQMSKENPLGVKAL  452

Query  542  TRIPAQPMWAFKNAGKK  592
             R PA+P WA+    +K
Sbjct  453  VRTPAKPYWAYSGRVEK  469



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT LDHGV  VGYG++NG DYWIV+NSWG  WGE GY+RM
Sbjct  275  IEAGGRAFQLYQSGIFTGRCGTRLDHGVVVVGYGSDNGKDYWIVRNSWGGDWGEAGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA TG CGIAME SYP KKG +      P  P P+P  P   P+VCD++ +CP +T
Sbjct  335  ERNIKASTGKCGIAMEPSYPIKKGKN------PPHPGPSPPSPVSPPTVCDEYYSCPPAT  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G+YCFAWGCCPL++A+CCDDH+SCCPHDYP C+V +GTC   K+NPLGVKA+
Sbjct  389  TCCCLYEYGSYCFAWGCCPLEAAICCDDHFSCCPHDYPACNVGAGTCQISKDNPLGVKAL  448

Query  542  TRIPAQPMWAF  574
             R PA+P+WAF
Sbjct  449  VRTPAKPLWAF  459



>ref|XP_009420643.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 150/201 (75%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQ Y SGIFTGSCGTDLDHGV AVGYG+ENG DYWIVKNSWG+ WGE GY+RM
Sbjct  275  IEAAGRAFQFYDSGIFTGSCGTDLDHGVTAVGYGSENGKDYWIVKNSWGEDWGEDGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + TG CGIAMEASYP K+G        P  P P+P  P   P+VCD +  C  ST
Sbjct  335  ERNIASSTGKCGIAMEASYPIKEG------QNPPNPGPSPPSPVKPPTVCDDYYTCEEST  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCFAWGCCPL+ A CC+DHYSCCPHDYP+C+V+ GTC + KN+PL VKA 
Sbjct  389  TCCCVYEYGKYCFAWGCCPLEDATCCEDHYSCCPHDYPICNVQEGTCLQSKNSPLSVKAS  448

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R PA+P WA  N+G +G  S
Sbjct  449  KRTPAKPYWA--NSGSEGKKS  467



>ref|XP_008796668.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=473

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 147/201 (73%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGTDLDHGV AVGYG+ENG +YWIVKNSWG  WGE GYVRM
Sbjct  280  IEGGGRAFQLYESGIFTGYCGTDLDHGVTAVGYGSENGKEYWIVKNSWGSEWGEAGYVRM  339

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP ST
Sbjct  340  ERNINAATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCPEST  393

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ FG  CFAWGCCPL+ A CCDDHYSCCPHDYP+C+V  G C   KNNPLGVKAM
Sbjct  394  TCCCVYEFGRNCFAWGCCPLEGATCCDDHYSCCPHDYPICNVEEGICLMSKNNPLGVKAM  453

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
               PA+P   +  +G +G SS
Sbjct  454  KHTPAKPYQGY--SGAQGRSS  472



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT LDHGV  VGYG+ENGVDYWIV+NSWG  WGE+GY+RM
Sbjct  278  IEAGGRAFQLYQSGIFTGRCGTALDHGVITVGYGSENGVDYWIVRNSWGSSWGEEGYIRM  337

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+ +   G CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  338  ERNLASTDNGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVTPPTVCDGYYSCPES  391

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ FG++CFAWGCCPL+SA CC+DHYSCCPH++PVC++ +GTC    NNPLGVKA
Sbjct  392  NTCCCVYQFGSFCFAWGCCPLESATCCEDHYSCCPHEFPVCNIDAGTCQLSNNNPLGVKA  451

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+P W F +AG++ +SS
Sbjct  452  LKRTPAKPFWTFGSAGRRKSSS  473



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 149/198 (75%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGTDLDHGV AVGYGTENG  YWIV+NSWG  WGE GY+RM
Sbjct  279  IEAGGREFQLYHSGIFTGRCGTDLDHGVVAVGYGTENGKGYWIVRNSWGGDWGESGYIRM  338

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +R+V A  G CGIAMEASYPTKKG        P  P P+P  P   P+VCD   +CP+ T
Sbjct  339  ERDVNASAGKCGIAMEASYPTKKG------QNPPNPGPSPPSPVNPPAVCDSSYSCPSGT  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV  FG  CFAWGCCPL+ A CC+DHYSCCPHDYPVC+V++GTC   K+NPLGVKA+
Sbjct  393  TCCCVSEFGRRCFAWGCCPLEGATCCEDHYSCCPHDYPVCNVKAGTCQLSKDNPLGVKAL  452

Query  542  TRIPAQPMWAFKNA-GKK  592
             R PA+  WAF  A GKK
Sbjct  453  VRTPAKLHWAFSGAEGKK  470



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG CGT +DHGV AVGYG+ENG+DYWI++NSWG  WGEKGY+R+
Sbjct  273  IEAGGKDFQHYVSGIFTGKCGTAVDHGVVAVGYGSENGMDYWIIRNSWGASWGEKGYLRV  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV +  GLCG+A+E SYP K G + P PSP  P    P         CD +  CP  T
Sbjct  333  QRNVASSKGLCGLAIEPSYPVKTGVNPPKPSPSPPSPIKPPTQ------CDDYAQCPEGT  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCVF + N CF+WGCCPL+ A CC+DHYSCCPHDYPVC+VR+GTC+  KNNPLGVKAM
Sbjct  387  TCCCVFEYYNSCFSWGCCPLEGATCCEDHYSCCPHDYPVCNVRAGTCSISKNNPLGVKAM  446

Query  542  TRIPAQPMWAFKNAGKKGTS  601
              I A+P+ AF N GKK +S
Sbjct  447  KHILAEPIGAFINGGKKSSS  466



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG C T +DHGV   GYGTENG+DYWI++NSWG  WGEKGY+R+
Sbjct  273  IEAGGRDFQHYKSGIFTGKCSTAVDHGVVVAGYGTENGMDYWIIRNSWGAKWGEKGYLRV  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV   +GLCG+A+E SYP K G + P P+P  P    P         CD+ + CP  T
Sbjct  333  QRNVARSSGLCGLAIEPSYPVKTGANPPKPAPSPPSPVKPPTE------CDESSQCPVGT  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+  F N CF+WGCCPL+ A CC+DHYSCCPHDYPVC+VR GTC+  K NPLGVKAM
Sbjct  387  TCCCILQFHNSCFSWGCCPLEGATCCEDHYSCCPHDYPVCNVRQGTCSMSKGNPLGVKAM  446

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI AQP+ AF N GKK +S
Sbjct  447  KRILAQPIGAFGNGGKKSSS  466



>emb|CBI19479.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT LDHGV AVGYGTENGVDYWIVKNSWG  WGE+GY+RM
Sbjct  194  IEAGGREFQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRM  253

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R++  + TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + ACP S
Sbjct  254  ERDLATSATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTVCDNYYACPES  307

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC+F +  YCF WGCCPL++A CC+DH SCCP +YPVC+VR+GTC   K+NPLGVKA
Sbjct  308  STCCCIFEYAKYCFQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKA  367

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R  A+P WA+   GK+ ++
Sbjct  368  LKRTAAKPHWAYGGDGKRSSA  388



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT LDHGV AVGYG+ENGVDYWIVKNSWG  WGE+GY+RM
Sbjct  278  IEAGGRAFQLYQSGIFTGRCGTALDHGVTAVGYGSENGVDYWIVKNSWGGSWGEEGYIRM  337

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+ +  TG CGIAM+ASYP K+G        P  P P+P  P   P+VCD + +CP S
Sbjct  338  ERNLASGLTGKCGIAMQASYPIKQG------QNPPNPGPSPPSPVKPPTVCDGYYSCPES  391

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FG YCF WGCCPL+SA CC+DHYSCCP DYPVC+V +GTC   K+NPLGVKA
Sbjct  392  NTCCCLFEFGKYCFEWGCCPLESATCCEDHYSCCPQDYPVCNVDAGTCLMSKDNPLGVKA  451

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R  A+P WA+ +AG++ +++
Sbjct  452  LKRSAAKPFWAYGSAGRRKSNN  473



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQ Y SG+FTG+CGT LDHGV AVGYGTEN VDYWIVKNSWG  WGE GY+RM
Sbjct  269  IEASGMAFQFYESGVFTGNCGTALDHGVTAVGYGTENSVDYWIVKNSWGSSWGESGYIRM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN  A TG CGIA+E SYP K          P  P P+P  P   P+VCD +  CP S+
Sbjct  329  ERNTGA-TGKCGIAVEPSYPIK------TSQNPPNPGPSPPSPIKPPTVCDDYYTCPESS  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+V +GTC   K+NPLGVKAM
Sbjct  382  TCCCVYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPICNVYAGTCLMSKDNPLGVKAM  441

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI A+P WAF N GK+ ++
Sbjct  442  KRIQAKPQWAFANDGKRSSA  461



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  268  IEAGGRAFQLYNSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYIKM  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN++A TG CGIAMEASYP KKG        P  P P+P  P   P+VCD +  CP S+
Sbjct  328  ARNIEASTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYTCPESS  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YC AWGCCPL++A CC+D+YSCCPHDYPVC+V+ GTC   KNNPLGVKA 
Sbjct  382  TCCCLFQYGKYCLAWGCCPLEAATCCEDNYSCCPHDYPVCNVQQGTCLMSKNNPLGVKAF  441

Query  542  TRIPAQPMWA  571
             RIPA P+W+
Sbjct  442  KRIPANPIWS  451



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQ Y SGIFTG CGT LDHGV AVGYGTENGVDYWIVKNSWG  WGE+GY++M
Sbjct  284  IEAGGREFQFYDSGIFTGKCGTALDHGVTAVGYGTENGVDYWIVKNSWGGSWGEQGYIKM  343

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV  + TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  344  ARNVANSPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCPES  397

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ + NYCFAWGCCPL++A CC+DHYSCCP D+PVC+V +GTC   K+NPLGVKA
Sbjct  398  NTCCCVYEYANYCFAWGCCPLEAATCCEDHYSCCPQDFPVCNVNAGTCQMSKDNPLGVKA  457

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+  WAF + G+K ++
Sbjct  458  LKRTPAKFHWAFGSDGQKSSA  478



>ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda]
 gb|ERN16692.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda]
Length=538

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 150/201 (75%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G DFQLY SG+FTGSCGTDLDHGV AVGYGTE GV YWIVKNSWG  WGE GY+++
Sbjct  344  IEAAGRDFQLYQSGVFTGSCGTDLDHGVTAVGYGTEKGVHYWIVKNSWGGSWGESGYIKL  403

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN K+KTG CGIAMEASYP KKG        P  P P+P  P   P++CD +  CP S 
Sbjct  404  ERNAKSKTGKCGIAMEASYPIKKG------DNPPNPGPSPPSPVKPPTMCDNYYTCPESN  457

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G YCF+WGCCPL++A CC DHYSCCPHDYP+C++ +GTC   KN+P GVKA+
Sbjct  458  TCCCVYEYGPYCFSWGCCPLEAATCCADHYSCCPHDYPICNLNAGTCLASKNSPFGVKAL  517

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R PA+P WA   + +  +S+
Sbjct  518  KRTPAKPYWALGGSSQGKSSA  538



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT LDHGV AVGYGTENGVDYWIVKNSWG  WGE+GY+RM
Sbjct  275  IEAGGREFQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRM  334

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R++  + TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + ACP S
Sbjct  335  ERDLATSATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTVCDNYYACPES  388

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC+F +  YCF WGCCPL++A CC+DH SCCP +YPVC+VR+GTC   K+NPLGVKA
Sbjct  389  STCCCIFEYAKYCFQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKA  448

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R  A+P WA+   GK+ ++
Sbjct  449  LKRTAAKPHWAYGGDGKRSSA  469



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQ Y SGIFTG CGT LDHGV AVGYGTENGVDYWIVKNSWG  WGE+GY++M
Sbjct  284  IEAGGREFQFYDSGIFTGKCGTALDHGVTAVGYGTENGVDYWIVKNSWGGSWGEQGYIKM  343

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV  + TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  344  ARNVANSPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCPES  397

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ + NYCFAWGCCPL++A CC+DHYSCCP D+PVC+V +GTC   K+NPLGVKA
Sbjct  398  NTCCCVYEYANYCFAWGCCPLEAATCCEDHYSCCPQDFPVCNVNAGTCQMSKDNPLGVKA  457

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+  WAF + G+K ++
Sbjct  458  LKRTPAKFHWAFGSDGQKSSA  478



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT LDHGV AVGYGTENGVDYWIVKNSWG  WGE+GY+RM
Sbjct  273  IEAGGREFQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R++  + TG CGIAMEASYP KKG        P  P P+P  P   P+VCD + ACP S
Sbjct  333  ERDLATSATGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTVCDNYYACPES  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC+F +  YCF WGCCPL++A CC+DH SCCP +YPVC+VR+GTC   K+NPLGVKA
Sbjct  387  STCCCIFEYAKYCFQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKA  446

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R  A+P WA+   GK+ ++
Sbjct  447  LKRTAAKPHWAYGGDGKRSSA  467



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG+DFQ Y SGIFTG CGT +DHGV AVGYG+ENG+DYWI++NSWG  WGEKGY+R+
Sbjct  277  IEAGGHDFQHYVSGIFTGKCGTAVDHGVVAVGYGSENGMDYWIIRNSWGASWGEKGYLRV  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV +  GLCG+A+E SYP K G + P P P  P    P         CD +  CP  T
Sbjct  337  QRNVASSKGLCGLAIEPSYPVKTGVNPPKPGPSPPSPIKPPTQ------CDDYAQCPEGT  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCVF + N CF+WGCCPL+ A CC+DHYSCCPHDYPVC++R+GTC+  K+NPLGVKAM
Sbjct  391  TCCCVFEYYNSCFSWGCCPLEGATCCEDHYSCCPHDYPVCNIRAGTCSISKDNPLGVKAM  450

Query  542  TRIPAQPMWAFKNAGKKGTS  601
              I A+P+ AF N G+K +S
Sbjct  451  KHIHAEPIEAFINGGRKSSS  470



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY+SG+FTG CGT LDHGVAAVGYGTE G DYWIV+NSWG  WGE GY+RM
Sbjct  272  IEGGGRNFQLYNSGVFTGECGTSLDHGVAAVGYGTEKGKDYWIVRNSWGKSWGESGYIRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + TG CGIA+E SYP KKG + P P P  P    P        VCD + +CP S+
Sbjct  332  ERNIASPTGKCGIAIEPSYPIKKGQNPPNPGPSPPSPVKPPS------VCDNYFSCPDSS  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL+ A CCDDHYSCCPH+YPVC+V  GTC   K NP GVKA+
Sbjct  386  TCCCIFEYGKYCFAWGCCPLEGATCCDDHYSCCPHEYPVCNVNEGTCLISKGNPFGVKAL  445

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             R PA+P WA    GK   +
Sbjct  446  RRTPAKPHWAHGTEGKNSVA  465



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 144/196 (73%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY SG+FTG CGT LDHGVAAVGYGTE G DYWIV+NSWG  WGE GY+RM
Sbjct  272  IEGGGRNFQLYDSGVFTGECGTSLDHGVAAVGYGTEKGKDYWIVRNSWGKSWGESGYIRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + TG CGIA+E SYP KKG +      P  P P+P  P   PSVCD + +CP S 
Sbjct  332  ERNIASPTGKCGIAIEPSYPIKKGQN------PPNPGPSPPSPVKPPSVCDNYFSCPDSN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL+ A CCDDHYSCCPHDYPVC+V  GTC   K NP GVKA+
Sbjct  386  TCCCIFEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPVCNVNEGTCLISKGNPFGVKAL  445

Query  542  TRIPAQPMWAFKNAGK  589
             R PA+P WA    GK
Sbjct  446  RRTPAKPHWAHGTEGK  461



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 152/202 (75%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGTDLDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+R+
Sbjct  269  IEAGGRAFQLYQSGVFTGLCGTDLDHGVAAVGYGTENGKDYWIVRNSWGSSWGENGYIRL  328

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+    TG CGIA+EASYP K G  NPP   PSPP+P          VCD +  CP  
Sbjct  329  ERNLANTTTGKCGIAVEASYPVKNGDTNPPKPAPSPPTPVKPAT-----VCDDYYTCPEG  383

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ +G YCF WGCCPL+SA CCDDH SCCPH+YPVC V++GTC   K++P+G+KA
Sbjct  384  TTCCCVYEYGKYCFGWGCCPLESATCCDDHSSCCPHEYPVCDVKAGTCLVSKDSPMGIKA  443

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + RI A+P W+ +N G+K +S+
Sbjct  444  LKRIDAKPHWSSQNGGRKISSA  465



>dbj|BAG92753.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93806.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 151/201 (75%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  68   IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  127

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +         P PTP  P+P P+VCD +  CP ST
Sbjct  128  ERNIKASSGKCGIAVEPSYPLKKGENP------PNPGPTPPSPTPPPTVCDNYYTCPDST  181

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  182  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  241

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  242  KRTLAKPNLSFLFGNGKKSSA  262



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTGSCGT LDHGV AVGYGTENGVDYW+V+NSWG  WGE GY+RM
Sbjct  284  IEAGGRAFQLYQSGVFTGSCGTQLDHGVVAVGYGTENGVDYWVVRNSWGPAWGENGYIRM  343

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV + +TG CGIAMEASYPTKKG + P P P  P    P+PP  S   CD + +CPA 
Sbjct  344  ERNVASTETGKCGIAMEASYPTKKGANPPNPGPSPPSPVNPSPPPSSE--CDDYYSCPAG  401

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G+YCF WGCCPL+SA CCDDHYSCCPH+YPVC +  GTC   KNNP GVKA
Sbjct  402  STCCCIYQYGDYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLEGGTCRMSKNNPFGVKA  461

Query  539  MTRIPAQPMWAFKNAGKK  592
            +TR PA+   + +  GK+
Sbjct  462  LTRAPARIAQSHQLGGKR  479



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG D Q Y SGIFTG CGT +DHGV A GYG+ENG+DYWIV+NSWG  WGEKGY+R+
Sbjct  273  IEAGGRDLQHYKSGIFTGKCGTAVDHGVVAAGYGSENGMDYWIVRNSWGAKWGEKGYLRV  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV + +GLCG+A E SYP K G + P P+P  P    P         CD+++ CP  T
Sbjct  333  QRNVASSSGLCGLATEPSYPVKTGANPPKPAPSPPSPVKPPTE------CDEYSQCPVGT  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV  F   CF+WGCCPL+ A CC+DH SCCPHDYPVC+VR GTC+  K NPLGVKAM
Sbjct  387  TCCCVLEFRRSCFSWGCCPLEGATCCEDHSSCCPHDYPVCNVRQGTCSMSKGNPLGVKAM  446

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI AQP+ AF N GKK +S
Sbjct  447  KRILAQPIGAFGNGGKKSSS  466



>ref|NP_001183396.1| uncharacterized protein LOC100501813 [Zea mays]
 gb|ACR36639.1| unknown [Zea mays]
Length=291

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIFTG+CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  92   IEAGGRAFQLYNSGIFTGTCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  151

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD + +CP ST
Sbjct  152  ERNIKASSGKCGIAVEPSYPLKKGAN------PPNPGPTPPSPTPPPTVCDNYYSCPDST  205

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYPVC+V+ GTC   K++P  L VK
Sbjct  206  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPVCNVKQGTCLMGKDSPLSLSVK  265

Query  536  AMTRIPAQPMWAF  574
            A  R  A+P WAF
Sbjct  266  ATKRTLAKPHWAF  278



>emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 149/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG+CGT LDHGVAAVGYGTENG DYW+V+NSWG  WGE GY+RM
Sbjct  267  IEAGGRAFQLYKSGIFTGTCGTALDHGVAAVGYGTENGKDYWLVRNSWGSVWGEDGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYPTK G +      P  P PTP  P+P  SVCD +N CPAST
Sbjct  327  ERNIKASSGKCGIAVEPSYPTKTGEN------PPNPGPTPPSPAPPSSVCDSYNECPAST  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH+YP+C+ + GTC   K++PL VKA 
Sbjct  381  TCCCIYEYGKECFAWGCCPLEGATCCDDHYSCCPHNYPICNTKQGTCLAAKDSPLSVKAQ  440

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P+ AF      G  S
Sbjct  441  RRTLAKPIGAFSGIAIDGKKS  461



>gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii]
Length=463

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 149/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG+CGT LDHGVAAVGYGTENG DYW+V+NSWG  WGE GY+RM
Sbjct  267  IEAGGRAFQLYKSGIFTGTCGTALDHGVAAVGYGTENGKDYWLVRNSWGTVWGEDGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYPTK G +      P  P PTP  P+P  SVCD +N CPAST
Sbjct  327  ERNIKASSGKCGIAVEPSYPTKTGEN------PPNPGPTPPSPAPPSSVCDSYNECPAST  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH+YP+C+ + GTC   K++PL VKA 
Sbjct  381  TCCCIYEYGKECFAWGCCPLEGATCCDDHYSCCPHNYPICNTQQGTCLAAKDSPLSVKAQ  440

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P+ AF      G  S
Sbjct  441  RRTLAKPIGAFSGIATDGKKS  461



>ref|NP_001105993.1| cysteine protease component of protease-inhibitor complex precursor 
[Zea mays]
 dbj|BAA88898.1| cysteine protease component of protease-inhibitor complex [Zea 
mays]
Length=465

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 151/202 (75%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTGSCGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  268  IEAAGTQFQLYSSGIFTGSCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP K+G      + P  P P+P  P+P+P+VCD + +CP ST
Sbjct  328  ERNIKASSGKCGIAVEPSYPLKEG------ANPPNPGPSPPSPTPAPAVCDNYYSCPDST  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP-LGVKA  538
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+VR GTC   K++P L VKA
Sbjct  382  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPICNVRQGTCLMGKDSPLLSVKA  441

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
              R  A+P WAF      G  S
Sbjct  442  TKRTLAKPHWAFSGNTADGMKS  463



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 145/199 (73%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY SG+FTGSCGT LDHGV AVGYG E+G++YWIVKNSWG+ WGEKGY+RM
Sbjct  272  IEGGGRDFQLYDSGVFTGSCGTALDHGVTAVGYGEEDGMEYWIVKNSWGESWGEKGYIRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN K  TGLCGIAMEASYP K G + P P P  P    P        VCD + +CP   
Sbjct  332  ERNTKY-TGLCGIAMEASYPIKDGMNPPNPGPSPPSPVQPPS------VCDSYYSCPEGD  384

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ + NYCF+WGCCPL++A CC+DHYSCCPHDYP+C+V  GTC   KN+PL V A 
Sbjct  385  TCCCIYEYANYCFSWGCCPLEAASCCEDHYSCCPHDYPICNVYEGTCQMSKNSPLAVPAF  444

Query  542  TRIPAQPMWAFKNAGKKGT  598
             R PA+P WAF   GK  +
Sbjct  445  KRTPAKPHWAFSGIGKSSS  463



>dbj|BAF02546.1| triticain alpha [Triticum aestivum]
 gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum turgidum 
subsp. durum]
Length=461

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 149/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG+CGT LDHGVAAVGYGTENG DYW+V+NSWG  WGE GY+RM
Sbjct  265  IEAGGRAFQLYKSGIFTGTCGTALDHGVAAVGYGTENGKDYWLVRNSWGTVWGEDGYIRM  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYPTK G +      P  P PTP  P+P  SVCD +N CPAST
Sbjct  325  ERNIKASSGKCGIAVEPSYPTKTGEN------PPNPGPTPPSPAPPSSVCDSYNECPAST  378

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH+YP+C+ + GTC   K++PL VKA 
Sbjct  379  TCCCIYEYGKECFAWGCCPLEGATCCDDHYSCCPHNYPICNTQQGTCLAAKDSPLSVKAQ  438

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P+ AF      G  S
Sbjct  439  RRTLAKPIGAFSVIATDGKKS  459



>ref|NP_001149658.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG36262.1| cysteine protease 1 precursor [Zea mays]
Length=469

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIFTG+CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  270  IEAGGRAFQLYNSGIFTGTCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD + +CP ST
Sbjct  330  ERNIKASSGKCGIAVEPSYPLKKGAN------PPNPGPTPPSPTPPPTVCDNYYSCPDST  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYPVC+V+ GTC   K++P  L VK
Sbjct  384  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPVCNVKQGTCLMGKDSPLSLSVK  443

Query  536  AMTRIPAQPMWAF  574
            A  R  A+P WAF
Sbjct  444  ATKRTLAKPHWAF  456



>gb|EMS56635.1| Oryzain alpha chain [Triticum urartu]
Length=483

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 148/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG+CGT LDHGVAAVGYGTENG DYW+V+NSWG  WGE GY+RM
Sbjct  287  IEAGGRAFQLYKSGIFTGTCGTALDHGVAAVGYGTENGKDYWLVRNSWGTVWGEDGYIRM  346

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYPTK G +         P PTP  P+P  SVCD +N CPAST
Sbjct  347  ERNIKASSGKCGIAVEPSYPTKTGENP------PNPGPTPPSPAPPSSVCDSYNECPAST  400

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH+YP+C+ + GTC   K++PL VKA 
Sbjct  401  TCCCIYEYGKECFAWGCCPLEGATCCDDHYSCCPHNYPICNTQQGTCLAAKDSPLSVKAQ  460

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P+ AF      G  S
Sbjct  461  RRTLAKPIGAFSVIATDGKKS  481



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTGSCGT LDHGV  VGYGTENGVDYW+V+NSWG  WGE GY+RM
Sbjct  273  IEAGGRAFQLYQSGVFTGSCGTQLDHGVVVVGYGTENGVDYWVVRNSWGPAWGENGYIRM  332

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV + +TG CGIAMEASYPTKKG + P P P  P    P+PP  S   CD + +CPA 
Sbjct  333  ERNVASTETGKCGIAMEASYPTKKGANPPNPGPSPPSPVNPSPPPSSE--CDDYYSCPAG  390

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++P+G+YCF WGCCPL+SA CCDDH SCCPH+YPVC + +GTC   KNNP GVKA
Sbjct  391  STCCCIYPYGDYCFGWGCCPLESATCCDDHNSCCPHEYPVCDLEAGTCRMSKNNPFGVKA  450

Query  539  MTRIPAQPMWAFKNAGKK  592
            +TR PA+   + +  GK+
Sbjct  451  LTRAPARIAQSHQLGGKR  468



>emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa Japonica Group]
Length=458

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  264  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  323

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  324  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  377

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  378  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  437

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  438  KRTLAKPNLSFLFGNGKKSSA  458



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG CG  +DHGV AVGYG+ENG+DYWIV+NSWG  WGE GY+RM
Sbjct  280  IEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGENGYLRM  339

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+    GLCGIA  ASYP K G + P P+P  P    P         CD +N CPA T
Sbjct  340  QRNIGNPKGLCGIATIASYPVKTGQNPPKPAPSPPSPVKPPTQ------CDDYNECPAGT  393

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ + NYCFAWGCCP++ A CC DH SCCPHDYPVC+V++GTC+  KNNPLGVKAM
Sbjct  394  TCCCVYKYYNYCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLGVKAM  453

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
              I A+P+  F N GKK  SS
Sbjct  454  QHILAKPIGTFGNEGKKSPSS  474



>ref|NP_001148706.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG32602.1| cysteine protease 1 precursor [Zea mays]
Length=463

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 151/203 (74%), Gaps = 8/203 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTGSCGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  265  IEAAGTAFQLYSSGIFTGSCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP K+G      + P  P P+P  P+P+P+VCD + +CP ST
Sbjct  325  ERNIKASSGKCGIAVEPSYPLKEG------ANPPNPGPSPPSPTPAPAVCDNYYSCPDST  378

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+VR GTC   K++P  L VK
Sbjct  379  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPICNVRQGTCLMGKDSPLSLSVK  438

Query  536  AMTRIPAQPMWAFKNAGKKGTSS  604
            A  R  A+P WAF      G  S
Sbjct  439  ATKRTLAKPHWAFSGNTADGMKS  461



>tpg|DAA35682.1| TPA: cysteine proteinase Mir3 [Zea mays]
Length=468

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 151/203 (74%), Gaps = 8/203 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTGSCGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  270  IEAAGTAFQLYSSGIFTGSCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP K+G      + P  P P+P  P+P+P+VCD + +CP ST
Sbjct  330  ERNIKASSGKCGIAVEPSYPLKEG------ANPPNPGPSPPSPTPAPAVCDNYYSCPDST  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+VR GTC   K++P  L VK
Sbjct  384  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPICNVRQGTCLMGKDSPLSLSVK  443

Query  536  AMTRIPAQPMWAFKNAGKKGTSS  604
            A  R  A+P WAF      G  S
Sbjct  444  ATKRTLAKPHWAFSGNTADGMKS  466



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 147/201 (73%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG CG  +DHGV AVGYG+ENG+DYWIV+NSWG  WGEKGY+RM
Sbjct  280  IEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGEKGYLRM  339

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+    GLCGIA  ASYP K G + P P+P  PP   PT        CD +N CPA T
Sbjct  340  QRNIGNPKGLCGIATIASYPVKTGQNPPKPAPSPPPVKPPTQ-------CDDYNECPAGT  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +  YCFAWGCCP++ A CC DH SCCPHDYPVC+V++GTC+  KNNPLGVKAM
Sbjct  393  TCCCVYEYYKYCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLGVKAM  452

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
              I A+P+  F N GKK  SS
Sbjct  453  QHILAKPIGTFGNEGKKSPSS  473



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 148/193 (77%), Gaps = 5/193 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+R+
Sbjct  281  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPNWGEAGYIRL  340

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIA+EASYPTKKG +     P   PSP   PP   P+VCD++ +CP  
Sbjct  341  ERNVASTNTGKCGIAIEASYPTKKGQN----PPRPLPSPPSPPPVKPPTVCDEYYSCPLG  396

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GNYCF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NPL VKA
Sbjct  397  TTCCCAYEYGNYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPLSVKA  456

Query  539  MTRIPAQPMWAFK  577
            + R PA+    F+
Sbjct  457  LRRTPARSSRRFR  469



>gb|AFW59668.1| LOW QUALITY PROTEIN: cysteine protease 1 [Zea mays]
Length=469

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIFTG+CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  270  IEAGGRAFQLYNSGIFTGTCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD + +CP ST
Sbjct  330  ERNIKASSGKCGIAVEPSYPLKKGAN------PPNPGPTPPSPTPPPTVCDNYYSCPDST  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYPVC+V+ GTC   K++P  L VK
Sbjct  384  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPVCNVKQGTCLMGKDSPLSLSVK  443

Query  536  AMTRIPAQPMWAF  574
            A  R  A+P WAF
Sbjct  444  ATKRTLAKPHWAF  456



>dbj|BAA14402.1| oryzain alpha precursor [Oryza sativa Japonica Group]
Length=458

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  264  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  323

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  324  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  377

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  378  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  437

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  438  KRTLAKPNLSFLFGNGKKSSA  458



>sp|P25776.2|ORYA_ORYSJ RecName: Full=Oryzain alpha chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABB30151.1| oryzain alpha [Oryza sativa Japonica Group]
Length=458

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  264  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  323

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  324  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  377

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  378  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  437

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  438  KRTLAKPNLSFLFGNGKKSSA  458



>gb|EEC78138.1| hypothetical protein OsI_17694 [Oryza sativa Indica Group]
Length=458

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  264  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  323

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  324  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  377

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  378  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  437

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  438  KRTLAKPNLSFLFGNGKKSSA  458



>gb|EEE61807.1| hypothetical protein OsJ_16426 [Oryza sativa Japonica Group]
Length=459

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  265  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  325  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  378

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  379  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  438

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  439  KRTLAKPNLSFLFGNGKKSSA  459



>emb|CAJ86180.1| H0212B02.7 [Oryza sativa Indica Group]
Length=470

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  276  IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P P+VCD +  CP ST
Sbjct  336  ERNIKASSGKCGIAVEPSYPLKKGEN------PPNPGPTPPSPTPPPTVCDNYYTCPDST  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC   K++PL VKA+
Sbjct  390  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKAL  449

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R  A+P  +F     K +S+
Sbjct  450  KRTLAKPNLSFLFGNGKKSSA  470



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 141/187 (75%), Gaps = 6/187 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G DFQ Y SGIFTG CGT+LDHGV  VGYGTE  VDYWIV+NSWGD WGEKGY+RM
Sbjct  273  IEASGRDFQFYESGIFTGKCGTELDHGVNVVGYGTEKNVDYWIVRNSWGDSWGEKGYIRM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNVK+ +GLCGI  E SYP K G +         P P+P  P   PSVCD++  CPAS+
Sbjct  333  QRNVKSASGLCGITSEPSYPVKNGENP------PNPGPSPPSPVKPPSVCDEYYTCPASS  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ F N CF WGCCPL+SA CCDDHYSCCPH+YPVC+V +GTC+  K +PLGVK M
Sbjct  387  TCCCVYEFYNECFEWGCCPLESASCCDDHYSCCPHEYPVCNVYAGTCSTSKGSPLGVKLM  446

Query  542  TRIPAQP  562
             RIPA P
Sbjct  447  KRIPATP  453



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG CG  +DHGV AVGYG+ENG+DYWIV+NSWG  WGE GY+RM
Sbjct  279  IEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGENGYLRM  338

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+    GLCGIA  ASYP K G + P P+P  P    P         CD +N CPA T
Sbjct  339  QRNIGNPKGLCGIATIASYPVKTGQNPPKPAPSPPSPVKPPTQ------CDDYNECPAGT  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ + NYCFAWGCCP++ A CC DH SCCPHDYPVC+V++GTC+  KNNPLGVKAM
Sbjct  393  TCCCVYKYYNYCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLGVKAM  452

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
              I A+P+  F N GKK  SS
Sbjct  453  QHILAKPIGTFGNEGKKTPSS  473



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +EAGG DFQ Y SGIFTG CGT +DHGV   GYGTENG+DYWIV+NSWG  WGE GY+R+
Sbjct  273  LEAGGRDFQHYKSGIFTGKCGTAVDHGVVIAGYGTENGMDYWIVRNSWGANWGENGYLRV  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV + +GLCG+A+E SYP K G + P P+P  P    P         CD+++ C   T
Sbjct  333  QRNVASSSGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTE------CDEYSQCAVGT  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+  F   CF+WGCCPL+ A CC+DHYSCCPHDYP+C+VR GTC+  K NPLGVKAM
Sbjct  387  TCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAM  446

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI AQP+ AF N GKK +S
Sbjct  447  KRILAQPIGAFGNGGKKSSS  466



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 148/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+RM
Sbjct  276  IEAGGREFQLYRSGIFTGRCGTKLDHGVVAVGYGTQNGEDYWIVRNSWGGDWGEAGYIRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAMEASYP K G +      P  P PTP  P   P+VCD +  CP+ T
Sbjct  336  ERNLNTSTGKCGIAMEASYPIKNGEN------PPNPGPTPPSPVSPPTVCDNYYTCPSHT  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G  CFAWGCCPL++A CC+DHYSCCPHDYPVC+V +GTC   K+NPL VKA 
Sbjct  390  TCCCVYEYGGTCFAWGCCPLEAATCCEDHYSCCPHDYPVCNVEAGTCQMSKDNPLVVKAF  449

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R PA+P WA+    ++  ++
Sbjct  450  ARTPAKPYWAYSGLAEENRNA  470



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G DFQ Y SGIFTG CGTDLDHGV  VGYGTENG DYWIV+NSWG  WGEKGY+RM
Sbjct  267  IEASGRDFQFYDSGIFTGKCGTDLDHGVVVVGYGTENGKDYWIVRNSWGADWGEKGYLRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +R + +K G+CGI  E SYP K G        P  P P+P  P    SVCD++  CP ST
Sbjct  327  ERGISSKAGICGITSEPSYPVKSG------VNPPNPGPSPPSPKSPESVCDEYYTCPMST  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +  YCFAWGCCPL+ A CCDD YSCCPHDYPVC+VR+GTC+   NNPLGVKA+
Sbjct  381  TCCCMYEYYGYCFAWGCCPLEGASCCDDGYSCCPHDYPVCNVRAGTCSMSNNNPLGVKAI  440

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI A P W   + GKK T+
Sbjct  441  QRILATPNWQHGSKGKKVTA  460



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLY SG+FTGSCGT LDHGV  VGYGTE+GVDYWIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGRDFQLYQSGVFTGSCGTQLDHGVVTVGYGTEHGVDYWIVRNSWGPAWGENGYIRM  332

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R+V + +TG CGIAMEASYPTKK  + P P P  P    P PP    S CD + +CPA 
Sbjct  333  ERDVASTETGKCGIAMEASYPTKKSANPPNPGPSPPSPVNPPPPEKPSSECDDYYSCPAG  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G+YCF WGCCPL+SA CCDDHYSCCPH+YPVC +++GTC   K+NP GVKA
Sbjct  393  STCCCIYQYGDYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLQAGTCRMSKSNPFGVKA  452

Query  539  MTRIPAQ  559
            +TR PA+
Sbjct  453  LTRAPAR  459



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  270  IEAGGRAFQLYDSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGKNWGESGYLRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN++A TG CGIAMEASYP KKG        P  P P+P  P   P+VCD +  CP S 
Sbjct  330  ARNIEASTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYTCPESN  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CC+D+ SCCPHD+PVC+V+ GTC   KNNP+ VKA+
Sbjct  384  TCCCLFKYGKYCFAWGCCPLEAATCCEDNSSCCPHDFPVCNVKQGTCLMSKNNPMSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P W+
Sbjct  444  KRTPAKPFWS  453



>ref|XP_006652923.1| PREDICTED: oryzain alpha chain-like [Oryza brachyantha]
Length=461

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 149/203 (73%), Gaps = 9/203 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTG+CGT LDHGVAAVGYG+ NG DYWIVKNSWG  WGE GYVRM
Sbjct  265  IEAAGRAFQLYSSGIFTGTCGTALDHGVAAVGYGSANGKDYWIVKNSWGASWGESGYVRM  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP K G        P  P PTP  P    +VCD +  CP ST
Sbjct  325  ERNIKASSGKCGIAVEPSYPLKTG------ENPPNPGPTPPSPPSPATVCDDYYTCPDST  378

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPHDYP+C+V+ GTC   K++PL VKA+
Sbjct  379  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHDYPICNVQQGTCLMGKDSPLAVKAL  438

Query  542  TRIPAQPMWAF---KNAGKKGTS  601
             R  A+P W+F   +  GKK ++
Sbjct  439  KRTLAKPNWSFLGNRANGKKSSA  461



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 146/193 (76%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+++
Sbjct  283  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPNWGEAGYIKL  342

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIA+EASYPTKKG + P P P  P  P   P      VCD++ +CP  
Sbjct  343  ERNVASINTGKCGIAIEASYPTKKGQNPPRPPPSPPSPPVKPPT-----VCDEYYSCPMG  397

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GNYCF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NPL VKA
Sbjct  398  TTCCCAYEYGNYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPLSVKA  457

Query  539  MTRIPAQPMWAFK  577
            + R PA+    F+
Sbjct  458  LKRTPARSSRRFR  470



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 148/199 (74%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY SG+FTG CGT LDHGVA VGYGTE+G+DYWIV+NSWGD WGE GY+RM
Sbjct  267  IEGGGRDFQLYDSGVFTGKCGTALDHGVAVVGYGTEDGLDYWIVRNSWGDTWGEGGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN K  +G+CGIA+E SYP K G        P  P P+P  P   PSVCD   +C   T
Sbjct  327  QRNTKLPSGICGIAIEPSYPIKSG------LNPPNPGPSPPSPVQPPSVCDDNYSCAERT  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F + +YC++WGCCPL++A CC+D+YSCCPHDYPVC++ +GTC+  KNNP+ + A+
Sbjct  381  TCCCLFEYAHYCYSWGCCPLEAATCCEDNYSCCPHDYPVCNIYAGTCSMGKNNPIQIPAL  440

Query  542  TRIPAQPMWAFKNAGKKGT  598
             R PA+P WAF N GK  +
Sbjct  441  KRTPAKPHWAFGNVGKSSS  459



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 146/193 (76%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+++
Sbjct  283  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPNWGEAGYIKL  342

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIA+EASYPTKKG + P P P  P  P   P      VCD++ +CP  
Sbjct  343  ERNVASINTGKCGIAIEASYPTKKGQNPPRPPPSPPSPPVKPPT-----VCDEYYSCPMG  397

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GNYCF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NPL VKA
Sbjct  398  TTCCCAYEYGNYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPLSVKA  457

Query  539  MTRIPAQPMWAFK  577
            + R PA+    F+
Sbjct  458  LKRTPARSSRRFR  470



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 149/201 (74%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY+SG+FTG CGT LDHGV  VGYGT+ GVDYWIV+NSWG  WGE+GY+RM
Sbjct  279  IEGGGRDFQLYNSGVFTGRCGTSLDHGVTVVGYGTDKGVDYWIVRNSWGGSWGEEGYIRM  338

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+     G+CGIAMEASYP K G        P  P P+P  P   PSVCD + +CP S
Sbjct  339  ERNLGNTAHGICGIAMEASYPVKSG------LNPPNPGPSPPSPVQPPSVCDNYYSCPES  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL+ A CCDDHYSCCP DYPVC++ +GTC   K+NPLGVKA
Sbjct  393  NTCCCIYEYANYCFAWGCCPLEGATCCDDHYSCCPSDYPVCNLNAGTCQLSKDNPLGVKA  452

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R+PA+P WA    GK+ +S
Sbjct  453  LKRMPAKPHWAI-GGGKRSSS  472



>gb|AAD28476.1|AF133838_1 papain-like cysteine protease [Sandersonia aurantiaca]
Length=370

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 141/189 (75%), Gaps = 6/189 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+ GG  FQLY+SGIFTG CGT LDHGV  VGYG+E+G DYWIV+NSWG+ WGEKGY+RM
Sbjct  176  IDGGGRSFQLYNSGIFTGKCGTSLDHGVTVVGYGSESGKDYWIVRNSWGESWGEKGYIRM  235

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+ + +G+CGIAMEASYP KKG + P P P  P    P        VCD + +CP S+
Sbjct  236  ARNIDSPSGICGIAMEASYPIKKGQNPPNPGPSPPSPVKPPS------VCDNYYSCPESS  289

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G  CFAWGCCPL+ A CCDDH SCCPHD+P+C+V+ G C K KNNPLGVKA+
Sbjct  290  TCCCLFQYGRSCFAWGCCPLEGATCCDDHSSCCPHDFPICNVQQGLCLKSKNNPLGVKAL  349

Query  542  TRIPAQPMW  568
             R PA P W
Sbjct  350  ARTPAIPSW  358



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY SGIFTG CG DLDHGV  VGYG+ENGVDYWIV+NSWG  WGEKGYVRM
Sbjct  278  IEGGGRDFQLYESGIFTGRCGVDLDHGVNVVGYGSENGVDYWIVRNSWGASWGEKGYVRM  337

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+K+KTGLCGIA+E SYP K   +         P P+P  P   PSVCD + +CP S 
Sbjct  338  QRNIKSKTGLCGIAVEPSYPIKTSQNP------PNPGPSPPSPVKPPSVCDDYYSCPESD  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +   C  WGCCPL+ A CCDDH SCCPH+YPVC++ +GTC+  K NPLGVKAM
Sbjct  392  TCCCIFEYYGECLEWGCCPLEGATCCDDHSSCCPHEYPVCNIYAGTCSISKGNPLGVKAM  451

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             R  A+PM      GKK +S
Sbjct  452  RRTLAKPMGTSTKDGKKSSS  471



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+++
Sbjct  270  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPSWGEAGYIKL  329

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIA+EASYPTKKG + P P P  P  P   P      VCD + +CP  
Sbjct  330  ERNVASTNTGKCGIAIEASYPTKKGQNPPRPPPSPPSPPPVKPTI----VCDDYYSCPVG  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GN CF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NPL VKA
Sbjct  386  TTCCCTYEYGNLCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPLSVKA  445

Query  539  MTRIPAQPMWAFKNAGK  589
            + R PA+    F  AGK
Sbjct  446  LKRTPARSNRHFHFAGK  462



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT LDHGV  VGYGTENG DYWIV+NSW   WGE GY+RM
Sbjct  275  IEAGGREFQLYKSGVFTGRCGTKLDHGVVVVGYGTENGKDYWIVRNSWSSDWGEAGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIA+E SYPTKKG + P P P  P   +P         CDK+ +CP+ST
Sbjct  335  ERNLNTSTGKCGIAIEPSYPTKKGQNPPNPGPSPPSPVSPPI------TCDKYFSCPSST  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G++CFAWGCCP++ A CC+DH SCCP D+PVC+ ++GTC   K+NPLGVKA+
Sbjct  389  TCCCVYEYGSHCFAWGCCPVEGATCCEDHRSCCPPDFPVCNAQAGTCQLSKDNPLGVKAL  448

Query  542  TRIPAQPMWAFKNAGKK  592
             RIPA+P WA+ +   K
Sbjct  449  DRIPAKPHWAYSDDESK  465



>ref|XP_003580684.2| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon]
Length=486

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG CGT LDHGV AVGYG+ENG DYWIVKNSWG  WGE GYVR+
Sbjct  296  IEAGGRAFQLYKSGIFTGRCGTALDHGVTAVGYGSENGKDYWIVKNSWGTVWGEDGYVRL  355

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +      P  P PTP  P+P  +VCD +N CPAST
Sbjct  356  ERNIKATSGKCGIAIEPSYPLKKGAN------PPNPGPTPPSPAPPSTVCDSYNECPAST  409

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH YP+C+V+ GTC   K++P+ VKA+
Sbjct  410  TCCCIYTYGKECFAWGCCPLEGATCCDDHYSCCPHSYPICNVQQGTCLAGKDSPMSVKAL  469

Query  542  TRIPAQPMWAF  574
             RI A+P   F
Sbjct  470  KRILAKPHGTF  480



>dbj|BAH11164.1| cysteine protease [Hordeum vulgare]
Length=462

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 152/203 (75%), Gaps = 9/203 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIFTG+CGT LDHGVAAVGYGTENG DYW+V+NSWG  WGE GY+RM
Sbjct  266  IEAGGRAFQLYKSGIFTGTCGTALDHGVAAVGYGTENGKDYWLVRNSWGSVWGENGYIRM  325

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYPTK G +      P  P PTP  P+P+ SVC   N CPAST
Sbjct  326  ERNIKASSGKCGIAVEPSYPTKTGEN------PPNPGPTPPSPAPTSSVCYSHNECPAST  379

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G  CFAWGCCPL+ A CCDDHYSCCPH+YP+C+ + GTC   K++PL VKA 
Sbjct  380  TCCCIYEYGKECFAWGCCPLEGATCCDDHYSCCPHNYPICNTKQGTCLAAKDSPLSVKAQ  439

Query  542  TRIPAQPMWAF---KNAGKKGTS  601
             R  A+P+ AF    N GKK ++
Sbjct  440  RRTLAKPIGAFPGIANDGKKSSA  462



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 144/201 (72%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE+GY+RM
Sbjct  272  IEAGGRAFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEEGYIRM  331

Query  182  QRN-VKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RN   + TG CGIA+EASYP KKG        P  P P+P  P   P+VCD +  CP S
Sbjct  332  ARNEANSVTGKCGIAIEASYPIKKG------QNPPNPGPSPPSPIKPPTVCDSYYTCPES  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ +  YCFAWGCCPL++A CCDDHYSCCPH+YP+C++  GTC   K NPLGVKA
Sbjct  386  NTCCCVYEYYGYCFAWGCCPLEAATCCDDHYSCCPHEYPICNINEGTCLMSKGNPLGVKA  445

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+P WA  + GKK  +
Sbjct  446  LRRTPAKPFWAHGSVGKKSNA  466



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 147/197 (75%), Gaps = 5/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+++
Sbjct  280  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPSWGEAGYIKL  339

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIA+EASYP+K+G + P P P  P  P   P      VCD + +CP  
Sbjct  340  ERNVASTNTGKCGIAIEASYPSKQGQNPPRPPPSPPSPPPVKPTI----VCDDYYSCPLG  395

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GN+CF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NPL VKA
Sbjct  396  TTCCCTYEYGNFCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPLSVKA  455

Query  539  MTRIPAQPMWAFKNAGK  589
            + R PA+    F  AGK
Sbjct  456  LKRTPARSNRHFHFAGK  472



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  273  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  333  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTTCDKYFSCPESN  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YCF WGCCPL+SA CCDDH SCCPH+YPVC +  GTC   KN+PL VKA+
Sbjct  387  TCCCLYKYGKYCFGWGCCPLESATCCDDHSSCCPHEYPVCDINRGTCLMSKNSPLSVKAL  446

Query  542  TRIPAQPMWA  571
             R PA P WA
Sbjct  447  KRTPAIPFWA  456



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 145/201 (72%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG+ WGE+GY+RM
Sbjct  258  IEAGGRAFQLYASGIFNGICGTQLDHGVVAVGYGTENGKDYWIVRNSWGNQWGEEGYIRM  317

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+    TG CGIA+EASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  318  ERNLANTATGKCGIAIEASYPIKNG------QNPPNPGPSPPSPIKPPTVCDNYYSCPES  371

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ +  YCFAWGCCPL++A CCDDHYSCCPHDYP+C++  GTC   K NP+ VKA
Sbjct  372  NTCCCVYEYYGYCFAWGCCPLEAATCCDDHYSCCPHDYPICNLNEGTCLMSKGNPMAVKA  431

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA P WA  + G K  +
Sbjct  432  LRRTPATPFWAHGSVGVKNNA  452



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTGSCGT LDHGV  VGYGTE+GVDYWIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGRGFQLYQSGVFTGSCGTQLDHGVVTVGYGTEHGVDYWIVRNSWGPAWGENGYIRM  332

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R+V + +TG CGIAMEASYPTKK  + P P P  P    P PP    S CD + +CPA 
Sbjct  333  ERDVASTETGKCGIAMEASYPTKKSANPPNPGPSPPSPVNPPPPEKPSSECDDYYSCPAG  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G+YCF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NP GVKA
Sbjct  393  STCCCIYQYGDYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLEAGTCRMSKSNPFGVKA  452

Query  539  MTRIPAQ  559
            +TR PA+
Sbjct  453  LTRAPAR  459



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 147/201 (73%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY+SG+FTG CGT LDHGV  VGYGT+ GVDYWIV+NSWG  WGE+GY+RM
Sbjct  279  IEGGGRDFQLYNSGVFTGRCGTSLDHGVTVVGYGTDKGVDYWIVRNSWGGSWGEEGYIRM  338

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+     G+CGIAMEASYP K G        P  P P+P  P   PSVCD + +CP S
Sbjct  339  ERNLGNTAHGICGIAMEASYPVKSG------LNPPNPGPSPPSPVQPPSVCDNYYSCPES  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL+ A CCDDHYSCCP DYPVC+V +GTC   K+NPLGVKA
Sbjct  393  NTCCCIYEYANYCFAWGCCPLEGATCCDDHYSCCPSDYPVCNVNAGTCQLSKDNPLGVKA  452

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R  A+P WA    GK+ +S
Sbjct  453  LKRTAAKPHWAI-GGGKRSSS  472



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 145/201 (72%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT LDHGVAAVGYGTENG DYWIV NSWG  WGE GY+RM
Sbjct  273  IEAGGRAFQLYQSGVFTGKCGTSLDHGVAAVGYGTENGQDYWIVGNSWGKNWGEDGYIRM  332

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  + +G CGIA+  SYP K          P  P P+P  P   P+VCD + +CP  
Sbjct  333  ERNLAGSSSGKCGIAIGPSYPIKN------GPNPPNPGPSPPSPVQPPTVCDNYYSCPER  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G YCFAWGCCPL+ A CC+DHYSCCPHDYP+C+V+ GTC   KNNPLGVKA
Sbjct  387  TTCCCIYEYGKYCFAWGCCPLEGATCCEDHYSCCPHDYPICNVKDGTCLMSKNNPLGVKA  446

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+P W   N GK+  +
Sbjct  447  IRRTPAKPYWENLNEGKRSAA  467



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 145/201 (72%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG+ WGE+GY+RM
Sbjct  273  IEAGGRAFQLYASGIFNGICGTQLDHGVVAVGYGTENGKDYWIVRNSWGNQWGEEGYIRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+    TG CGIA+EASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  333  ERNLANTATGKCGIAIEASYPIKNG------QNPPNPGPSPPSPIKPPTVCDNYYSCPES  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ +  YCFAWGCCPL++A CCDDHYSCCPHDYP+C++  GTC   K NP+ VKA
Sbjct  387  NTCCCVYEYYGYCFAWGCCPLEAATCCDDHYSCCPHDYPICNLNEGTCLMSKGNPMAVKA  446

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA P WA  + G K  +
Sbjct  447  LRRTPATPFWAHGSVGVKNNA  467



>gb|KJB14608.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=341

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  156  IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  215

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  216  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  269

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   K NPL VKA
Sbjct  270  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMSKGNPLAVKA  329

Query  539  MTRIPAQPMWA  571
            + R PA+P WA
Sbjct  330  LKRTPAKPFWA  340



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y+SGIFTGSCGT LDHGV A GYGTE+G DYW+VKNSWG  WGE GY++M
Sbjct  275  IEAGGRDFQFYTSGIFTGSCGTALDHGVLAAGYGTEDGKDYWLVKNSWGAEWGEGGYLKM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+  K+G CGIAMEASYP  K GDN     P  P PTP  P+    VCD+++ CP ST
Sbjct  335  ERNIADKSGKCGIAMEASYPI-KNGDN-----PPNPGPTPPSPAAPEVVCDEYSTCPEST  388

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +  YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+VR GTC+K +N+PL + A 
Sbjct  389  TCCCIYEYYGYCFAWGCCPLEGASCCDDHYSCCPHDYPICNVRRGTCSKSRNSPLEISAT  448

Query  542  TRIPAQPMWAFKN  580
             RI A P    +N
Sbjct  449  KRILATPTKLKRN  461



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 148/201 (74%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFT +CGT LDHGVA VGYGTENG+DYWIV+NSWG  WGE GY+RM
Sbjct  269  IEGGGRAFQLYVSGIFTETCGTSLDHGVAVVGYGTENGLDYWIVRNSWGSNWGEDGYIRM  328

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+ +  TG CGIA+E SYP KKG        P  P P+P  P   P+VCD + +C  S
Sbjct  329  ERNLASTPTGKCGIAIEPSYPIKKG------QNPPNPGPSPPSPVKPPTVCDNYYSCADS  382

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCVF +G YCF+WGCCPL++A CC+DH SCCPHDYP+C++ +GTC   K+NPLGVKA
Sbjct  383  DTCCCVFEWGRYCFSWGCCPLEAATCCEDHNSCCPHDYPICNINAGTCLMSKDNPLGVKA  442

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R  A+P WAF+  GKK  +
Sbjct  443  LKRTAAKPHWAFRLDGKKSNA  463



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  273  IEAGGRAFQLYSSGVFDGLCGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN++A TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  333  ARNIEAPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTTCDKYFSCPESN  386

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YCF WGCCPL++A CCDD+ SCCPH+YPVC V  GTC   KN+P  VKA+
Sbjct  387  TCCCLYKYGKYCFGWGCCPLEAATCCDDNSSCCPHEYPVCDVNRGTCLMSKNSPFSVKAL  446

Query  542  TRIPAQPMWA  571
             R PA P WA
Sbjct  447  KRTPAIPFWA  456



>dbj|BAD29956.1| cysteine protease [Daucus carota]
Length=423

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 145/202 (72%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGTDLDHGV AVGYGTE+G DYWIV+NSWG  WGE GY+R+
Sbjct  228  IEAGGRAFQLYESGIFNGLCGTDLDHGVVAVGYGTEDGKDYWIVRNSWGPNWGENGYIRL  287

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIAM+ SYPTK G        P  P P+P  P    SVCD +  CPAS
Sbjct  288  ERNVASTNTGKCGIAMQPSYPTKTG------VNPPKPGPSPPSPVKPQSVCDDYYTCPAS  341

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ +G YCF WGCCPL++A CCDDH SCCP +YPVC + + TC   KN+P+G+KA
Sbjct  342  TTCCCVYEYGKYCFGWGCCPLEAATCCDDHSSCCPQEYPVCDINAQTCRLSKNSPIGIKA  401

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+P W   NA +K  S+
Sbjct  402  LKRSPARPNWTLANAARKFISA  423



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 141/192 (73%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY+SG+FTG CGT LDHGV  VGYGT++G+DYWIV+NSWG  WGE+GY+RM
Sbjct  282  IEGGGRDFQLYNSGVFTGRCGTALDHGVTVVGYGTDDGLDYWIVRNSWGGSWGEEGYIRM  341

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN+     G+CGIAME SYP KKG +      P  P P+P  P   PSVCD   +CP S
Sbjct  342  QRNLGNTANGICGIAMEPSYPIKKGQN------PPNPGPSPPSPVKPPSVCDNHYSCPES  395

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL+ A CCDDHYSCCP DYPVC V +G C   K NPLGVKA
Sbjct  396  NTCCCIYEYANYCFAWGCCPLEGATCCDDHYSCCPSDYPVCDVNAGACLMSKGNPLGVKA  455

Query  539  MTRIPAQPMWAF  574
            + R PA+P WA 
Sbjct  456  LKRTPAKPHWAI  467



>dbj|BAF01762.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
Length=300

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG  YWIV+NSWG+ WGE GY++M
Sbjct  110  IEAGGRAFQLYSSGVFDGLCGTELDHGVVAVGYGTENGKGYWIVRNSWGNRWGESGYIKM  169

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN++A TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  170  ARNIEAPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTTCDKYFSCPESN  223

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YCF WGCCPL++A CCDD+ SCCPH+YPVC V  GTC   KN+P  VKA+
Sbjct  224  TCCCLYKYGKYCFGWGCCPLEAATCCDDNSSCCPHEYPVCDVNRGTCLMSKNSPFSVKAL  283

Query  542  TRIPAQPMWA  571
             R PA P WA
Sbjct  284  KRTPAIPFWA  293



>gb|KJB14607.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=253

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  68   IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  127

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  128  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  181

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   K NPL VKA
Sbjct  182  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMSKGNPLAVKA  241

Query  539  MTRIPAQPMWA  571
            + R PA+P WA
Sbjct  242  LKRTPAKPFWA  252



>gb|KJB14606.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=303

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  118  IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  177

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  178  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  231

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   K NPL VKA
Sbjct  232  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMSKGNPLAVKA  291

Query  539  MTRIPAQPMWA  571
            + R PA+P WA
Sbjct  292  LKRTPAKPFWA  302



>sp|P20721.1|CYSPL_SOLLC RecName: Full=Low-temperature-induced cysteine proteinase; Flags: 
Precursor, partial [Solanum lycopersicum]
 gb|AAA66308.1| thiol protease, partial [Solanum lycopersicum]
Length=346

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +EAGG DFQ Y SGIFTG CGT +DHGV   GYGTENG+DYWIV+NSWG    E GY+R+
Sbjct  153  LEAGGRDFQHYKSGIFTGKCGTAVDHGVVIAGYGTENGMDYWIVRNSWGANCRENGYLRV  212

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV + +GLCG+A+E SYP K G + P P+P  P    P         CD+++ C   T
Sbjct  213  QRNVSSSSGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTE------CDEYSQCAVGT  266

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+  F   CF+WGCCPL+ A CC+DHYSCCPHDYP+C+VR GTC+  K NPLGVKAM
Sbjct  267  TCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAM  326

Query  542  TRIPAQPMWAFKNAGKKGTS  601
             RI AQP+ AF N GKK +S
Sbjct  327  KRILAQPIGAFGNGGKKSSS  346



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 141/192 (73%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY SG+FTG CGT LDHGV  VGYGT++G+DYWIV+NSWG  WGE+GY+RM
Sbjct  281  IEGGGRDFQLYISGVFTGRCGTALDHGVTVVGYGTDDGLDYWIVRNSWGGSWGEEGYIRM  340

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN+     G+CGIAME SYP K+G +      P  P P+P  P   PSVCD + +CP S
Sbjct  341  QRNLGNTANGICGIAMEPSYPIKEGQN------PPNPGPSPPSPVKPPSVCDNYYSCPES  394

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL+ A CCDDHYSCCP DYPVC V +G C   K NPLGVKA
Sbjct  395  NTCCCIYEYANYCFAWGCCPLEGATCCDDHYSCCPSDYPVCDVNAGACLMSKGNPLGVKA  454

Query  539  MTRIPAQPMWAF  574
            + R PA+P WA 
Sbjct  455  LKRTPAKPHWAI  466



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 145/197 (74%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SGIFTG CGT LDHGV AVGYGTENGVDYWIV+NSWG  WGE GYVRM
Sbjct  280  IEAGGREFQLYVSGIFTGKCGTALDHGVTAVGYGTENGVDYWIVRNSWGKSWGESGYVRM  339

Query  182  QRNVKAKT-GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+ A   G CGI M++SYP KKG        P  P P+P  P   P+VC ++++C +S
Sbjct  340  ERNLAASVAGKCGIVMQSSYPIKKG------QNPPNPGPSPPSPVNPPNVCSRYHSCASS  393

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCVF  G  CF+WGCCPL++AVCC DH SCCPH+YP+C+ R GTC + K+NP GVKA
Sbjct  394  TTCCCVFGIGKLCFSWGCCPLEAAVCCKDHSSCCPHNYPICNTRQGTCLRSKDNPFGVKA  453

Query  539  MTRIPAQPMWAFKNAGK  589
            M R PA+  W F +  K
Sbjct  454  MKRTPAKLHWPFGDQNK  470



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  272  IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  331

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  332  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   K NPL VKA
Sbjct  386  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMSKGNPLAVKA  445

Query  539  MTRIPAQPMWA  571
            + R PA+P WA
Sbjct  446  LKRTPAKPFWA  456



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  272  IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  331

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  332  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   K NPL VKA
Sbjct  386  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMSKGNPLAVKA  445

Query  539  MTRIPAQPMWA  571
            + R PA+P WA
Sbjct  446  LKRTPAKPFWA  456



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 142/201 (71%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLYSSG+FTG CGT LDHGVA VGYGTE+G DYWIV+NSWGD WGE GY+RM
Sbjct  275  IEGGGREFQLYSSGVFTGRCGTALDHGVAVVGYGTEHGSDYWIVRNSWGDSWGESGYIRM  334

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  + TG CGIAME SYP K G        P  P P+P  P   P VCD + +CP S
Sbjct  335  ERNLGNSATGKCGIAMEPSYPVKIG------QNPPNPGPSPPSPIKPPQVCDNYFSCPES  388

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ + NYCFAWGCCPL+ A CCDDHYSCCP DYPVC+V +GTC   K NP+ VKA
Sbjct  389  NTCCCIYQYQNYCFAWGCCPLEGATCCDDHYSCCPSDYPVCNVNAGTCQLSKGNPMSVKA  448

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+  W      K  +S
Sbjct  449  LKRTPAKAHWTLGGGAKHSSS  469



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 140/191 (73%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY+SG+FTG CGT LDHGV  VGYGT+ G+DYWIV+NSWG  WGEKGY+RM
Sbjct  279  IEGGGRDFQLYNSGVFTGRCGTALDHGVTVVGYGTDKGLDYWIVRNSWGASWGEKGYIRM  338

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN+     G+CGIAME SYP KKG +      P  P P+P  P   PSVCD + +CP S
Sbjct  339  QRNLGNTANGICGIAMEPSYPIKKGQN------PPNPGPSPPSPIKPPSVCDNYYSCPES  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ FGNYCF WGCCPL+ A CCDDHYSCCP +YPVC V +G C   K NPLGVKA
Sbjct  393  NTCCCIYQFGNYCFDWGCCPLEGATCCDDHYSCCPSEYPVCDVNAGACLMSKGNPLGVKA  452

Query  539  MTRIPAQPMWA  571
            + R  A+P WA
Sbjct  453  LKRTXAKPHWA  463



>gb|AAP41847.1| senescence-associated cysteine protease [Anthurium andraeanum]
Length=460

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 140/195 (72%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CG DLDHGV AVGYGTE+G DYWIV+NSWG  WGE GY+RM
Sbjct  265  IEGGGRSFQLYKSGIFDGRCGIDLDHGVVAVGYGTESGKDYWIVRNSWGKSWGEAGYIRM  324

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  + +G CGIA+E SYP KKG + P P+P  P    P         CD + +CP S
Sbjct  325  ERNLPSSSSGKCGIAIEPSYPIKKGQNPPKPAPSPPSPVKPPTE------CDNYYSCPES  378

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ +G YCFAWGCCPL +AVCCDDH SCCPHDYPVC+V+ G C   KNNPLGVK 
Sbjct  379  TTCCCVYEYGKYCFAWGCCPLVNAVCCDDHSSCCPHDYPVCNVKQGICLASKNNPLGVKM  438

Query  539  MTRIPAQPMWAFKNA  583
            + R PA+P  AF  A
Sbjct  439  LKRTPAKPHQAFSGA  453



>ref|XP_003589136.1| Cysteine proteinase [Medicago truncatula]
Length=295

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 140/197 (71%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLY  G+FTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE+GY+R+
Sbjct  101  VEGGGREFQLYEYGVFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGGSWGEQGYIRL  160

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  ++ G CGIA+E SYP K G + P P P  P    P        VCD + +C   
Sbjct  161  ERNLASSRAGKCGIAIEPSYPIKNGQNPPNPGPSPPSPIKPPS------VCDSYYSCAEG  214

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G  CF WGCCPL+SA CCDDHYSCCPH+YPVC  R+G C K KNNPLGVK+
Sbjct  215  STCCCIYEYGRSCFEWGCCPLESATCCDDHYSCCPHEYPVCDTRAGLCLKGKNNPLGVKS  274

Query  539  MTRIPAQPMWAFKNAGK  589
              R PA+P WAF    K
Sbjct  275  FKRTPAKPHWAFGGKNK  291



>dbj|BAE98640.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=202

 Score =   234 bits (596),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF GSCGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  12   IEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRM  71

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+ + +G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  72   ARNIASSSGKCGIAIEPSYPIKNG------ENPPNPGPSPPSPIKPPTQCDSYYTCPESN  125

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  126  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKAL  185

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  186  KRKPATPFWS  195



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 145/200 (73%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG+ WGE+GY+RM
Sbjct  273  IEAGGRAFQLYASGIFNGLCGTQLDHGVVAVGYGTENGKDYWIVRNSWGNQWGEEGYIRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+    TG CGIA+EASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  333  ERNLANTATGKCGIAIEASYPIKNG------QNPPNPGPSPPSPIKPPTVCDNYYSCPES  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+ +  YCFAWGCCPL++A CCDDHYSCCPHDYP+C++  GTC   K NP+ VKA
Sbjct  387  NTCCCVYEYYGYCFAWGCCPLEAATCCDDHYSCCPHDYPICNLNEGTCLMSKGNPMAVKA  446

Query  539  MTRIPAQPMWAFKNAGKKGT  598
            + R PA P WA  + G +G 
Sbjct  447  LRRTPATPFWAHGSVGGEGN  466



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT+LDHGV AVGYGTENG+DYWIV+NSWG  WGE GY+RM
Sbjct  277  IEAGGREFQLYQSGVFTGRCGTNLDHGVVAVGYGTENGIDYWIVRNSWGPKWGESGYIRM  336

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIAMEASYPTKKG + P P P  P    P        VCD++ + P +
Sbjct  337  ERNVASTDTGKCGIAMEASYPTKKGQNPPKPGPSPPSPVRPPT------VCDEYYSRPEA  390

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ +G +CF WGCCPL+SA CCDDHYSCCPHDYP+C + +GTC   +NNP+ VK 
Sbjct  391  TTCCCVYEYGGFCFGWGCCPLESATCCDDHYSCCPHDYPICDLDAGTCRMSENNPMSVKP  450

Query  539  MTRIPAQ  559
              R PA+
Sbjct  451  YKRGPAR  457



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 150/201 (75%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SG+FTG CGT+LDHGV AVGYGT+  +DYWIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGMAFQLYNSGVFTGICGTELDHGVIAVGYGTDGHLDYWIVRNSWGPDWGESGYIRM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV  KTG CGIA+E SYP KKG    PP+P   P     PP  SP+VCD +  CP+ +
Sbjct  333  ERNVNTKTGKCGIAIEPSYPIKKG--QNPPNPGPSPPSPVNPPPSSPTVCDDYYTCPSGS  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G++CF WGCCP++SA CC+DHYSCCPHD+P+C + +GTC    NNPL VK++
Sbjct  391  TCCCMYEYGDFCFGWGCCPIESATCCEDHYSCCPHDFPICDLETGTCQMSANNPLAVKSL  450

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             +IPA+ + A    G KG +S
Sbjct  451  KQIPARSVRAHHILGNKGITS  471



>ref|XP_008357442.1| PREDICTED: oryzain alpha chain-like, partial [Malus domestica]
Length=381

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 139/192 (72%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY+SG+FTG CGT LDHGV  VGYGT+ G+DYWIV+NSWG  WGEKGY+RM
Sbjct  188  IEGGGRDFQLYNSGVFTGRCGTALDHGVTVVGYGTDKGLDYWIVRNSWGASWGEKGYIRM  247

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN+     G+CGIAME SYP KKG +      P  P P+P  P   PSVCD + +CP S
Sbjct  248  QRNLGNTANGICGIAMEPSYPIKKGQN------PPNPGPSPPSPIKPPSVCDNYYSCPES  301

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++  GNYCF WGCCPL+ A CCDDHYSCCP +YPVC V +G C   K NPLGVKA
Sbjct  302  NTCCCIYQXGNYCFDWGCCPLEGATCCDDHYSCCPSEYPVCDVNAGACLMSKGNPLGVKA  361

Query  539  MTRIPAQPMWAF  574
            + R  A+P WA 
Sbjct  362  LKRTXAKPHWAV  373



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 149/201 (74%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT+LDHGV AVGYGT+  +DYWIV+NSWG  WGE GY+RM
Sbjct  280  IEAGGMAFQLYKSGVFTGTCGTELDHGVIAVGYGTDGHLDYWIVRNSWGPDWGESGYIRM  339

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV  KTG CGIA+E SYP KKG    PP+P   P     PP  SP+VCD +  CP+ +
Sbjct  340  ERNVNTKTGKCGIAIEPSYPIKKG--QNPPNPGPSPPSPVNPPPSSPTVCDDYYTCPSGS  397

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G++CF WGCCP++SA CC+DHYSCCPHD+P+C + +GTC    NNPL VK++
Sbjct  398  TCCCMYEYGDFCFGWGCCPIESATCCEDHYSCCPHDFPICDLETGTCQMSANNPLAVKSL  457

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             +IPA  + A    G KG +S
Sbjct  458  KQIPAISVRAHHILGNKGITS  478



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 139/191 (73%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTGSCG  LDHGVAAVGYG+ENGVDYWIV+NSWG  WGE+GYVRM
Sbjct  269  IEGGGMAFQLYESGIFTGSCGVSLDHGVAAVGYGSENGVDYWIVRNSWGKNWGEEGYVRM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+++  G CGIA+E SYP KKG        P  P P+P  P   P VCD +  CP S 
Sbjct  329  ERNIESAAGKCGIAIEPSYPIKKG------QNPPNPGPSPPSPVKPPVVCDSYTTCPTSN  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV  +G YCF WGCCPL++A CC+D+YSCCPHDYP+C++  GTC   K+NP+ VKA+
Sbjct  383  TCCCVLGYGTYCFEWGCCPLEAATCCEDNYSCCPHDYPICNIYEGTCLMSKDNPMSVKAL  442

Query  542  TRIPAQPMWAF  574
             R  A+  W F
Sbjct  443  KRTVAKRSWGF  453



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 144/186 (77%), Gaps = 6/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT LDHGV  +GYGTENGVDYW V+NSWG  WGE GY+RM
Sbjct  280  IEAGGREFQLYQSGVFTGRCGTQLDHGVVVIGYGTENGVDYWKVRNSWGPSWGENGYIRM  339

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  A  G CGIAME+SYP KKG      +PP+P    P+PP   P+VCD++ +CP S
Sbjct  340  ERNLAGASHGKCGIAMESSYPIKKG-----QNPPNPGPSPPSPPVKPPAVCDEYYSCPES  394

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G YCFAWGCCPL+SA CCDDHYSCCPHDYPVC + +GTC   K+NP GVKA
Sbjct  395  STCCCIYEYGKYCFAWGCCPLESATCCDDHYSCCPHDYPVCDLDAGTCRVSKDNPFGVKA  454

Query  539  MTRIPA  556
            + R PA
Sbjct  455  LKRAPA  460



>gb|KEH44128.1| papain family cysteine protease [Medicago truncatula]
Length=473

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGVA VGYGTENG+DYW+V+NSWG  WGE GY++M
Sbjct  274  IEAGGRAFQLYQSGVFTGICGTELDHGVAVVGYGTENGIDYWLVRNSWGSSWGENGYIKM  333

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  K TG CGIAMEASYP KKG +      P  P P+P  P    +VCD++ +C A 
Sbjct  334  ERNLLTKETGKCGIAMEASYPIKKGQN------PPNPGPSPPSPVQPSTVCDEYYSCSAG  387

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC+F +GN+CFAWGCCP++SA CCDD  SCCPHDYPVC V +GTC   K+NP GVKA
Sbjct  388  TTCCCLFEYGNFCFAWGCCPIESATCCDDGSSCCPHDYPVCDVEAGTCRLSKDNPFGVKA  447

Query  539  MTRIPA  556
            + R PA
Sbjct  448  LKRTPA  453



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 135/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G+CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  270  IEGGGRAFQLYDSGIFDGTCGTQLDHGVLAVGYGTENGKDYWIVKNSWGASWGESGYIRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + +G CGIA+E SYP K G + P P P  P    P         CD +  CP S 
Sbjct  330  ERNIASSSGKCGIAIEPSYPIKNGANPPNPGPSPPSPIKPPTQ------CDSYYTCPESN  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+PL VKA+
Sbjct  384  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLNQGTCKLSKNSPLSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  444  RRKPATPFWS  453



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGTDLDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  269  IEAGGRAFQLYSSGVFDGICGTDLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYIKM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIA+EASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  329  ERNIAEPTGKCGIAVEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYYSCPESN  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPHDYPVC+   GTC   KN+P  VKA+
Sbjct  383  TCCCLFKYGKYCFGWGCCPLEAATCCDDNSSCCPHDYPVCN--GGTCLMSKNSPFSVKAL  440

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  441  KRTPAKPFWA  450



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 132/192 (69%), Gaps = 10/192 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG DFQLY SG+FTG CGTDLDHGV  VGYGT+ G+DYWIV+NSWG+ WGEKGY+RM
Sbjct  279  IEGGGRDFQLYYSGVFTGRCGTDLDHGVTVVGYGTDKGLDYWIVRNSWGESWGEKGYIRM  338

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN+     G+CGIAME SYP K G           P      P    SVCD++ +CP S
Sbjct  339  QRNLGNTANGICGIAMEPSYPIKNG---------QNPPNPGPSPPSPISVCDEYYSCPES  389

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++  G YCF WGCCPL+ A CCDDHYSCCP  YPVC V +G C   K NPLGVKA
Sbjct  390  NTCCCIYQIGTYCFTWGCCPLEGATCCDDHYSCCPSAYPVCDVNAGACLMSKGNPLGVKA  449

Query  539  MTRIPAQPMWAF  574
            + R  A+P WA 
Sbjct  450  LKRTAAKPHWAV  461



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 139/192 (72%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLY  G+FTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE+GY+R+
Sbjct  280  VEGGGREFQLYEYGVFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGGSWGEQGYIRL  339

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  ++ G CGIA+E SYP K G + P P P  P    P        VCD + +C   
Sbjct  340  ERNLASSRAGKCGIAIEPSYPIKNGQNPPNPGPSPPSPIKPPS------VCDSYYSCAEG  393

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G  CF WGCCPL+SA CCDDHYSCCPH+YPVC  R+G C K KNNPLGVK+
Sbjct  394  STCCCIYEYGRSCFEWGCCPLESATCCDDHYSCCPHEYPVCDTRAGLCLKGKNNPLGVKS  453

Query  539  MTRIPAQPMWAF  574
              R PA+P WAF
Sbjct  454  FKRTPAKPHWAF  465



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 147/201 (73%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+F+G CGT LDHGV AVGYGTE G++YWIVKNSWG  WGE+GY+RM
Sbjct  276  IEAGGRAFQLYQSGVFSGRCGTALDHGVTAVGYGTEKGMNYWIVKNSWGKSWGEQGYIRM  335

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R++    TG CGIAMEASYP K          P  P P+P  P   P+ CD++ +C  S
Sbjct  336  ERSLTNTITGKCGIAMEASYPIKN------GPNPPNPGPSPPSPIKPPTTCDRYYSCAES  389

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ + NYCFAWGCCPL++A CC+DH SCCPHDYP+C+V  GTC   KNNPL VKA
Sbjct  390  TTCCCVYQYANYCFAWGCCPLEAATCCEDHESCCPHDYPICNVNEGTCLMSKNNPLSVKA  449

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PAQ  WAF + GKK ++
Sbjct  450  LKRTPAQFHWAFGSGGKKSSA  470



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 147/201 (73%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+F+G CGT LDHGV AVGYGTE G++YWIVKNSWG  WGE+GY+RM
Sbjct  276  IEAGGRAFQLYQSGVFSGRCGTALDHGVTAVGYGTEKGMNYWIVKNSWGKSWGEQGYIRM  335

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +R++    TG CGIAMEASYP K          P  P P+P  P   P+ CD++ +C  S
Sbjct  336  ERSLTNTITGKCGIAMEASYPIKN------GPNPPNPGPSPPSPIKPPTTCDRYYSCAES  389

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ + NYCFAWGCCPL++A CC+DH SCCPHDYP+C+V  GTC   KNNPL VKA
Sbjct  390  TTCCCVYQYANYCFAWGCCPLEAATCCEDHESCCPHDYPICNVNEGTCLMSKNNPLSVKA  449

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PAQ  WAF + GKK ++
Sbjct  450  LKRTPAQFHWAFGSGGKKSSA  470



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGTENGV+YWIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGRAFQLYKSGVFTGRCGTELDHGVVAVGYGTENGVNYWIVRNSWGSAWGESGYIRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV   KTG CGIA++ SYPTKKG + P P P  P    P PP    +VCD + +CP  
Sbjct  333  ERNVANTKTGKCGIAIQPSYPTKKGANPPNPGPSPPSPVNPPPPVSPSTVCDDYFSCPDG  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ +  YCF WGCCPL+SA CCDDH SCCPH+YPVC +++GTC   K+NPLGVKA
Sbjct  393  NTCCCIYEYSGYCFGWGCCPLESATCCDDHNSCCPHEYPVCDLKAGTCRLSKDNPLGVKA  452

Query  539  MTRIPAQ  559
            + R PA+
Sbjct  453  LRRGPAK  459



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGTDLDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  269  IEGGGRAFQLYDSGIFDGICGTDLDHGVLAVGYGTENGKDYWIVKNSWGSSWGESGYIRM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A  G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  329  ERNIAASAGKCGIAVEPSYPIKNG------QNPPNPGPSPPSPIKPPTQCDSYYTCPQSN  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F FG YC +WGCCPL++A CCDD+YSCCPHDYPVC +  GTC   KN+P  VKA+
Sbjct  383  TCCCLFEFGKYCLSWGCCPLEAATCCDDNYSCCPHDYPVCDLDQGTCLMSKNSPFSVKAL  442

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  443  KRKPATPFWS  452



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 140/191 (73%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQ Y SGIF+G+CGT LDHGVAAVGYG+E+G DYWIV+NSWG  WGE GY+RM
Sbjct  279  IEAGGRSFQFYESGIFSGTCGTSLDHGVAAVGYGSEDGKDYWIVRNSWGLSWGEDGYIRM  338

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+     G CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  339  ERNLAGTANGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPAVCDNYYSCPDS  392

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ +G YCF+WGCCPL+ A CCDD+YSCCP DYPVC+V  GTC   KNNPL VKA
Sbjct  393  NTCCCLYEYGKYCFSWGCCPLEGATCCDDNYSCCPSDYPVCNVNQGTCLMSKNNPLSVKA  452

Query  539  MTRIPAQPMWA  571
            + R PA P WA
Sbjct  453  LKRTPAVPNWA  463



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGT+  +DYWIV+NSWG  WGE GY+RM
Sbjct  273  IEAGGMAFQLYKSGVFTGICGTELDHGVIAVGYGTDGHLDYWIVRNSWGPDWGESGYIRM  332

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV  KTG CGIA+E SYP KKG    PP+P   P     PP  SP+VCD +  CP+ +
Sbjct  333  ERNVNTKTGKCGIAIEPSYPIKKG--QNPPNPGPSPPSPVNPPPSSPTVCDDYYTCPSGS  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G++CF WGCCP++SA CC+DHYSCCPHD+P+C + +GTC    NNPL VK++
Sbjct  391  TCCCMYEYGDFCFGWGCCPIESATCCEDHYSCCPHDFPICDLETGTCQMSANNPLAVKSL  450

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             +IPA  + A    G KG +S
Sbjct  451  KQIPAISVRAHHILGNKGITS  471



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  278  IEAGGRAFQLYASGVFDGVCGTELDHGVVAVGYGTENGKDYWIVRNSWGGNWGESGYIRM  337

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIA+EASYP KKG + P P P  P    P         CDK+  CP S 
Sbjct  338  ARNIAEPTGKCGIAVEASYPIKKGQNPPNPGPSPPSPIKPPTK------CDKYFTCPESN  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +G YCF WGCCPL++A CCDD+ SCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  392  TCCCLYKYGKYCFGWGCCPLEAATCCDDNSSCCPHEYPVCDINRGTCLMSKNSPFSVKAL  451

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  452  KRTPAKPFWA  461



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  321  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  380

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  381  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYFSCPESN  434

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCP ++A CCDD  SCCPHDYPVC    G C K KN+ L VKA+
Sbjct  435  TCCCLFQYGKYCFGWGCCPEEAATCCDDRSSCCPHDYPVCDTNRGACLKSKNSSLSVKAL  494

Query  542  TRIPAQPMWA  571
             R PA P WA
Sbjct  495  KRTPAIPFWA  504



>ref|NP_001104879.1| cysteine proteinase Mir3 precursor [Zea mays]
 gb|AAB88263.1| cysteine proteinase Mir3 [Zea mays]
Length=480

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 151/210 (72%), Gaps = 16/210 (8%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQLYSSGIFTGSCGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GYVRM
Sbjct  268  IEAAGTAFQLYSSGIFTGSCGTRLDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRM  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP K+G      + P  P P+P  P+P+P+VCD + +CP ST
Sbjct  328  ERNIKASSGKCGIAVEPSYPLKEG------ANPPNPGPSPPSPTPAPAVCDNYYSCPDST  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP--LGVK  535
            TCCC++ +G YCFAWGCCPL+ A CCDDHYSCCPHDYP+C+VR GT    K++P  L VK
Sbjct  382  TCCCIYEYGKYCFAWGCCPLEGATCCDDHYSCCPHDYPICNVRQGTSLMGKDSPLSLSVK  441

Query  536  AMTRI--------PAQPMWAFKNAGKKGTS  601
            A  R         PA  + A K++  +  S
Sbjct  442  ATKRTLAKRTGLSPATQLTALKSSALRKRS  471



>gb|ABK24495.1| unknown [Picea sitchensis]
 gb|ACN40861.1| unknown [Picea sitchensis]
Length=452

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 140/190 (74%), Gaps = 7/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G +FQ Y SG+FT +CGT LDHGV  VGYG+E+G DYW VKNSWG  WGE+G++R+
Sbjct  264  IEASGREFQFYDSGVFTSTCGTQLDHGVTLVGYGSESGTDYWTVKNSWGKSWGEEGFIRL  323

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN++ A TG+CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  324  QRNIEVASTGMCGIAMEASYPVKKGA------NPPNPGPSPPSPIKPPTVCDNYYSCPES  377

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ FG YC+AWGCCPLDSA CCDDHYSCCP++YPVC +  GTC K   +P GVK 
Sbjct  378  NTCCCMYDFGGYCYAWGCCPLDSATCCDDHYSCCPNEYPVCDLDGGTCLKSSKDPFGVKM  437

Query  539  MTRIPAQPMW  568
            + R PA+P W
Sbjct  438  LKRTPAKPYW  447



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF GSCGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  272  IEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+ + +G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  332  ARNIASSSGKCGIAIEPSYPIKNG------ENPPNPGPSPPSPIKPPTQCDSYYTCPESN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  386  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKAL  445

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  446  KRKPATPFWS  455



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF GSCGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  272  IEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+ + +G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  332  ARNIASSSGKCGIAIEPSYPIKNG------ENPPNPGPSPPSPIKPPTQCDSYYTCPESN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  386  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKAL  445

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  446  KRKPATPFWS  455



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 142/201 (71%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIFTG CG  +DHGV AVGYG+ENG+DYWIV+NSWG  WGE GY+RM
Sbjct  278  IEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGEHGYLRM  337

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+    GLCGIA   SYP K G + P P+P  P    P         CD   +CP+ T
Sbjct  338  QRNIANPKGLCGIATVVSYPVKTGQNPPKPAPSPPSPVKPPT------TCDDMYSCPSGT  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ + + CFAWGCCP++ A CC DH SCCPHDYPVC+V++GTC+  +NNPL VKAM
Sbjct  392  TCCCVYEYYHMCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISENNPLSVKAM  451

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
            + I A+P+ +F N G K T S
Sbjct  452  SHILAKPIGSFSNQGMKNTIS  472



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 135/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  269  IEGGGRAFQLYDSGIFDGVCGTQLDHGVVAVGYGTENGKDYWIVRNSWGTSWGESGYIRM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+K  +G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  329  ERNIKDSSGKCGIAIEPSYPIKNG------QNPPNPGPSPPSPIKPPTQCDSYYTCPESN  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  383  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMSKNSPFSVKAL  442

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  443  KRKPATPFWS  452



>ref|XP_008452589.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=495

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGTDLDHGV  VGYG+E GVDYWIV+NSWG  WGE GYVRM
Sbjct  299  IEGGGRSFQLYQSGIFTGRCGTDLDHGVNVVGYGSEGGVDYWIVRNSWGANWGESGYVRM  358

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+ + TGLCGIAME SYPTK          P  P PTP  P   PSVCD++  CPA+ 
Sbjct  359  QRNIDSPTGLCGIAMEPSYPTKS------GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAE  412

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK--  535
            TCCC+F F N C  WGCCPL+SA CCDDHYSCCPHDYP+C+VR+GTC+K KN+  GVK  
Sbjct  413  TCCCIFEFSNLCLEWGCCPLESATCCDDHYSCCPHDYPICNVRAGTCSKSKNDIFGVKAM  472

Query  536  AMTRIPAQPMWAFKNA  583
              T   A+P WA ++ 
Sbjct  473  RRTAAAARPSWAHRDV  488



>gb|ABK24233.1| unknown [Picea sitchensis]
Length=463

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 141/192 (73%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQ Y SG+FT +CGT LDHGV  VGYG+E+G DYWIVKNSWG  WGEKG++R+
Sbjct  267  IEASGRAFQFYESGVFTSTCGTQLDHGVTLVGYGSESGTDYWIVKNSWGKSWGEKGFIRL  326

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN++   TG+CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  327  QRNIEGVSTGMCGIAMEASYPLKKGA------NPPNPGPSPPSPVKPPTVCDNYYSCPES  380

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ FG YC+AWGCCPL+SA CCDDHYSCCP+D+PVC + + TC K + +P+G K 
Sbjct  381  NTCCCMYDFGGYCYAWGCCPLNSATCCDDHYSCCPNDHPVCDLDAQTCLKSRKDPIGTKM  440

Query  539  MTRIPAQPMWAF  574
            + R PA+P WA 
Sbjct  441  LKRTPAKPYWAL  452



>gb|ACB87490.1| mucunain [Mucuna pruriens]
Length=422

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY SG+FTG CGT LDHGV AVGYG+  G DYWIV+NSWG  WGE+GYVR+
Sbjct  228  IEGGGREFQLYVSGVFTGRCGTALDHGVVAVGYGSVKGHDYWIVRNSWGASWGEEGYVRL  287

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+ K+++G CGIA+E SYP K G        P  P P+P  P   P+VCD   +C  S
Sbjct  288  ERNLAKSRSGKCGIAIEPSYPIKNGA------NPPNPGPSPPSPVKPPNVCDNSYSCSDS  341

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F F  YC  WGCCPL++A CCDDHYSCCPH+YP+C+VR+GTC K KNNP GVKA
Sbjct  342  ATCCCIFEFQKYCMVWGCCPLEAATCCDDHYSCCPHEYPICNVRAGTCLKGKNNPFGVKA  401

Query  539  MTRIPAQPMWAF  574
            + R PA+P WAF
Sbjct  402  LRRTPAKPHWAF  413



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 142/186 (76%), Gaps = 5/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  WGE GY+R+
Sbjct  264  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPSWGEAGYIRL  323

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV  A TG CGIA+EASYPTKKG + P P P  P  P   PP+    VCD++ +CP  
Sbjct  324  ERNVASANTGKCGIAIEASYPTKKGQNPPRPPPYPPSPPPVKPPT----VCDEYYSCPVG  379

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GN+CF WGCCPL+SA  CDDHYSCCP +Y VC + +GTC   K+NPL +KA
Sbjct  380  TTCCCAYEYGNHCFGWGCCPLESATYCDDHYSCCPREYTVCDLDAGTCRLSKDNPLSMKA  439

Query  539  MTRIPA  556
            + R PA
Sbjct  440  LKRTPA  445



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 141/199 (71%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQ Y SGIF+G CG  +DHGV AVGYG+ENG+DYWIV+NSWG  WGE GY+RM
Sbjct  277  IEAGGKDFQHYKSGIFSGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGEHGYLRM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+    GLCGIA   SYP K G + P P+P  P    P         CD   +CP+ T
Sbjct  337  QRNIANPKGLCGIATGVSYPVKTGQNPPKPAPSPPSPVKPPT------TCDDMYSCPSGT  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ + + CFAWGCCP++ A CC DH SCCPHDYPVC+V++GTC+  KNNPL VKAM
Sbjct  391  TCCCVYEYYHMCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLAVKAM  450

Query  542  TRIPAQPMWAFKNAGKKGT  598
            + I A+P+ +F N G K T
Sbjct  451  SHILAKPIGSFSNQGMKNT  469



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 136/190 (72%), Gaps = 7/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHG   VGYGTENG DYWIV+NSWGD WGE GYVRM
Sbjct  273  IEAGGRAFQLYQSGIFDGQCGTQLDHGATIVGYGTENGKDYWIVRNSWGDNWGEAGYVRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV   KTG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  333  ERNVVDTKTGKCGIAMEASYPIKTG------RNPPNPGPSPPSPVKPPTVCDNYYSCPES  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCCV+    YC AWGCC +++A CC+D+YSCCPHDYP C++  GTC   K+NPLGVKA
Sbjct  387  NTCCCVYEHYGYCLAWGCCSIEAATCCEDNYSCCPHDYPACNINEGTCLMSKDNPLGVKA  446

Query  539  MTRIPAQPMW  568
            M R PA+P W
Sbjct  447  MKRTPAKPFW  456



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  276  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  336  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYFSCPESN  389

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCP ++A CCDD+ SCCPHDYPVC    G C K KN+ L VKA+
Sbjct  390  TCCCLFKYGKYCFGWGCCPEEAATCCDDNSSCCPHDYPVCDTNRGACLKSKNSSLSVKAL  449

Query  542  TRIPAQPMWA  571
             R  A P WA
Sbjct  450  KRTHAIPFWA  459



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGTDLDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  267  IEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGKDYWIVKNSWGTSWGESGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  327  ERNIASSAGKCGIAVEPSYPIKNG------QNPPNPGPSPPSPVKPPTQCDSYYTCPESN  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YC AWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  +KA+
Sbjct  381  TCCCLFDYGKYCLAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMSKNSPFSIKAI  440

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  441  KRKPATPFWS  450



>emb|CDY17044.1| BnaA08g04080D [Brassica napus]
Length=459

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 133/190 (70%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGTDLDHGV AVGYGTE+G DYWIVKNSWG  WGE GY+RM
Sbjct  269  IEGGGRAFQLYDSGIFDGICGTDLDHGVLAVGYGTESGKDYWIVKNSWGSSWGESGYIRM  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A  G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  329  ERNIAASAGKCGIAVEPSYPIKNG------QNPPNPGPSPPSPIKPPTQCDSYYTCPESN  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F FG YC +WGCCPL++A CCDD+YSCCPHDYPVC +  GTC   KN+P  V A+
Sbjct  383  TCCCLFEFGKYCLSWGCCPLEAATCCDDNYSCCPHDYPVCDLDQGTCLMSKNSPFSVMAL  442

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  443  KRKPAMPFWS  452



>gb|AAC49455.1| Pseudotzain [Pseudotsuga menziesii]
Length=454

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G  FQ Y SG+FT +CGT LDHGV  VGYG+E+G+DYW+VKNSWG+ WGEKG++++
Sbjct  267  IEASGRAFQFYESGVFTSNCGTQLDHGVTLVGYGSESGIDYWLVKNSWGNSWGEKGFIKL  326

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN++ A TG+CGIAMEASYP KKG        P  P P+P  P   P+VCD + +CP S
Sbjct  327  QRNLEGASTGMCGIAMEASYPVKKGA------NPPNPGPSPPSPVKPPTVCDNYYSCPES  380

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC++ FG YC+AWGCCPL+SA CCDDHYSCCP D+PVC + + TC K + +P G K 
Sbjct  381  NTCCCMYDFGGYCYAWGCCPLNSATCCDDHYSCCPSDHPVCDLDAQTCLKSRKDPFGTKM  440

Query  539  MTRIPAQPMWAF  574
            + R PA+P W+ 
Sbjct  441  LKRTPAKPYWSL  452



>ref|XP_004169515.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=459

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGTDLDHGV  VGYG+E GVDYWIV+NSWG  WGE GYV+M
Sbjct  263  IEGGGRSFQLYQSGIFTGRCGTDLDHGVNVVGYGSEGGVDYWIVRNSWGGSWGESGYVKM  322

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+ + TGLCGIAME SYPTK          P  P PTP  P   PSVCD++  CPA+ 
Sbjct  323  QRNIASPTGLCGIAMEPSYPTKT------GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAE  376

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK--  535
            TCCC+F F N C  WGCCPL+SA CCDDHYSCCPHDYPVC+VR+GTC+K KN+  GVK  
Sbjct  377  TCCCIFQFSNLCLEWGCCPLESATCCDDHYSCCPHDYPVCNVRAGTCSKSKNDIFGVKAM  436

Query  536  AMTRIPAQPMWAFKNA  583
              T   A+P WA ++ 
Sbjct  437  RRTAAAARPSWARRDV  452



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G+CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  265  IEAGGRAFQLYDSGIFDGTCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLKM  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+ + +G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  325  ARNIASSSGKCGIAIEPSYPIKNG------ENPPNPGPSPPSPIKPPTQCDSYYTCPESN  378

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  379  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKAL  438

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  439  KRKPATPFWS  448



>gb|KGN55227.1| hypothetical protein Csa_4G641600 [Cucumis sativus]
Length=459

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGTDLDHGV  VGYG+E GVDYWIV+NSWG  WGE GYV+M
Sbjct  263  IEGGGRSFQLYQSGIFTGRCGTDLDHGVNVVGYGSEGGVDYWIVRNSWGGSWGESGYVKM  322

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+ + TGLCGIAME SYPTK          P  P PTP  P   PSVCD++  CPA+ 
Sbjct  323  QRNIASPTGLCGIAMEPSYPTKT------GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAE  376

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK--  535
            TCCC+F F N C  WGCCPL+SA CCDDHYSCCPHDYPVC+VR+GTC+K KN+  GVK  
Sbjct  377  TCCCIFQFSNLCLEWGCCPLESATCCDDHYSCCPHDYPVCNVRAGTCSKSKNDIFGVKAM  436

Query  536  AMTRIPAQPMWAFKNA  583
              T   A+P WA ++ 
Sbjct  437  RRTAAAARPSWARRDV  452



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 138/190 (73%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESGYIKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  332  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYYSCPESN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPH+YPVC+    TC   KN+P  VKA+
Sbjct  386  TCCCLFKYGKYCFGWGCCPLEAATCCDDNTSCCPHEYPVCN--GDTCLMSKNSPFSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  444  KRTPAKPFWA  453



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 138/190 (73%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESGYIKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  332  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYYSCPESN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPH+YPVC+    TC   KN+P  VKA+
Sbjct  386  TCCCLFKYGKYCFGWGCCPLEAATCCDDNTSCCPHEYPVCN--GDTCLMSKNSPFSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  444  KRTPAKPFWA  453



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  277  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  337  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYFSCPESN  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCP ++A CCDD+ +CCPHDYPVC    G C K KN+ L VKA+
Sbjct  391  TCCCLFKYGKYCFGWGCCPEEAATCCDDNSTCCPHDYPVCDTNRGACLKSKNSSLSVKAL  450

Query  542  TRIPAQPMWA  571
             R  A P WA
Sbjct  451  KRTHAIPFWA  460



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 143/192 (74%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGTENG DYW+V+NSWG  WGE GY+++
Sbjct  275  IEAGGRAFQLYHSGVFTGLCGTELDHGVVAVGYGTENGTDYWLVRNSWGPSWGENGYIKL  334

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +KTG CGIAMEASYP KKG +      P  P PTP  P    +VCD + +C A 
Sbjct  335  ERNLLTSKTGKCGIAMEASYPIKKGQN------PPNPGPTPPSPVKPSTVCDDYYSCSAG  388

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC+F +G+YCFAWGCCP++SA CCDD  SCCP DYP+C V +GTC   K+NP GVKA
Sbjct  389  TTCCCLFEYGSYCFAWGCCPVESATCCDDGSSCCPPDYPICDVHAGTCRLSKDNPFGVKA  448

Query  539  MTRIPAQPMWAF  574
            + R PA   W++
Sbjct  449  LRRTPATTTWSW  460



>ref|XP_004496966.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Cicer arietinum]
Length=474

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 143/192 (74%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGTENG DYW+V+NSWG  WGE GY+++
Sbjct  277  IEAGGRAFQLYHSGVFTGLCGTELDHGVVAVGYGTENGTDYWLVRNSWGPSWGENGYIKL  336

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +KTG CGIAMEASYP KKG +      P  P PTP  P    +VCD + +C A 
Sbjct  337  ERNLLTSKTGKCGIAMEASYPIKKGQN------PPNPGPTPPSPVKPSTVCDDYYSCSAG  390

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC+F +G+YCFAWGCCP++SA CCDD  SCCP DYP+C V +GTC   K+NP GVKA
Sbjct  391  TTCCCLFEYGSYCFAWGCCPVESATCCDDGSSCCPPDYPICDVHAGTCRLSKDNPFGVKA  450

Query  539  MTRIPAQPMWAF  574
            + R PA   W++
Sbjct  451  LRRTPATTTWSW  462



>ref|XP_004141271.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=458

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGTDLDHGV  VGYG+E GVDYWIV+NSWG  WGE GYV+M
Sbjct  262  IEGGGRSFQLYQSGIFTGRCGTDLDHGVNVVGYGSEGGVDYWIVRNSWGGSWGESGYVKM  321

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+ + TGLCGIAME SYPTK          P  P PTP  P   PSVCD++  CPA+ 
Sbjct  322  QRNIASPTGLCGIAMEPSYPTKT------GPNPPNPGPTPPSPVKPPSVCDEYYTCPAAE  375

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK--  535
            TCCC+F F N C  WGCCPL+SA CCDDHYSCCPHDYPVC+VR+GTC+K KN+  GVK  
Sbjct  376  TCCCIFQFSNLCLEWGCCPLESATCCDDHYSCCPHDYPVCNVRAGTCSKSKNDIFGVKAM  435

Query  536  AMTRIPAQPMWAFKNA  583
              T   A+P WA ++ 
Sbjct  436  RRTAAAARPSWARRDV  451



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGTDLDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  267  IEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGKDYWIVKNSWGTSWGESGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  327  ERNIASSAGKCGIAVEPSYPIKNG------QNPPNPGPSPPSPVTPPTQCDSYYTCPESN  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YC AWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  +KA+
Sbjct  381  TCCCLFGYGKYCLAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMNKNSPFSIKAI  440

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  441  KRKPATPFWS  450



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 141/186 (76%), Gaps = 5/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV AVGYGTENGVDYWIV+NSWG  W E GY+R+
Sbjct  270  IEAGGREFQLYQSGVFTGRCGTDLDHGVVAVGYGTENGVDYWIVRNSWGPSWVEAGYIRL  329

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV  A TG CGIA+EASYPTKK        P  PP P   PP   P++CD++ +CP  
Sbjct  330  ERNVASANTGKCGIAIEASYPTKK----GXNPPKPPPYPPSPPPMKPPTMCDEYYSCPVG  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +GNYCF WGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K+NP+  KA
Sbjct  386  TTCCCAYEYGNYCFGWGCCPLESATCCDDHYSCCPHEYPVCDLDAGTCRLSKDNPMSEKA  445

Query  539  MTRIPA  556
            + R PA
Sbjct  446  LKRTPA  451



>dbj|BAD29954.1| cysteine protease [Daucus carota]
Length=474

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 7/186 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYG+ENG DYWIV+NSWG  WGE GY+R+
Sbjct  285  IEAGGRAFQLYESGVFTGQCGTELDHGVVAVGYGSENGKDYWIVRNSWGPDWGESGYIRL  344

Query  182  QRNVKA-KTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV +  TG CGIAM+ASYPTK G DNPP   PSPPSP          VCD + +CP S
Sbjct  345  ERNVASTSTGKCGIAMQASYPTKTG-DNPPKPGPSPPSPVKPQT-----VCDDYYSCPES  398

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++  G YCF WGCCPL SA CCDDHYSCCP ++PVC + +GTC   K+NP+GVKA
Sbjct  399  TTCCCLYEIGQYCFGWGCCPLASATCCDDHYSCCPQEFPVCDLDAGTCLMSKDNPIGVKA  458

Query  539  MTRIPA  556
            + R PA
Sbjct  459  LERRPA  464



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 141/202 (70%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY  G+FTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+R+
Sbjct  278  IEGGGREFQLYEYGVFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGSSWGEAGYIRL  337

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K G + P P P  P    P        VCD + +C   
Sbjct  338  ERNLASSRSGKCGIAIEPSYPIKNGQNPPNPGPSPPSPVKPPS------VCDSYYSCAEG  391

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G  CF WGCCPL+SA CC+DHYSCCPH+YPVC +  G C K KNNPLGVKA
Sbjct  392  TTCCCIYEYGRSCFEWGCCPLESATCCEDHYSCCPHEYPVCDIYQGLCLKGKNNPLGVKA  451

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
              R PA+  +AF   GK   SS
Sbjct  452  FKRTPAKRHFAF--GGKNKISS  471



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 9/198 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLYSSG+FTG CGT LDHGV AVGYGT+NG D+WIV+NSWG  WGE+GY+R+
Sbjct  273  VEGGGREFQLYSSGVFTGRCGTALDHGVVAVGYGTDNGHDFWIVRNSWGADWGEEGYIRL  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K G        P  P P+P  P   P+VCD + +C  S
Sbjct  333  ERNLGNSRSGKCGIAIEPSYPIKTG------QNPPNPGPSPPSPVKPPNVCDNYYSCSDS  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FG  CF WGCCPL+ A CCDDHYSCCPHDYP+C+  +GTC + KNNP GVKA
Sbjct  387  ATCCCIFEFGKTCFEWGCCPLEGATCCDDHYSCCPHDYPICNTYAGTCLRSKNNPFGVKA  446

Query  539  MTRIPAQPMWAFKNAGKK  592
            + R PA+P  AF  AG K
Sbjct  447  LRRTPAKPHGAF--AGNK  462



>ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
 gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
Length=509

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G+CGT +DHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  319  IEAGGRAFQLYVSGIFDGTCGTQVDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLKM  378

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G + P P P  P    P         CD +  CP S 
Sbjct  379  ERNIASSAGKCGIAIEPSYPVKNGENPPNPGPSPPSPIKPPTQ------CDSYYTCPESN  432

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+
Sbjct  433  TCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMSKNSPFSVKAL  492

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  493  KRKPATPFWS  502



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 143/198 (72%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQ YSSG+FTG CGT LDHGV  VGYGTENG DYWIV+NSWG  WGE GY+++
Sbjct  273  IEAGGRAFQHYSSGVFTGYCGTQLDHGVVVVGYGTENGEDYWIVRNSWGPNWGESGYIKL  332

Query  182  QRN-VKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN   + TG CGIAM+ASYP K G +      P  P P+P  P   P+VCD++ +CP  
Sbjct  333  QRNFANSTTGKCGIAMQASYPLKSGAN------PPNPGPSPPTPVTPPTVCDEYYSCPQG  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G YCF WGCCP +SA CCDD+YSCCPHDYPVC V +GTC   K+NPL VKA
Sbjct  387  TTCCCIYQYGEYCFGWGCCPYESATCCDDNYSCCPHDYPVCDVDAGTCLMSKDNPLKVKA  446

Query  539  MTRIPAQPMWAFKNAGKK  592
            + R PA+  W+   + +K
Sbjct  447  LKRGPARANWSGMKSNRK  464



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 9/198 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLYSSG+FTG CGT LDHGV AVGYGT+NG D+WIV+NSWG  WGE+GY+R+
Sbjct  262  VEGGGREFQLYSSGVFTGRCGTALDHGVVAVGYGTDNGHDFWIVRNSWGADWGEEGYIRL  321

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K G        P  P P+P  P   P+VCD + +C  S
Sbjct  322  ERNLGNSRSGKCGIAIEPSYPIKTG------QNPPNPGPSPPSPVKPPNVCDNYYSCSDS  375

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FG  CF WGCCPL+ A CCDDHYSCCPHDYP+C+  +GTC + KNNP GVKA
Sbjct  376  ATCCCIFEFGKTCFEWGCCPLEGATCCDDHYSCCPHDYPICNTYAGTCLRSKNNPFGVKA  435

Query  539  MTRIPAQPMWAFKNAGKK  592
            + R PA+P  AF  AG K
Sbjct  436  LRRTPAKPHGAF--AGNK  451



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 141/202 (70%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY  G+FTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+R+
Sbjct  301  IEGGGREFQLYEYGVFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGSSWGEAGYIRL  360

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K G + P P P  P    P        VCD + +C   
Sbjct  361  ERNLASSRSGKCGIAIEPSYPIKNGQNPPNPGPSPPSPVKPPS------VCDSYYSCAEG  414

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G  CF WGCCPL+SA CC+DHYSCCPH+YPVC +  G C K KNNPLGVKA
Sbjct  415  TTCCCIYEYGRSCFEWGCCPLESATCCEDHYSCCPHEYPVCDIYQGLCLKGKNNPLGVKA  474

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
              R PA+  +AF   GK   SS
Sbjct  475  FKRTPAKRHFAF--GGKNKISS  494



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESGYIKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP   
Sbjct  332  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYYSCPEGN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPH+YPVC+    TC   KN+P  VKA+
Sbjct  386  TCCCLFKYGKYCFGWGCCPLEAATCCDDNTSCCPHEYPVCN--GDTCLMSKNSPFSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  444  KRTPAKPFWA  453



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESGYIKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIAMEASYP KKG        P  P P+P  P   P+ CDK+ +CP   
Sbjct  332  ARNIAEPTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYYSCPEGN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPH+YPVC+    TC   KN+P  VKA+
Sbjct  386  TCCCLFKYGKYCFGWGCCPLEAATCCDDNTSCCPHEYPVCN--GDTCLMSKNSPFSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  444  KRTPAKPFWA  453



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 139/201 (69%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE    DFQLY  G+FTG+CGT LDHGV  VGYGT NG DYWIV+NSWG  WGE GY+RM
Sbjct  270  IEGSSRDFQLYLKGLFTGNCGTALDHGVNVVGYGTANGKDYWIVRNSWGAEWGEDGYIRM  329

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNVKA +GLCGI  E SYP KK         P  P P+P  P   P+ CD +  CP   
Sbjct  330  ERNVKATSGLCGITSEPSYPVKK------GPNPPNPGPSPPSPIKPPAACDNYYECPQDN  383

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCVF F   CF WGCCPL+ AVCC+DHYSCCPHDYPVCHV+SGTC+  K+NPLGVK M
Sbjct  384  TCCCVFEFYGSCFEWGCCPLEGAVCCEDHYSCCPHDYPVCHVQSGTCSLSKDNPLGVKVM  443

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
              + A+P+   K +G +G  S
Sbjct  444  KHMLARPIKRVK-SGTEGMKS  463



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 140/202 (69%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGTDLDHGV AVGYGTE G DYWIV+NSWG  WGE GY+R+
Sbjct  273  IEAGGRAFQLYQSGVFTGRCGTDLDHGVVAVGYGTEEGKDYWIVRNSWGPSWGENGYIRL  332

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV     G CGIA+EASYP K G + P P P  P    P        VCD++  CP  
Sbjct  333  ERNVANTFAGKCGIAVEASYPVKTGHNPPNPGPSPPTPVKPPT------VCDEYYTCPEG  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC + +G  C  WGCCPL+SA CC+DH SCCPHDYP+C V +GTC   K+NP+G+ A
Sbjct  387  TTCCCAYQYGKLCLGWGCCPLESATCCEDHSSCCPHDYPICDVEAGTCLMSKDNPMGIGA  446

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R  A+P W+  + G+K +SS
Sbjct  447  LKRRNAEPNWSSLHGGRKISSS  468



>ref|XP_010461511.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G+CGT +DHGV A+GYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYVSGIFDGTCGTQVDHGVVAIGYGTENGKDYWIVRNSWGKSWGESGYLKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G + P P P  P    P         CD +  CP + 
Sbjct  332  ERNIASSAGKCGIAIEPSYPVKNGANPPNPGPSPPSPVKPPTQ------CDSYYTCPDTA  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+ SCCPH+YPVC +  GTC   KN+PL VKA+
Sbjct  386  TCCCLFEYGKYCFAWGCCPLEAATCCDDNSSCCPHEYPVCDIDHGTCLMSKNSPLSVKAL  445

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  446  KRKPATPFWS  455



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 145/200 (73%), Gaps = 8/200 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLY SG+FTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GY+R+
Sbjct  271  VEGGGREFQLYDSGVFTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGGSWGEAGYIRL  330

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +K+G CGIA+E SYP K G        P  P+P+P  P   PSVCD + +C   
Sbjct  331  ERNLATSKSGKCGIAIEPSYPIKNG------LNPPKPAPSPPSPVKPPSVCDSY-SCAEG  383

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC+F +G  CF WGCCPL+SA CCDDHYSCCPH+YPVC   +G C K KNNPLGVK+
Sbjct  384  STCCCIFDYGGSCFEWGCCPLESATCCDDHYSCCPHEYPVCDTYAGLCRKNKNNPLGVKS  443

Query  539  MTRIPAQPMWAFKNAGKKGT  598
              R PA+P +A +   K G+
Sbjct  444  FKRTPAKPHFAIEGKNKMGS  463



>ref|XP_010500237.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G+CGT +DHGV AVGYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYVSGIFDGTCGTQVDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G + P P P  P    P         CD +  CP + 
Sbjct  332  ERNIASSAGKCGIAIEPSYPVKNGANPPNPGPSPPSPIKPPTQ------CDSYYTCPDTA  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+ SCCPH+YPVC +  GTC   KN+PL VKA+
Sbjct  386  TCCCLFEYGKYCFAWGCCPLEAATCCDDNSSCCPHEYPVCDLDHGTCLMSKNSPLSVKAL  445

Query  542  TRIPAQPMWA  571
             R PA P W+
Sbjct  446  KRKPATPFWS  455



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 134/188 (71%), Gaps = 7/188 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQ Y SGIFTG CGT LDHGV  VGYGTE G DYWIV+NSWG  WGE GY+RM
Sbjct  271  IEGGGRAFQFYDSGIFTGKCGTALDHGVNVVGYGTEKGKDYWIVRNSWGSSWGEAGYIRM  330

Query  182  QRNVKAKT-GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+   + G CGIAME SYP K G + P P P  P    P        VCD +  CP S
Sbjct  331  ERNLAGTSVGKCGIAMEPSYPLKNGQNPPNPGPSPPTPVRPPT------VCDDYYTCPES  384

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCCV+ +  YCF+WGCCPLD A CCDDHYSCCPHDYPVC+V++GTC+  KNNPLGVKA
Sbjct  385  STCCCVYEYYGYCFSWGCCPLDGATCCDDHYSCCPHDYPVCNVQAGTCSMSKNNPLGVKA  444

Query  539  MTRIPAQP  562
            + RI A P
Sbjct  445  IQRILATP  452



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 138/202 (68%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT LDHGV AVGYGTENGVDYW V+NSWG  WGE GY+R+
Sbjct  267  IEAGGRAFQLYHSGVFTGQCGTQLDHGVVAVGYGTENGVDYWTVRNSWGPSWGENGYIRL  326

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIA+E SYP K G + P P P  P    P        VCD +  CP +
Sbjct  327  ERNVANVTTGKCGIAIEPSYPVKTGANPPNPGPSPPSPVKPPS------VCDDYYTCPEA  380

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCCV+ +GNYCF WGCCPL+SA CCDD  SCCPHDYP+C +  GTC   K+NPL V A
Sbjct  381  STCCCVYEYGNYCFGWGCCPLESATCCDDRSSCCPHDYPICDLDEGTCLMSKDNPLKVAA  440

Query  539  MTRIPAQPMWAFKNAGKKGTSS  604
            + R PA+ +     A  K +SS
Sbjct  441  LKRGPARLIGRGARASSKVSSS  462



>emb|CBI40282.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT LDHGV AVGYGTEN VDYWIV+NSWG  WGE GY+++
Sbjct  194  IEAGGRAFQLYQSGVFTGQCGTQLDHGVVAVGYGTENSVDYWIVRNSWGPNWGESGYIKL  253

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+   +TG CGIA+E SYP K G + P P P  P    P+       VCD++  CP  
Sbjct  254  ERNLAGTETGKCGIAIEPSYPIKNGQNPPNPGPSPPSPSKPSV------VCDEYYTCPEE  307

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +  +CF WGCCPL+ A CCDDHYSCCPH+YPVC V +GTC   K NPL VKA
Sbjct  308  STCCCIYEYAGFCFEWGCCPLEGATCCDDHYSCCPHEYPVCDVDAGTCQMSKGNPLSVKA  367

Query  539  MTRIPAQPMWA  571
              R PA+P++A
Sbjct  368  WRRTPARPVFA  378



>ref|XP_003579458.1| PREDICTED: oryzain beta chain-like [Brachypodium distachyon]
Length=470

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  281  IEAGGREFQLYHSGVFTGRCGTELDHGVVAVGYGTENGKDYWIVRNSWGPKWGEAGYLRM  340

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAM +SYPTKKG + P PSP  P  PTP PP     VCD+  +C A +
Sbjct  341  ERNINATTGKCGIAMMSSYPTKKGANPPKPSPTPPTPPTPPPPVAPDHVCDENVSCAAGS  400

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC++++GTC+  KN  L VKA+
Sbjct  401  TCCCAFGFRNMCLVWGCCPVEGATCCKDHASCCPPDYPVCNIKAGTCSASKNRTLTVKAL  460

Query  542  TRIPAQP  562
             R  A+P
Sbjct  461  KRTLAKP  467



>gb|AEV40973.1| putative oryzain beta chain precursor [Oryza punctata]
Length=461

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  272  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAM ASYPTK G + P PSP  P  PTP PP+    VCD   +CPA +
Sbjct  332  ERNINATTGKCGIAMMASYPTKSGANPPKPSPAPPTPPTPPPPAAPDHVCDDNFSCPAGS  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYP+C+ R+GTC+  KN+PL VKA+
Sbjct  392  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPICNTRAGTCSASKNSPLSVKAL  451

Query  542  TRIPAQ  559
             R  A+
Sbjct  452  KRTLAK  457



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT LDHGV AVGYGTEN VDYWIV+NSWG  WGE GY+++
Sbjct  277  IEAGGRAFQLYQSGVFTGQCGTQLDHGVVAVGYGTENSVDYWIVRNSWGPNWGESGYIKL  336

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+   +TG CGIA+E SYP K G + P P P  P    P+       VCD++  CP  
Sbjct  337  ERNLAGTETGKCGIAIEPSYPIKNGQNPPNPGPSPPSPSKPSV------VCDEYYTCPEE  390

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +  +CF WGCCPL+ A CCDDHYSCCPH+YPVC V +GTC   K NPL VKA
Sbjct  391  STCCCIYEYAGFCFEWGCCPLEGATCCDDHYSCCPHEYPVCDVDAGTCQMSKGNPLSVKA  450

Query  539  MTRIPAQPMWA  571
              R PA+P++A
Sbjct  451  WRRTPARPVFA  461



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 141/192 (73%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQ Y SG+FTG CG DLDHGV AVGYG+++G DYWIV+NSWG  WGE GY+RM
Sbjct  282  IEAGGSTFQFYQSGVFTGKCGADLDHGVVAVGYGSDDGKDYWIVRNSWGADWGESGYIRM  341

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN++  KTG CGIA+E SYP K   ++  P  P P  P+P  P+ +   CD++  CP+S
Sbjct  342  ERNLETVKTGKCGIAIEPSYPIK---NSQNPPNPGPTPPSPPSPASADVTCDEYYTCPSS  398

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCCV+ +G YCFAWGCCPL+SAVCC DH SCCPHDYPVC+ R GTC   KN+P  VKA
Sbjct  399  TTCCCVYEYGPYCFAWGCCPLESAVCCADHSSCCPHDYPVCNARKGTCNASKNSPFSVKA  458

Query  539  MTRIPAQPMWAF  574
            + R PA+    F
Sbjct  459  LKRTPAKHHAKF  470



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY SG+FTG CGT LDHGV AVGYGT NG DYWIV+NSWG  WGE GY+R+
Sbjct  270  IEGGGREFQLYVSGVFTGRCGTALDHGVVAVGYGTANGHDYWIVRNSWGPSWGEDGYIRL  329

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K          P  P P+P  P   P+VCD + +C  S
Sbjct  330  ERNLANSRSGKCGIAIEPSYPLKN------GPNPPNPGPSPPSPVKPPNVCDNYYSCADS  383

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FGN CF WGCCPL+ A CCDDHYSCCP+DYP+C+  +GTC K KNNP GVKA
Sbjct  384  ATCCCIFEFGNACFEWGCCPLEGATCCDDHYSCCPNDYPICNTYAGTCLKSKNNPFGVKA  443

Query  539  MTRIPAQPMWAFKNAGKKGTS  601
            + R PA+P W F    K  ++
Sbjct  444  LRRTPAKPHWTFGRKNKVSSA  464



>ref|XP_004173252.1| PREDICTED: oryzain alpha chain-like [Cucumis sativus]
Length=321

 Score =   228 bits (580),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGTDLDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+R+
Sbjct  126  IEAGGRAFQLYQSGVFTGRCGTDLDHGVVAVGYGTDNGTDYWIVRNSWGKDWGESGYIRL  185

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIA++ SYPTK G + P PS   P    P         CD++ +C   
Sbjct  186  ERNVANITTGKCGIAVQPSYPTKSGANPPKPSASPPSPVKPPTE------CDEYFSCEEG  239

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ FG+ CFAWGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K++ +GV  
Sbjct  240  STCCCIYQFGSTCFAWGCCPLESATCCDDHYSCCPHEYPVCDLEAGTCRVSKDSSMGVNL  299

Query  539  MTRIPAQPMWAFKNAGK  589
            + R+PA      +  GK
Sbjct  300  LKRLPAIQTKKVQKLGK  316



>emb|CDY25228.1| BnaC02g30040D [Brassica napus]
Length=460

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G+CGT+LDHGV AVGYGTE+G DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYSSGVFDGTCGTELDHGVVAVGYGTEDGKDYWIVRNSWGGSWGESGYIKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGI MEASYP KKG        P  P P+P  P   P+ CDK+ +CP   
Sbjct  332  ARNIAEPTGKCGITMEASYPIKKG------QNPPNPGPSPPSPIKPPTKCDKYYSCPEGN  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCF WGCCPL++A CCDD+ SCCPH+YPVC+    TC   KN+P  VKA+
Sbjct  386  TCCCLFKYGKYCFGWGCCPLEAATCCDDNTSCCPHEYPVCN--GDTCLMSKNSPFSVKAL  443

Query  542  TRIPAQPMWA  571
             R PA+P WA
Sbjct  444  KRTPAKPFWA  453



>gb|ABR26128.1| cysteine proteinase rd21a precursor [Oryza sativa Indica Group]
Length=229

 Score =   224 bits (571),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSGIFTG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE GYVRM
Sbjct  68   IEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRM  127

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+KA +G CGIA+E SYP KKG +         P PTP  P+P P+VCD +  CP ST
Sbjct  128  ERNIKASSGKCGIAVEPSYPLKKGENP------PNPGPTPPSPTPPPTVCDNYYTCPDST  181

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTC  502
            TCCC++ +G YC+AWGCCPL+ A CCDDHYSCCPH+YP+C+V+ GTC
Sbjct  182  TCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTC  228



>gb|AIE88288.1| hypothetical protein OG_BBa0063K01.19 [Oryza glaberrima]
Length=479

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  290  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  349

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS    VCD   +CPA +
Sbjct  350  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGS  409

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  410  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  469

Query  542  TRIPAQ  559
             R  A+
Sbjct  470  KRTLAK  475



>gb|ACI00280.1| triticain beta 2 [Hordeum vulgare]
Length=473

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  284  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGEAGYLRM  343

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  344  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  403

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+  KN+PL VKA+
Sbjct  404  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL  463

Query  542  TRIPA  556
             R  A
Sbjct  464  KRTLA  468



>dbj|BAK03074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  284  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGEAGYLRM  343

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  344  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  403

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+  KN+PL VKA+
Sbjct  404  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL  463

Query  542  TRIPA  556
             R  A
Sbjct  464  KRTLA  468



>ref|NP_001054211.2| Os04g0670200 [Oryza sativa Japonica Group]
 sp|P25777.2|ORYB_ORYSJ RecName: Full=Oryzain beta chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa Japonica Group]
 emb|CAJ86092.1| H0818H01.14 [Oryza sativa Indica Group]
 gb|EAY95991.1| hypothetical protein OsI_17862 [Oryza sativa Indica Group]
 dbj|BAG98700.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF16125.2| Os04g0670200 [Oryza sativa Japonica Group]
Length=466

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  277  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS    VCD   +CPA +
Sbjct  337  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGS  396

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  397  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  456

Query  542  TRIPAQ  559
             R  A+
Sbjct  457  KRTLAK  462



>dbj|BAA14403.1| oryzain beta precursor [Oryza sativa Japonica Group]
Length=471

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  276  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS    VCD   +CPA +
Sbjct  336  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGS  395

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  396  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  455

Query  542  TRIPAQ  559
             R  A+
Sbjct  456  KRTLAK  461



>dbj|BAF93840.1| triticain beta 2 [Triticum aestivum]
Length=469

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  280  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGEAGYLRM  339

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  340  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  399

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC+VR+GTC+  KN+PL VKA+
Sbjct  400  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNVRAGTCSATKNSPLSVKAL  459

Query  542  TRIPA  556
             R  A
Sbjct  460  KRTLA  464



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 140/197 (71%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY SG+FTG CGT LDHGV AVGYGT NG DYWIV+NSWG  WGE GY+R+
Sbjct  302  IEGGGREFQLYVSGVFTGRCGTALDHGVVAVGYGTANGHDYWIVRNSWGPSWGEDGYIRL  361

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K          P  P P+P  P   P+VCD + +C  S
Sbjct  362  ERNLANSRSGKCGIAIEPSYPLKN------GPNPPNPGPSPPSPVKPPNVCDNYYSCADS  415

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FGN CF WGCCPL+ A CCDDHYSCCP+DYP+C+  +GTC K KNNP GVKA
Sbjct  416  ATCCCIFEFGNACFEWGCCPLEGATCCDDHYSCCPNDYPICNTYAGTCLKSKNNPFGVKA  475

Query  539  MTRIPAQPMWAFKNAGK  589
            + R PA+P W F    K
Sbjct  476  LRRTPAKPHWTFGRKNK  492



>gb|EMS68758.1| Oryzain beta chain [Triticum urartu]
Length=472

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  283  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGESGYLRM  342

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  343  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  402

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+  KN+PL VKA+
Sbjct  403  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL  462

Query  542  TRIPA  556
             R  A
Sbjct  463  KRTLA  467



>dbj|BAF02547.1| triticain beta [Triticum aestivum]
Length=472

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  283  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGESGYLRM  342

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  343  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  402

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+  KN+PL VKA+
Sbjct  403  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL  462

Query  542  TRIPA  556
             R  A
Sbjct  463  KRTLA  467



>ref|XP_010479116.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=462

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 134/191 (70%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G+CGT +DHGV A+GYGTENG DYWIV+NSWG  WGE GY++M
Sbjct  272  IEAGGRAFQLYVSGIFDGTCGTQVDHGVVAIGYGTENGKDYWIVRNSWGKSWGESGYLKM  331

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ + +G CGIA+E SYP K G + P P P  P    P         CD +  CP + 
Sbjct  332  ERNIASSSGKCGIAIEPSYPVKNGANPPNPGPSPPSPIKPPTQ------CDSYYTCPDTA  385

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL++A CCDD+ SCCPH+YPVC +  GTC   KN+PL VKA+
Sbjct  386  TCCCLFEYGKYCFAWGCCPLEAATCCDDNSSCCPHEYPVCDIDHGTCLMSKNSPLSVKAL  445

Query  542  TRIPAQPMWAF  574
             R PA   W+ 
Sbjct  446  KRKPATAFWSL  456



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLYSSG+F G CGT+LDHGV AVGYGTENG DYWIV+NSWG+ WGE GY++M
Sbjct  277  IEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN+   TG CGIA+EASYP KKG        P  P P+P  P   P+ CDK+ +CP S 
Sbjct  337  ARNIAEPTGKCGIAIEASYPIKKG------QNPPNPGPSPPSPIKPPTQCDKYFSCPESN  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +  YCF W CCP ++A CCDD+ SCCPHDYPVC    G C K KN+ L VKA+
Sbjct  391  TCCCLFKYRKYCFGWECCPEEAATCCDDNSSCCPHDYPVCDTNRGVCLKSKNSSLSVKAL  450

Query  542  TRIPAQPMWA  571
             R  A P WA
Sbjct  451  KRTHAIPFWA  460



>gb|AEV41071.1| putative oryzain beta chain precursor [Oryza minuta]
Length=464

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  275  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS +  VCD   +CP  +
Sbjct  335  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSATDHVCDDNFSCPVGS  394

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  395  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  454

Query  542  TRIPAQ  559
             R  A+
Sbjct  455  KRTLAK  460



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 141/198 (71%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQ YSSG+FTG CGT LDHGV  VGYGTENG DYWIV+NSWG  WGE GY+++
Sbjct  273  IEGGGRAFQHYSSGVFTGYCGTQLDHGVVVVGYGTENGEDYWIVRNSWGANWGESGYIKL  332

Query  182  QRN-VKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            QRN   + TG CGIAM+ASYP K G +      P  P P+P  P    +VCD++ +CP  
Sbjct  333  QRNFANSTTGKCGIAMQASYPLKSGAN------PPNPGPSPPTPVTPSTVCDEYYSCPQG  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G YCF WGCCP +SA CCDD+YSCCPHDYPVC V +GTC   K+NPL VKA
Sbjct  387  TTCCCIYQYGEYCFGWGCCPYESATCCDDNYSCCPHDYPVCDVDAGTCLMSKDNPLKVKA  446

Query  539  MTRIPAQPMWAFKNAGKK  592
            + R PA+  W+   + +K
Sbjct  447  LKRGPARVNWSGMKSNRK  464



>gb|EAZ32359.1| hypothetical protein OsJ_16569 [Oryza sativa Japonica Group]
Length=480

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  291  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  350

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS    VCD   +CPA +
Sbjct  351  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGS  410

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  411  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  470

Query  542  TRIPAQ  559
             R  A+
Sbjct  471  KRTLAK  476



>gb|AEV41024.1| putative oryzain beta chain precursor [Oryza minuta]
Length=493

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  304  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  363

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAM ASYPTK G + P PSP  P  PTP PP+    VCD   +CPA +
Sbjct  364  ERNINATTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPAAPDHVCDDNFSCPAGS  423

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP +YP+C+ R+GTC+  KN+PL VKA+
Sbjct  424  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPEYPICNTRAGTCSASKNSPLSVKAL  483

Query  542  TRIPAQ  559
             R  A+
Sbjct  484  KRTLAK  489



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA G DFQ Y SGIFTG CG  LDHGV  VGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  268  IEASGRDFQFYDSGIFTGKCGIALDHGVVVVGYGTENGKDYWIVRNSWGADWGENGYLRM  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +R + +KTG+CGIA+E SYP K G        P  P P+P  P    SVCD++  CP ST
Sbjct  328  ERGISSKTGICGIAIEPSYPVKTG------VNPPNPGPSPPTPKTPESVCDEYYTCPMST  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK  535
            TCCC++ +  YCFAWGCCPL+ A CCDD YSCCPHDYPVC+VR+GTC+ K NNPLGV+
Sbjct  382  TCCCMYEYYGYCFAWGCCPLEGASCCDDGYSCCPHDYPVCNVRAGTCSMKYNNPLGVR  439



>gb|KDO84085.1| hypothetical protein CISIN_1g024783mg [Citrus sinensis]
Length=244

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIFTG CGT LDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  68   IEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRM  127

Query  182  QRNVKAK-TGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIAMEASYP KKG        P  P P+P  P+  P+VCD + +CP S
Sbjct  128  ERNVAGTLTGKCGIAMEASYPIKKG------QNPPNPGPSPPSPTKPPAVCDNYYSCPES  181

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKK  514
             TCCCVF +GN CFAWGCCPL++A CCDDHYSCCPHDYP+C+VR+GTC   +
Sbjct  182  NTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMVR  233



>gb|EMT10724.1| Oryzain beta chain [Aegilops tauschii]
Length=401

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+RM
Sbjct  212  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTDNGKDYWIVRNSWGPNWGEAGYLRM  271

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  272  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  331

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+  KN+PL VKA+
Sbjct  332  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL  391

Query  542  TRIPA  556
             R  A
Sbjct  392  KRTLA  396



>gb|AEV41117.1| putative oryzain beta chain precursor [Oryza officinalis]
Length=465

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GYVRM
Sbjct  276  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRM  335

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G + P PSP  P  PTP PPS    VCD   +CP  +
Sbjct  336  ERNINVTTGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPVGS  395

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  396  TCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  455

Query  542  TRIPAQ  559
             R  A+
Sbjct  456  KRTLAK  461



>ref|XP_007145379.1| hypothetical protein PHAVU_007G234100g [Phaseolus vulgaris]
 gb|ESW17373.1| hypothetical protein PHAVU_007G234100g [Phaseolus vulgaris]
Length=460

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 139/197 (71%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT+LDHGVA VGYGTENG DYW+V+NSWG  WGE GY+++
Sbjct  268  IEAGGREFQLYQSGVFTGRCGTELDHGVAVVGYGTENGTDYWLVRNSWGPAWGENGYIKL  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRNV ++TG CGIAMEASYPTK G      + P  P P+P  P+   +VCD++ +C   T
Sbjct  328  QRNVNSETGKCGIAMEASYPTKSG------ANPPNPGPSPPAPAAPSTVCDEYYSCSPGT  381

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +  +CF WGCCP+ SA CC D  SCCP ++PVC   SG+C   +NNP GVKA+
Sbjct  382  TCCCLFEYRGFCFGWGCCPIQSATCCADKSSCCPPEFPVCDTTSGSCLLSRNNPFGVKAL  441

Query  542  TRIPAQPMWAFKNAGKK  592
             R PA      +  G K
Sbjct  442  KREPATCTLTQRKVGMK  458



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 135/186 (73%), Gaps = 7/186 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGTE+GVDYW VKNSWG  WGE GY+RM
Sbjct  386  IEAGGRPFQLYHSGVFTGHCGTNLDHGVVAVGYGTEDGVDYWTVKNSWGPDWGENGYIRM  445

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIA  ASYP KKG + P PSP  P    P        VCD + +CP  
Sbjct  446  ERNVAGTSTGKCGIATMASYPIKKGQNPPKPSPSPPSPVKPPT------VCDDYYSCPEG  499

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ FG +CF WGCCPL+SA CCDDHYSCCP +YP+C + +GTC   K+NPLGVK 
Sbjct  500  STCCCLYEFGKFCFGWGCCPLESATCCDDHYSCCPQEYPICDLATGTCRMSKDNPLGVKL  559

Query  539  MTRIPA  556
            + R PA
Sbjct  560  LRRGPA  565



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGTDLDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+R+
Sbjct  284  IEAGGRAFQLYQSGVFTGRCGTDLDHGVVAVGYGTDNGTDYWIVRNSWGKDWGESGYIRL  343

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV    TG CGIA++ SYPTK G + P PS   P    P         CD++ +C   
Sbjct  344  ERNVANITTGKCGIAVQPSYPTKSGANPPKPSASPPSPVKPPTE------CDEYFSCEEG  397

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ FG+ CFAWGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K++ +GV  
Sbjct  398  STCCCIYQFGSTCFAWGCCPLESATCCDDHYSCCPHEYPVCDLEAGTCRVSKDSSMGVNL  457

Query  539  MTRIPAQPMWAFKNAGK  589
            + R+PA      +  GK
Sbjct  458  LKRLPAIQTKKVQKLGK  474



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG +FQLY SG+FTG CGT LDHGV AVGYGT  G DYWIV+NSWG  WGE GY+R+
Sbjct  282  IEGGGREFQLYVSGVFTGRCGTALDHGVVAVGYGTAKGHDYWIVRNSWGSSWGEDGYIRL  341

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  +++G CGIA+E SYP K          P  P P+P  P   P+VCD + +C  S
Sbjct  342  ERNLANSRSGKCGIAIEPSYPLKN------GPNPPNPGPSPPSPVKPPNVCDNYYSCADS  395

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
             TCCC+F FGN CF WGCCPL+ A CCDDHYSCCP DYP+C+  +GTC + KNNP GVKA
Sbjct  396  ATCCCIFEFGNACFEWGCCPLEGASCCDDHYSCCPADYPICNTYAGTCLRSKNNPFGVKA  455

Query  539  MTRIPAQPMWAFKNAGK  589
            + R PA+P W F    K
Sbjct  456  LRRTPAKPHWTFGRKNK  472



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 141/195 (72%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGTENGVDYW V+NSWG  WGE GY+++
Sbjct  269  IEAGGRAFQLYESGVFTGHCGTNLDHGVVAVGYGTENGVDYWTVRNSWGPKWGENGYIKL  328

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A +G CGIA  ASYPTK        S P  P P+P  P   P+VCD + +CP  +
Sbjct  329  ERNINATSGKCGIASMASYPTK------TGSNPPNPGPSPPTPVNPPTVCDDYYSCPEGS  382

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+ +G++C  WGCCPL+SA CCDDH SCCPH+YP+C +  GTC   K+NPLGVKA+
Sbjct  383  TCCCVYQYGDFCIGWGCCPLESATCCDDHSSCCPHEYPICDLDGGTCLMSKDNPLGVKAL  442

Query  542  TRIPAQPMWAFKNAG  586
             R PA+      +AG
Sbjct  443  KRGPARRNVGHLHAG  457



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY +G+FTG+C T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  278  IEAGGREFQLYKAGVFTGTCTTNLDHGVVAVGYGTENGKDYWIVRNSWGAKWGEDGYIRM  337

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAM ASYPTKKG +  PP P   P   P PP    +VCD+  +C A +
Sbjct  338  ERNVNATTGKCGIAMMASYPTKKGAN--PPKPSPTPPTPPPPPVAPDNVCDENFSCAAGS  395

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP  YPVC+VR+GTC+  KN+PL VKA+
Sbjct  396  TCCCAFGFRNVCLVWGCCPMEGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPLSVKAL  455

Query  542  TRIPAQ  559
             R  A+
Sbjct  456  KRTLAK  461



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+AGG DFQLY SGIF+G CG DLDHGV  VGYGTE GVDYWIV+NSWGD WGEKGY+RM
Sbjct  277  IDAGGRDFQLYESGIFSGKCGLDLDHGVNVVGYGTEKGVDYWIVRNSWGDSWGEKGYLRM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKG-GDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNVKAK GLCGIA+E SYP K G     P   P  PSP P  PS   SVCD + ACP S
Sbjct  337  KRNVKAKEGLCGIAVEPSYPVKSGLNPPKPGPSPPTPSPPPPAPSAPSSVCDDYYACPDS  396

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKK  514
            TTCCC++ +  YCF WGCCPL  A CCDDHYSCCPH+YPVC V +GTC+  K
Sbjct  397  TTCCCIYEYHGYCFEWGCCPLKGATCCDDHYSCCPHEYPVCDVYAGTCSISK  448



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY +G+FTG+C T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  335  IEAGGREFQLYKAGVFTGTCTTNLDHGVVAVGYGTENGKDYWIVRNSWGAKWGEDGYIRM  394

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAM ASYPTKKG +  PP P   P   P PP    +VCD+  +C A +
Sbjct  395  ERNVNATTGKCGIAMMASYPTKKGAN--PPKPSPTPPTPPPPPVAPDNVCDENFSCAAGS  452

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP  YPVC+VR+GTC+  KN+PL VKA+
Sbjct  453  TCCCAFGFRNVCLVWGCCPMEGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPLSVKAL  512

Query  542  TRIPAQ  559
             R  A+
Sbjct  513  KRTLAK  518



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY +G+F+G+C T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  275  IEAGGREFQLYKAGVFSGTCTTNLDHGVVAVGYGTENGKDYWIVRNSWGAKWGEDGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAM ASYPTKKG +  PP P   P   P PP    +VCD+  +C A +
Sbjct  335  ERNVNATTGKCGIAMMASYPTKKGAN--PPKPSPTPPTPPPPPVAPDNVCDENFSCAAGS  392

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP  YPVC+VR+GTC+  KN+PL VKA+
Sbjct  393  TCCCAFGFRNVCLVWGCCPMEGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPLSVKAL  452

Query  542  TRIPAQ  559
             R  A+
Sbjct  453  KRTLAK  458



>ref|XP_002448736.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
 gb|EES13064.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
Length=467

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+F+GSC T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  281  IEAGGRQFQLYKSGVFSGSCTTNLDHGVVAVGYGTENGKDYWIVRNSWGPKWGEAGYIRM  340

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAM ASYPTKKG +   P  PSP  PTP PP     VCD+   C A +
Sbjct  341  ERNINATTGKCGIAMMASYPTKKGAN---PPKPSPTPPTPPPPVAPDHVCDENFVCSAGS  397

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP DYPVC++R+ TC+  KN+PL VKA+
Sbjct  398  TCCCAFGFRNVCLVWGCCPIEGATCCKDHASCCPPDYPVCNIRARTCSVSKNSPLSVKAL  457

Query  542  TRIPAQ  559
             R  A+
Sbjct  458  KRTLAK  463



>gb|AAU81588.1| cysteine proteinase, partial [Petunia x hybrida]
Length=173

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +2

Query  71   LDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAKTGLCGIAMEASYPTKK  250
            +DHGV AVGYG+ENG+DYWI++NSWG  WGEKGY+R+QRNV ++ GLCG+A+E SYP K 
Sbjct  3    VDHGVVAVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASRQGLCGLAIEPSYPVKT  62

Query  251  GGDNpppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCPLDSA  430
            G        P  P P+P  P   P+VCD+++ CP STTCCCVF + + CF+WGCCPL+ A
Sbjct  63   G------QNPPNPGPSPPSPVTPPTVCDEYSECPESTTCCCVFEYYHSCFSWGCCPLEGA  116

Query  431  VCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAMTRIPAQPMWAFKNAGKKGTS  601
             CC+DHYSCCPHDYPVC+VR+GTC+  K+NPLGVKAM  I A+P+ AF   GKK +S
Sbjct  117  TCCEDHYSCCPHDYPVCNVRAGTCSLSKDNPLGVKAMKHILAKPIGAFSKGGKKSSS  173



>ref|NP_001150196.1| cysteine protease 1 precursor [Zea mays]
 gb|ACF84983.1| unknown [Zea mays]
 gb|ACF86484.1| unknown [Zea mays]
 gb|ACG38208.1| cysteine protease 1 precursor [Zea mays]
 gb|AFW59827.1| cysteine protease 1 [Zea mays]
Length=470

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+GSC T+LDHGV AVGYG ENG DYWIV+NSWG  WGE GY+RM
Sbjct  286  IEAGGREFQLYKSGVFSGSCTTNLDHGVVAVGYGAENGKDYWIVRNSWGPKWGEAGYIRM  345

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAM ASYPTKKG +     PP P    PTPP+   +VCD+  +C A +
Sbjct  346  ERNVNASTGKCGIAMMASYPTKKGAN-----PPRPSPTPPTPPAAPDNVCDENFSCSAGS  400

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP++ A CC DH SCCP  YPVC+VR+GTC+  KN+PL VKA+
Sbjct  401  TCCCAFGFRNVCLVWGCCPVEGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPLSVKAL  460

Query  542  TRIPAQ  559
             R  A+
Sbjct  461  KRTLAK  466



>ref|XP_006652996.1| PREDICTED: oryzain beta chain-like [Oryza brachyantha]
Length=460

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+RM
Sbjct  274  IEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYIRM  333

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   TG CGIAM ASYPTK G +   P  PSP  PTP PPSP   VCD+  +CPA +
Sbjct  334  ERNINVTTGKCGIAMMASYPTKSGAN---PPQPSPSPPTPPPPSPPDHVCDENFSCPAGS  390

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F   C  WGCCP++ A CC DH SCCP DYPVC+ R+GTC+  KN+PL VKA+
Sbjct  391  TCCCAFGFKKLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKAL  450

Query  542  TRIPAQ  559
             R  A+
Sbjct  451  KRTLAK  456



>gb|AAU81595.1| cysteine proteinase, partial [Petunia x hybrida]
Length=178

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = +2

Query  62   GTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAKTGLCGIAMEASYP  241
            G  +DHGV AVGYG+ENG+DYWIV+NSWG  WGEKGY+RMQRN+    GLC IA  ASYP
Sbjct  5    GEAMDHGVVAVGYGSENGMDYWIVRNSWGASWGEKGYLRMQRNIAKPAGLCAIAKMASYP  64

Query  242  TKKGGDNpppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCFAWGCCPL  421
             K G + P P+P  P    P         CD +  CPA TTCCCV+ + +YCFAWGCCP+
Sbjct  65   VKTGQNPPKPAPSPPSPIKPPSQ------CDDYYQCPAGTTCCCVYEYHSYCFAWGCCPM  118

Query  422  DSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAMTRIPAQPMWAFKNAGKK  592
            + A CC DH SCCPHDYPVC+VR+GTC+K KNNPLGV+AM  I A+P+ AFKN GK+
Sbjct  119  EGATCCKDHNSCCPHDYPVCNVRAGTCSKSKNNPLGVQAMKHILAEPIGAFKNEGKE  175



>ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 140/185 (76%), Gaps = 3/185 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGTDLDHGV  VGYGTE+G DYWIVKNSWG  WGE GY+R+
Sbjct  281  IEAGGREFQLYQSGVFTGRCGTDLDHGVLTVGYGTEDGKDYWIVKNSWGPNWGEAGYIRL  340

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV AKTG CGIA+E SYPTKKG +      P P  P+P PP    +VCD +  CP  T
Sbjct  341  ERNVPAKTGKCGIAIEPSYPTKKGQNP---PRPGPSPPSPPPPLSPSTVCDDYYTCPTGT  397

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC + +GN+CF WGCCP++SA CCDDHYSCCPHDYPVC + +GTC   KN+P+ VKAM
Sbjct  398  TCCCAYAYGNFCFGWGCCPMESATCCDDHYSCCPHDYPVCDLDAGTCKLSKNSPMSVKAM  457

Query  542  TRIPA  556
             R  A
Sbjct  458  KRTAA  462



>ref|NP_566633.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB02463.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAL32803.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAM13349.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AEE76234.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=452

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 134/185 (72%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SG+FTG+CGT LDHGV AVGYG+E G DYWIV+NSWG  WGE GY ++
Sbjct  265  IEAGGRAFQLYTSGVFTGTCGTSLDHGVVAVGYGSEGGQDYWIVRNSWGSNWGESGYFKL  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+K  +G CG+AM ASYPTK  G N            P PP+PSP VCDK N CPA +
Sbjct  325  ERNIKESSGKCGVAMMASYPTKSSGSN-----------PPKPPAPSPVVCDKSNTCPAKS  373

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCP +SA CCDD  SCCP  YPVC +++ TC  K N+PL +KA+
Sbjct  374  TCCCLYEYNGKCYSWGCCPYESATCCDDGSSCCPQSYPVCDLKANTCRMKGNSPLSIKAL  433

Query  542  TRIPA  556
            TR PA
Sbjct  434  TRGPA  438



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 142/193 (74%), Gaps = 7/193 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGT-ENGVDYWIVKNSWGDYWGEKGYVR  178
            I+AGG  FQ Y SG+FTG CG DLDHGVAAVGYGT E+G DYWIV+NSWG  WGE GY++
Sbjct  281  IDAGGSAFQFYQSGVFTGRCGEDLDHGVAAVGYGTSEDGKDYWIVRNSWGGDWGENGYIK  340

Query  179  MQRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPA  355
            M+RNV   K G CGIA+E SYP K        +PP+P    P+PP    S CD + +CP+
Sbjct  341  MERNVAGKKAGKCGIAVEPSYPIK-----TSKNPPNPGPTPPSPPPAPTSTCDSYYSCPS  395

Query  356  STTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK  535
            +TTCCCV+ +G+YCFAWGCCPL+SAVCC DH SCCPHDYP+C+++ GTC   KN+PL VK
Sbjct  396  ATTCCCVYEYGSYCFAWGCCPLESAVCCADHSSCCPHDYPICNLKKGTCNASKNSPLSVK  455

Query  536  AMTRIPAQPMWAF  574
            A+ R PA+    F
Sbjct  456  ALKRSPAKLHAKF  468



>ref|XP_008454976.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=480

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG CGT+LDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+R+
Sbjct  285  IEAGGRAFQLYQSGVFTGRCGTNLDHGVVAVGYGTDNGTDYWIVRNSWGKDWGENGYIRL  344

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV  + TG CGIA+E SYP K G + P PS   P    P         CD++ +C   
Sbjct  345  ERNVANSTTGKCGIAVEPSYPIKSGSNPPKPSASPPSPVNPPTE------CDEYFSCDEG  398

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            +TCCC++ +G+ CFAWGCCPL+SA CCDDHYSCCPH+YPVC + +GTC   K++ +GV  
Sbjct  399  STCCCIYQYGSTCFAWGCCPLESATCCDDHYSCCPHEYPVCDLEAGTCRASKDSLMGVNL  458

Query  539  MTRIPAQPMWAFKNAGK  589
            + R+PA      +  GK
Sbjct  459  LKRLPANQTKRIQKLGK  475



>ref|XP_001781010.1| predicted protein [Physcomitrella patens]
 gb|EDQ54194.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 131/192 (68%), Gaps = 8/192 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLYS G+FTG CGTDLDHGV AVGYG+E G+DYWIVKNSWG+YWGE GY+RM
Sbjct  268  IEAGGRDFQLYSGGVFTGRCGTDLDHGVLAVGYGSEKGLDYWIVKNSWGEYWGESGYLRM  327

Query  182  QRNVKAKT--GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPA  355
            QRN+K     GLCGI +E SY  K          P  P PTP  P P   +CDK+  CPA
Sbjct  328  QRNLKDDNGYGLCGINIEPSYAVKT------SPNPPNPGPTPPSPPPPEVICDKWRTCPA  381

Query  356  STTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK  535
              TCCC FP G  C AWGCC LDSA CCDDHY CCPH+YP+C++ +G C K  ++  GV 
Sbjct  382  ENTCCCTFPVGKSCLAWGCCALDSATCCDDHYHCCPHEYPICNLDAGLCLKGSHDKEGVA  441

Query  536  AMTRIPAQPMWA  571
             M R  A   WA
Sbjct  442  LMKRTLAHFNWA  453



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 7/186 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQ YSSG+FTG CGT LDHGV A+GYGT+NG DYWIV+NSWG  WGE GY+R+
Sbjct  273  IEAGGRAFQHYSSGVFTGYCGTQLDHGVVAIGYGTDNGSDYWIVRNSWGPNWGESGYIRL  332

Query  182  QRNVKAKT-GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+   T G CGIAME SYP K G +      P  P P+P  P    +VCD++ +C A 
Sbjct  333  ERNLANSTSGKCGIAMEPSYPLKNGAN------PPNPGPSPPSPVAPSTVCDEYYSCTAG  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G+YCF WGCCP +SA CCDD+ SCCPHDYPVC V SGTC   K++PL VKA
Sbjct  387  TTCCCIYKYGDYCFGWGCCPYESATCCDDNNSCCPHDYPVCDVNSGTCQMSKDSPLSVKA  446

Query  539  MTRIPA  556
            + R PA
Sbjct  447  LKRGPA  452



>dbj|BAH20390.1| AT1G47128 [Arabidopsis thaliana]
Length=178

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = +2

Query  41   GIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAKTGLCGI  220
            GIF GSCGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM RN+ + +G CGI
Sbjct  1    GIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGI  60

Query  221  AMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPASTTCCCVFPFGNYCF  400
            A+E SYP K G        P  P P+P  P   P+ CD +  CP S TCCC+F +G YCF
Sbjct  61   AIEPSYPIKNG------ENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCF  114

Query  401  AWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAMTRIPAQPMWA  571
            AWGCCPL++A CCDD+YSCCPH+YPVC +  GTC   KN+P  VKA+ R PA P W+
Sbjct  115  AWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWS  171



>ref|XP_001783545.1| predicted protein [Physcomitrella patens]
 gb|EDQ51634.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 133/192 (69%), Gaps = 9/192 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLY+ G+F+G CGTDLDHGV AVGYGTE+GVDYWIVKNSWG+YWGE GY+RM
Sbjct  272  IEAGGRDFQLYAQGVFSGECGTDLDHGVLAVGYGTEDGVDYWIVKNSWGEYWGESGYLRM  331

Query  182  QRNVKAKT---GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACP  352
            +RN+K      GLCGI +E SY  K          P  P PTP  P+P   +CDK+  CP
Sbjct  332  KRNMKDSNDGPGLCGINIEPSYAVKT------SPNPPNPGPTPPSPTPPEVICDKWRTCP  385

Query  353  ASTTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGV  532
            +  TCCC FP G  C AWGCC +DSA CCDDHY CCPHDYPVC++ +G C K +++  GV
Sbjct  386  SENTCCCTFPMGKMCLAWGCCSMDSATCCDDHYHCCPHDYPVCNLAAGLCVKGEHDKEGV  445

Query  533  KAMTRIPAQPMW  568
              M R  A   W
Sbjct  446  ALMKRTMAHFNW  457



>ref|XP_001755855.1| predicted protein [Physcomitrella patens]
 gb|EDQ79528.1| predicted protein [Physcomitrella patens]
Length=454

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG DFQLYS G+FTG CGTDLDHGV AVGYG+E  +DYWIVKNSWG+YWGE GY+RM
Sbjct  265  IEAGGRDFQLYSGGVFTGECGTDLDHGVLAVGYGSEGSLDYWIVKNSWGEYWGESGYLRM  324

Query  182  QRNVK---AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACP  352
            QRN+K    + GLCGI +E SY  K          P  P PTP  PSP   VCDK+  CP
Sbjct  325  QRNIKDSNHQFGLCGINIEPSYAVKT------SPNPPNPGPTPPSPSPPEVVCDKWRTCP  378

Query  353  ASTTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGV  532
            +  TCCC FP G  C AWGCC LDSA CCDDHY CCPHDYPVC++ +G C K +++  GV
Sbjct  379  SENTCCCTFPVGKMCLAWGCCSLDSATCCDDHYHCCPHDYPVCNLAAGLCLKGEHDKEGV  438

Query  533  KAMTRIPAQPMW  568
              M R  A   W
Sbjct  439  ALMKRTLAHFNW  450



>ref|XP_009396437.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 132/189 (70%), Gaps = 9/189 (5%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAG  +FQLY SG+FTG CGTDLDHG   VGYGT++G DYWIV+NSWG+ WGE GY+RM
Sbjct  281  IEAGSREFQLYRSGVFTGRCGTDLDHGAVIVGYGTDHGKDYWIVRNSWGEDWGEAGYIRM  340

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +R+V    G CGIAM  SYPTKK   + P  P S   PT          CD   AC + T
Sbjct  341  ERSVNTSAGKCGIAMIPSYPTKKDPKHGPCHPSSVNPPTS---------CDSQYACLSGT  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV+  G YC+AWGCCP ++A CC+DHYSCCP DYP C+V++GTC   K+NPLGVKA+
Sbjct  392  TCCCVYENGRYCYAWGCCPSEAATCCEDHYSCCPQDYPFCNVQAGTCQMSKDNPLGVKAL  451

Query  542  TRIPAQPMW  568
               PA P W
Sbjct  452  ASSPATPYW  460



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 135/186 (73%), Gaps = 7/186 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQ YSSG+FTG CGT LDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+R+
Sbjct  273  IEAGGRAFQHYSSGVFTGYCGTQLDHGVVAVGYGTDNGSDYWIVRNSWGPNWGESGYIRL  332

Query  182  QRNVKAKT-GLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+   T G CGIAME SYP K G +      P  P P+P  P    +VCD++ +C   
Sbjct  333  ERNLANSTSGKCGIAMEPSYPLKNGAN------PPNPGPSPPSPVAPSTVCDEYYSCTEG  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC++ +G+YCF WGCCP +SA CCDD+ SCCPHDYPVC V +GTC   K++PL VKA
Sbjct  387  TTCCCIYKYGDYCFGWGCCPYESATCCDDNNSCCPHDYPVCDVNAGTCQMSKDSPLNVKA  446

Query  539  MTRIPA  556
            + R PA
Sbjct  447  LKRSPA  452



>emb|CDY46179.1| BnaA05g20660D [Brassica napus]
Length=450

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYGT  G DYWI++NSWG  WGE GY+++
Sbjct  263  IEAGGRAFQLYKSGVFTGTCGTALDHGVVAVGYGTSEGQDYWIIRNSWGSNWGESGYIKL  322

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+K  +G CG+AM ASYPTK  G N            P PP P+P VCDK   CPA +
Sbjct  323  ERNIKDSSGKCGVAMMASYPTKSSGSN-----------PPKPPPPAPVVCDKSYNCPAKS  371

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCPL+SA CC+D  SCCP  YPVC +++GTC  K N+PL VKA+
Sbjct  372  TCCCLYEYKGKCYSWGCCPLESATCCEDGSSCCPQAYPVCDLKAGTCRMKANSPLSVKAL  431

Query  542  TRIPA  556
            TR PA
Sbjct  432  TRGPA  436



>ref|XP_009145796.1| PREDICTED: probable cysteine proteinase At3g19400 [Brassica rapa]
Length=450

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYGT  G DYWI++NSWG  WGE GY+++
Sbjct  263  IEAGGRAFQLYKSGVFTGTCGTALDHGVVAVGYGTSEGQDYWIIRNSWGSNWGESGYIKL  322

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+K  +G CG+AM ASYPTK  G N            P PP P+P VCDK   CPA +
Sbjct  323  ERNIKDSSGKCGVAMMASYPTKSSGSN-----------PPKPPPPAPVVCDKSYNCPAKS  371

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCPL+SA CC+D  SCCP  YPVC +++GTC  K N+PL VKA+
Sbjct  372  TCCCLYEYKGKCYSWGCCPLESATCCEDGSSCCPQAYPVCDLKAGTCRMKANSPLSVKAL  431

Query  542  TRIPA  556
            TR PA
Sbjct  432  TRGPA  436



>gb|AAL60578.1|AF454956_1 senescence-associated cysteine protease [Brassica oleracea]
Length=445

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYGT  G DYWI++NSWG  WGE GY+++
Sbjct  258  IEAGGRGFQLYKSGVFTGTCGTALDHGVVAVGYGTSEGQDYWIIRNSWGSNWGESGYIKL  317

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+K  +G CG+AM ASYPTK  G N            P PP P+P VCDK   CPA +
Sbjct  318  QRNIKDSSGKCGVAMMASYPTKSSGSN-----------PPKPPPPAPVVCDKSYTCPAKS  366

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCPL+SA CC+D  SCCP  YPVC +++GTC  K ++PL VKA+
Sbjct  367  TCCCLYEYKGKCYSWGCCPLESATCCEDGSSCCPQAYPVCDLKAGTCRMKADSPLSVKAL  426

Query  542  TRIPA  556
            TR PA
Sbjct  427  TRGPA  431



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 135/218 (62%), Gaps = 34/218 (16%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IE GG  FQLY SGIF G CGTDLDHGV AVGYGTENG DYWIVKNSWG  WGE GY+RM
Sbjct  267  IEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGKDYWIVKNSWGTSWGESGYIRM  326

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ +  G CGIA+E SYP K G        P  P P+P  P   P+ CD +  CP S 
Sbjct  327  ERNIASSAGKCGIAVEPSYPIKNG------QNPPNPGPSPPSPVKPPTQCDSYYTCPESN  380

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTC-------------  502
            TCCC+F +G YC AWGCCPL++A CCDD+YSCCPH+YPVC +  GTC             
Sbjct  381  TCCCLFDYGKYCLAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLIGKFCFSHFSRK  440

Query  503  ---------------TKKKNNPLGVKAMTRIPAQPMWA  571
                            + KN+P  +KA+ R PA P W+
Sbjct  441  QPINGNFLNLLGIFHLQSKNSPFSIKAIKRKPATPFWS  478



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 139/199 (70%), Gaps = 8/199 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+FTG CGT+LDHGV AVGYGTENG DYW+V+NSWG  WGE GY+++
Sbjct  243  IEAGGMEFQLYQSGVFTGRCGTNLDHGVVAVGYGTENGTDYWLVRNSWGSAWGENGYIKL  302

Query  182  QRNVK-AKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RNV+  +TG CGIA+EASYP K G +      P  P P+P  P+    VCD++ +C + 
Sbjct  303  ERNVQNTETGKCGIAIEASYPIKNGAN------PPNPGPSPPSPATPSIVCDEYYSCNSG  356

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKA  538
            TTCCC+F +  +CF WGCCP++SA CC D  SCCP D+P C   SG+C   ++NP GVKA
Sbjct  357  TTCCCLFEYRGFCFGWGCCPIESATCCPDQTSCCPPDFPFCD-DSGSCLLSRDNPFGVKA  415

Query  539  MTRIPAQPMWAFKNAGKKG  595
            + R PA   W  +    KG
Sbjct  416  LRRTPATSTWTQRKVAMKG  434



>emb|CDX99227.1| BnaC05g33420D [Brassica napus]
Length=507

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYGT  G DYWI++NSWG  WGE GY+++
Sbjct  263  IEAGGRAFQLYKSGVFTGTCGTALDHGVVAVGYGTSEGQDYWIIRNSWGSNWGESGYIKL  322

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            QRN+K  +G CG+AM ASYPTK  G N            P PP P+P VCDK   CPA +
Sbjct  323  QRNIKDSSGKCGVAMMASYPTKSSGSN-----------PPKPPPPAPVVCDKSYTCPAKS  371

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCPL+SA CC+D  SCCP  YPVC +++GTC  K ++PL VKA+
Sbjct  372  TCCCLYEYKGKCYSWGCCPLESATCCEDGSSCCPQAYPVCDLKAGTCRMKADSPLSVKAL  431

Query  542  TRIPA  556
            TR PA
Sbjct  432  TRGPA  436



>ref|XP_010466084.1| PREDICTED: probable cysteine proteinase At3g19400 isoform X1 
[Camelina sativa]
Length=452

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 132/185 (71%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYG+E G DYWI++NSWG  WGE GYV++
Sbjct  265  IEAGGRAFQLYKSGVFTGTCGTSLDHGVVAVGYGSEGGKDYWIIRNSWGSNWGESGYVKL  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CG+AM ASYPTK  G N            P PP PSP VCDK   CP  +
Sbjct  325  ERNINESSGKCGVAMMASYPTKSSGSN-----------PPKPPLPSPVVCDKSYTCPPKS  373

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCP++SA CCDD  SCCP  YPVC +++GTC  K N+PL +KA+
Sbjct  374  TCCCLYEYEGKCYSWGCCPIESATCCDDGSSCCPQSYPVCDLKAGTCRMKGNSPLSIKAL  433

Query  542  TRIPA  556
            TR PA
Sbjct  434  TRGPA  438



>ref|XP_002963113.1| hypothetical protein SELMODRAFT_270344 [Selaginella moellendorffii]
 gb|EFJ36576.1| hypothetical protein SELMODRAFT_270344 [Selaginella moellendorffii]
Length=479

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+AGG   Q Y SGIFTG CGTDLDHGV  VGYG E+G  YWI+KNSWG  WGEKGY++M
Sbjct  287  IDAGGSSMQFYRSGIFTGRCGTDLDHGVTNVGYGKEDGKAYWIIKNSWGSNWGEKGYIKM  346

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN     GLCGI MEASYPTK G + P P P  P    P         CD +  CP S+
Sbjct  347  ARNTGLAAGLCGINMEASYPTKTGANPPNPGPTPPSPVPPPNE------CDDYYTCPESS  400

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL SA CCDDHY CCP D+P+C++++ TC +   + LG K +
Sbjct  401  TCCCLFNYGKYCFAWGCCPLQSATCCDDHYHCCPSDFPICNLKANTCLRSSKDLLGTKML  460

Query  542  TRIPAQ  559
             R PA+
Sbjct  461  ERTPAR  466



>ref|XP_004960237.1| PREDICTED: oryzain beta chain-like isoform X2 [Setaria italica]
Length=461

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I AGG +FQLY SG+F+GSC T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  275  IAAGGREFQLYKSGVFSGSCTTNLDHGVVAVGYGTENGKDYWIVRNSWGPNWGESGYIRM  334

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+ A TG CGIAM ASYPTKKG   P P  PSP  PTP PP    +VCD+  +C A +
Sbjct  335  ERNINAITGKCGIAMMASYPTKKG---PNPPKPSPTPPTPPPPVAPDNVCDENYSCSAGS  391

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP+  A CC DH SCCP DYPVC++R+ TC+  KN+PL V A+
Sbjct  392  TCCCAFGFRNVCLVWGCCPIKGATCCKDHASCCPPDYPVCNIRAQTCSASKNSPLSVPAL  451

Query  542  TRIPA  556
             R  A
Sbjct  452  KRTLA  456



>ref|XP_006297656.1| hypothetical protein CARUB_v10013678mg [Capsella rubella]
 gb|EOA30554.1| hypothetical protein CARUB_v10013678mg [Capsella rubella]
Length=455

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 131/185 (71%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYG+E G DYWI++NSWG  WGE GYV++
Sbjct  268  IEAGGRAFQLYKSGVFTGTCGTSLDHGVVAVGYGSEGGRDYWIIRNSWGSNWGESGYVKL  327

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CG+AM ASYPTK  G N            P PP PSP VCDK   CP  +
Sbjct  328  ERNINESSGKCGVAMMASYPTKSSGSN-----------PPKPPLPSPVVCDKSYTCPPKS  376

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCPL+SA CCDD  SCCP  YPVC +++GTC  K  +PL VKA+
Sbjct  377  TCCCLYEYEGKCYSWGCCPLESATCCDDGSSCCPQSYPVCDLKAGTCRMKGTSPLSVKAL  436

Query  542  TRIPA  556
            TR PA
Sbjct  437  TRGPA  441



>ref|XP_010507701.1| PREDICTED: probable cysteine proteinase At3g19400 [Camelina sativa]
Length=453

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 131/185 (71%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYG+E G DYWI++NSWG  WGE GYV++
Sbjct  266  IEAGGRAFQLYKSGVFTGTCGTSLDHGVVAVGYGSEGGKDYWIIRNSWGSNWGESGYVKL  325

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CG+AM ASYPTK  G N            P PP PSP VCDK   CP  +
Sbjct  326  ERNINESSGKCGVAMMASYPTKSSGSN-----------PPRPPLPSPVVCDKSYTCPPKS  374

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCC L+SA CCDD  SCCP  YPVC +++GTC  K N+PL +KA+
Sbjct  375  TCCCLYEYEGKCYSWGCCSLESATCCDDGSSCCPQSYPVCDLKAGTCRMKGNSPLSIKAL  434

Query  542  TRIPA  556
            TR PA
Sbjct  435  TRGPA  439



>ref|XP_002980210.1| hypothetical protein SELMODRAFT_153766 [Selaginella moellendorffii]
 gb|EFJ18470.1| hypothetical protein SELMODRAFT_153766 [Selaginella moellendorffii]
Length=479

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+AGG   Q Y SGIFTG CGTDLDHGV  VGYG E+G  YWI+KNSWG  WGEKGYV+M
Sbjct  287  IDAGGSSMQFYRSGIFTGRCGTDLDHGVTNVGYGKEDGKAYWIIKNSWGSNWGEKGYVKM  346

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RN     GLCGI MEASYPTK G + P P P  P    P         CD +  CP S+
Sbjct  347  ARNTGLAAGLCGINMEASYPTKTGANPPNPGPTPPSPAPPPNE------CDDYYTCPESS  400

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+F +G YCFAWGCCPL SA CC+DHY CCP D+P+C++++ TC +   + LG K +
Sbjct  401  TCCCLFNYGKYCFAWGCCPLQSATCCEDHYHCCPSDFPICNLQANTCLRSSKDLLGTKML  460

Query  542  TRIPAQ  559
             R PA+
Sbjct  461  ERTPAR  466



>emb|CAQ00106.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY SG+F+G CGT LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  284  IEAGGREFQLYHSGVFSGRCGTQLDHGVVAVGYGTENGKDYWIVRNSWGPNWGEAGYLRM  343

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIAM +SYPTKKG + P P+P  P  PTP PP     VCD+  +CPA +
Sbjct  344  ERNINVTSGKCGIAMMSSYPTKKGANPPKPAPTPPSPPTPPPPVAPDHVCDENFSCPAGS  403

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC F F N C  WGCCP + A CC DH SCCP DYPVC++R+GTC+   N+       
Sbjct  404  TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSAVINSAFLFIFA  463

Query  542  TRIPAQPM  565
              +  QPM
Sbjct  464  AALSVQPM  471



>ref|XP_001761481.1| predicted protein [Physcomitrella patens]
 gb|EDQ73549.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTEN-GVDYWIVKNSWGDYWGEKGYVR  178
            IEAGG DFQ Y  G+FTG CGTDLDHGV AVGYGT++ GV+YWIVKNSWG  WGEKGY+R
Sbjct  273  IEAGGRDFQHYQGGVFTGPCGTDLDHGVLAVGYGTDDDGVNYWIVKNSWGPSWGEKGYIR  332

Query  179  MQR-NVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPA  355
            M+R    + +G CGI +E S+P KKG + PP  P  P    P         CD  ++CPA
Sbjct  333  MERMGSNSTSGKCGINIEPSFPIKKGANPPPAPPSPPTPVKPPSQ------CDSSHSCPA  386

Query  356  STTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVK  535
            S+TCCC F  G YC  WGCCP++SA CC+DHY CCP D+PVC++R+G C K KNNP GV 
Sbjct  387  SSTCCCAFNIGKYCLQWGCCPMESATCCEDHYHCCPSDFPVCNLRAGQCVKSKNNPFGVP  446

Query  536  AMTRIPAQPMW-AFKNAGKKGTSS  604
             + R  A+  W    +  +KG +S
Sbjct  447  MLERTRAKFNWPKVSDDSEKGRAS  470



>gb|ACF85649.1| unknown [Zea mays]
 gb|AFW75937.1| cysteine proteinase RD21a [Zea mays]
Length=262

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEA    FQLYSSGIF G CGT LDHGV  VGYG+E G DYWIVKNSWG  WGE GYVRM
Sbjct  68   IEASRRAFQLYSSGIFDGRCGTYLDHGVTVVGYGSEGGKDYWIVKNSWGTQWGEAGYVRM  127

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
             RNV+ + G CGIAME  YP K+G       P  PP PTP  P   P+VC+   +CP +T
Sbjct  128  ARNVRVRAGKCGIAMEPLYPVKEG-------PNPPPGPTPPSPVKPPNVCNAEYSCPEAT  180

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCCV  +   C A+GCC L++A CC+DH SCCPHDYPVC VR GTC K  N+P+ VKA+
Sbjct  181  TCCCVSEYRGKCLAYGCCELENATCCEDHSSCCPHDYPVCSVRDGTCRKSANSPMMVKAL  240

Query  542  TRIPAQPMWAFKNAGKKGTSS  604
             R PA          + G SS
Sbjct  241  QRKPAMYTGGGGGGEQSGRSS  261



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG +FQLY +G+FTG+C T+LDHGV AVGYGTENG DYWIV+NSWG  WGE GY+RM
Sbjct  278  IEAGGREFQLYKAGVFTGTCTTNLDHGVVAVGYGTENGKDYWIVRNSWGAKWGEDGYIRM  337

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RNV A TG CGIAM ASYPTKKG +  PP P   P   P PP    +VCD+  +C A +
Sbjct  338  ERNVNATTGKCGIAMMASYPTKKGAN--PPKPSPTPPTPPPPPVAPDNVCDENFSCAAGS  395

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPL  526
            TCCC F F N C  WGCCP++ A CC DH SCCP  YPVC+VR+GTC+  KN+P+
Sbjct  396  TCCCAFGFRNVCLVWGCCPMEGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPI  450



>gb|ACJ84565.1| unknown [Medicago truncatula]
Length=328

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            +E GG +FQLY  G+ TG CGT LDHGVAAVGYGTENG DYWIV+NSWG  WGE+GY+R+
Sbjct  159  VEGGGREFQLYEYGVLTGRCGTALDHGVAAVGYGTENGKDYWIVRNSWGGSWGEQGYIRL  218

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+  ++ G CGIA+E SYP K G + P P P  P    P        VCD + +C   
Sbjct  219  ERNLASSRAGKCGIAIEPSYPIKNGQNPPNPGPSPPSPIKPPS------VCDSYYSCAEG  272

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPL  526
            +TCCC++ +G  CF WGCCPL+SA CCDDHYSCCPH+YPVC  R+G C K KNNPL
Sbjct  273  STCCCIYEYGRSCFEWGCCPLESATCCDDHYSCCPHEYPVCDTRAGLCLKGKNNPL  328



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 127/168 (76%), Gaps = 7/168 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG+ WGE+GY+RM
Sbjct  273  IEAGGRAFQLYASGIFNGICGTQLDHGVVAVGYGTENGKDYWIVRNSWGNQWGEEGYIRM  332

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
            +RN+    TG CGIA+EASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  333  ERNLANTATGKCGIAIEASYPIKNG------QNPPNPGPSPPSPIKPPTVCDNYYSCPES  386

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTC  502
             TCCCV+ +  YCFAWGCCPL++A CCDDHYSCCPHDYP+C++  GTC
Sbjct  387  NTCCCVYEYYGYCFAWGCCPLEAATCCDDHYSCCPHDYPICNLNEGTC  434



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 125/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SGIF G CGT LDHGV AVGYGTE G DYWIVKNSWG  WGE GY+RM
Sbjct  272  IEAGGRSFQLYQSGIFDGKCGTQLDHGVTAVGYGTEKGKDYWIVKNSWGSSWGEAGYIRM  331

Query  182  QRNV-KAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAS  358
             RNV    TG CGIAMEASYP K G        P  P P+P  P   P+VCD + +CP S
Sbjct  332  ARNVANTVTGKCGIAMEASYPIKTG------ENPPNPGPSPPSPIKPPTVCDSYYSCPES  385

Query  359  TTCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNP  523
             TCCC++ + NYCFAWGCCPL++A CC+D YSCCPHDYPVC++  GTC   + +P
Sbjct  386  NTCCCIYEYYNYCFAWGCCPLEAATCCEDRYSCCPHDYPVCNIHEGTCLMVRLSP  440



>ref|XP_002883178.1| hypothetical protein ARALYDRAFT_479457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59437.1| hypothetical protein ARALYDRAFT_479457 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 131/185 (71%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYG+E G DYWIV+NSWG  WGE GY ++
Sbjct  265  IEAGGRAFQLYKSGVFTGTCGTSLDHGVVAVGYGSEGGQDYWIVRNSWGSNWGESGYFKL  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+K  +G CG+AM ASYPTK              S  P PP PSP VCDK N CPA +
Sbjct  325  ERNIKESSGKCGVAMMASYPTKS-----------SGSNPPKPPPPSPVVCDKSNTCPAKS  373

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCP +SA CCDD  SCCP  YPVC +++ TC  K ++PL +KA+
Sbjct  374  TCCCLYEYNGKCYSWGCCPYESATCCDDGSSCCPQSYPVCDLKANTCRMKGSSPLSIKAL  433

Query  542  TRIPA  556
            TR PA
Sbjct  434  TRGPA  438



>ref|XP_010466085.1| PREDICTED: probable cysteine proteinase At3g19400 isoform X2 
[Camelina sativa]
Length=451

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 132/185 (71%), Gaps = 12/185 (6%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            IEAGG  FQLY SG+FTG+CGT LDHGV AVGYG+E G DYWI++NSWG  WGE GYV++
Sbjct  265  IEAGGRAFQLYKSGVFTGTCGTSLDHGVVAVGYGSEGGKDYWIIRNSWGSNWGESGYVKL  324

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CG+AM ASYPTK  G N            P PP PSP VCDK   CP  +
Sbjct  325  ERNINESSGKCGVAMMASYPTKSSGSN-----------PPKPPLPSPVVCDKSYTCPPKS  373

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC++ +   C++WGCCP++SA CCDD  SCCP  YPVC +++GTC +  N+PL +KA+
Sbjct  374  TCCCLYEYEGKCYSWGCCPIESATCCDDGSSCCPQSYPVCDLKAGTC-RMGNSPLSIKAL  432

Query  542  TRIPA  556
            TR PA
Sbjct  433  TRGPA  437



>gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale]
Length=475

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 124/190 (65%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    IEAGGYDFQLYSSGIFTGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRM  181
            I+A G +FQLY SGIFTGSC T L+HGV  VGYGTENG DYWIVKNSWG+ WG  GY+ M
Sbjct  277  IDASGRNFQLYHSGIFTGSCNTSLNHGVTVVGYGTENGNDYWIVKNSWGENWGNSGYILM  336

Query  182  QRNVKAKTGLCGIAMEASYPTKKGGDNpppsppsppsptptppspspsVCDKFNACPAST  361
            +RN+   +G CGIA+  SYP K G  N     P+  S +      S + CD +  C  ST
Sbjct  337  ERNIAESSGKCGIAISPSYPIKVGATN--LRNPTTSSSSVPSLVESLTACDNYYTCSGST  394

Query  362  TCCCVFPFGNYCFAWGCCPLDSAVCCDDHYSCCPHDYPVCHVRSGTCTKKKNNPLGVKAM  541
            TCCC+   GN CFAWGCCPL+ A CC DHYSCCP +YP+C V    C   KN+PL VKA 
Sbjct  395  TCCCMHERGNRCFAWGCCPLEGATCCKDHYSCCPFNYPICSVADDNCLMSKNSPLRVKAS  454

Query  542  TRIPAQPMWA  571
             R PA P W 
Sbjct  455  RRTPAIPNWV  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250