BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006B11 466 bp,:Filtered

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010528407.1|  PREDICTED: ninja-family protein AFP3               114   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010089637.1|  hypothetical protein L484_021030                   114   4e-27   Morus notabilis
gb|KJB33416.1|  hypothetical protein B456_006G010000                    113   5e-27   Gossypium raimondii
ref|XP_007032759.1|  ABI five binding protein 3, putative               113   5e-27   Theobroma cacao [chocolate]
ref|XP_006395274.1|  hypothetical protein EUTSA_v10004771mg             112   5e-27   Eutrema salsugineum
gb|KHG26156.1|  Ninja-family protein AFP2                               113   5e-27   Gossypium arboreum [tree cotton]
ref|NP_189598.1|  Ninja-family protein AFP3                             110   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527618.1|  hypothetical protein RCOM_1025320                  108   1e-26   Ricinus communis
gb|KDP27248.1|  hypothetical protein JCGZ_19947                         112   2e-26   Jatropha curcas
ref|XP_010502975.1|  PREDICTED: ninja-family protein AFP3               109   3e-26   Camelina sativa [gold-of-pleasure]
gb|KDO72773.1|  hypothetical protein CISIN_1g022431mg                   110   4e-26   Citrus sinensis [Valencia orange]
ref|XP_008365427.1|  PREDICTED: ninja-family protein AFP3-like          111   4e-26   Malus domestica [apple tree]
gb|KDO72774.1|  hypothetical protein CISIN_1g022431mg                   110   4e-26   Citrus sinensis [Valencia orange]
ref|XP_006482754.1|  PREDICTED: ninja-family protein AFP3-like is...    110   8e-26   Citrus sinensis [Valencia orange]
ref|XP_006431301.1|  hypothetical protein CICLE_v10011883mg             110   8e-26   Citrus clementina
ref|XP_006431300.1|  hypothetical protein CICLE_v10011883mg             110   9e-26   Citrus clementina
ref|XP_006482758.1|  PREDICTED: ninja-family protein AFP3-like is...    110   9e-26   Citrus sinensis [Valencia orange]
ref|XP_007215559.1|  hypothetical protein PRUPE_ppa007375mg             110   1e-25   Prunus persica
ref|XP_008230885.1|  PREDICTED: ninja-family protein AFP3-like          110   1e-25   Prunus mume [ume]
ref|XP_009365923.1|  PREDICTED: ninja-family protein AFP3-like          109   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009365884.1|  PREDICTED: ninja-family protein AFP3-like          109   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_008357782.1|  PREDICTED: ninja-family protein AFP3-like          109   1e-25   Malus domestica [apple tree]
ref|XP_010514662.1|  PREDICTED: ninja-family protein AFP3-like          107   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010258036.1|  PREDICTED: ninja-family protein AFP3               109   1e-25   Nelumbo nucifera [Indian lotus]
emb|CAN77669.1|  hypothetical protein VITISV_038107                     112   2e-25   Vitis vinifera
ref|XP_009797625.1|  PREDICTED: ninja-family protein AFP3-like          108   3e-25   Nicotiana sylvestris
ref|XP_003562743.1|  PREDICTED: ninja-family protein 1-like             108   3e-25   Brachypodium distachyon [annual false brome]
dbj|BAJ90997.1|  predicted protein                                      108   3e-25   Hordeum vulgare subsp. vulgare [barley]
sp|B1B5D3.1|NNJA1_WHEAT  RecName: Full=Ninja-family protein 1; Al...    108   4e-25   Triticum aestivum [Canadian hard winter wheat]
emb|CBI21211.3|  unnamed protein product                                110   4e-25   Vitis vinifera
ref|XP_002277117.2|  PREDICTED: ninja-family protein AFP3-like          108   5e-25   Vitis vinifera
ref|XP_010425750.1|  PREDICTED: ninja-family protein AFP3               106   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004232160.1|  PREDICTED: ninja-family protein AFP3               107   6e-25   Solanum lycopersicum
emb|CDX85274.1|  BnaC07g25850D                                          106   6e-25   Brassica napus [oilseed rape]
ref|XP_003531858.1|  PREDICTED: ninja-family protein AFP2-like          107   6e-25   Glycine max [soybeans]
ref|XP_006338361.1|  PREDICTED: ninja-family protein AFP3-like          107   7e-25   Solanum tuberosum [potatoes]
ref|XP_009111795.1|  PREDICTED: ninja-family protein AFP3               106   7e-25   Brassica rapa
ref|XP_009360511.1|  PREDICTED: ninja-family protein AFP3-like          107   7e-25   Pyrus x bretschneideri [bai li]
sp|B1B5D4.1|NNJA2_WHEAT  RecName: Full=Ninja-family protein 2; Al...    107   8e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009151770.1|  PREDICTED: ninja-family protein AFP3-like          106   1e-24   Brassica rapa
ref|XP_004304226.1|  PREDICTED: ninja-family protein AFP3-like is...    107   1e-24   Fragaria vesca subsp. vesca
ref|XP_010906161.1|  PREDICTED: ninja-family protein AFP3-like is...    107   1e-24   Elaeis guineensis
ref|XP_009392469.1|  PREDICTED: ninja-family protein 2-like             107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906162.1|  PREDICTED: ninja-family protein AFP3-like is...    107   1e-24   Elaeis guineensis
ref|XP_011467882.1|  PREDICTED: ninja-family protein AFP3-like is...    107   1e-24   Fragaria vesca subsp. vesca
sp|B1B5D5.1|NNJA3_WHEAT  RecName: Full=Ninja-family protein 3; Al...    106   1e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009588665.1|  PREDICTED: ninja-family protein AFP3-like          106   1e-24   Nicotiana tomentosiformis
gb|KHN13550.1|  Ninja-family protein AFP2                               106   2e-24   Glycine soja [wild soybean]
ref|XP_003552572.2|  PREDICTED: ninja-family protein AFP2-like          106   2e-24   Glycine max [soybeans]
ref|XP_010260112.1|  PREDICTED: ninja-family protein AFP3-like          106   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007139479.1|  hypothetical protein PHAVU_008G032900g             106   2e-24   Phaseolus vulgaris [French bean]
ref|XP_006658776.1|  PREDICTED: ninja-family protein Os07g0602900...    105   3e-24   
ref|XP_009605136.1|  PREDICTED: ninja-family protein AFP3-like          105   3e-24   Nicotiana tomentosiformis
ref|XP_008791349.1|  PREDICTED: ninja-family protein AFP3               100   3e-24   
ref|XP_009764520.1|  PREDICTED: ninja-family protein AFP3-like          105   3e-24   Nicotiana sylvestris
gb|KHN14039.1|  Ninja-family protein AFP2                               105   3e-24   Glycine soja [wild soybean]
ref|XP_008805142.1|  PREDICTED: ninja-family protein AFP3-like          105   4e-24   Phoenix dactylifera
ref|XP_006291750.1|  hypothetical protein CARUB_v10017919mg             103   4e-24   Capsella rubella
dbj|BAB01982.1|  unnamed protein product                                104   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490204.1|  PREDICTED: ninja-family protein AFP1-like          105   6e-24   
gb|KEH27866.1|  ninja-family protein AFP1                               107   6e-24   Medicago truncatula
ref|XP_009416563.1|  PREDICTED: ninja-family protein AFP3-like          104   8e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939184.1|  PREDICTED: ninja-family protein Os07g0602900       104   9e-24   Elaeis guineensis
emb|CDY44386.1|  BnaA02g29910D                                          103   9e-24   Brassica napus [oilseed rape]
sp|Q6YVY6.1|NNJA2_ORYSJ  RecName: Full=Ninja-family protein Os07g...    104   9e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CDY00093.1|  BnaC09g02080D                                          103   1e-23   Brassica napus [oilseed rape]
ref|XP_006649630.1|  PREDICTED: ninja-family protein Os03g0214200...    104   1e-23   
ref|XP_007153513.1|  hypothetical protein PHAVU_003G042000g             104   1e-23   Phaseolus vulgaris [French bean]
ref|XP_003520115.1|  PREDICTED: ninja-family protein AFP2-like          104   1e-23   Glycine max [soybeans]
ref|XP_011098751.1|  PREDICTED: ninja-family protein AFP3-like is...    103   1e-23   Sesamum indicum [beniseed]
ref|XP_011098752.1|  PREDICTED: ninja-family protein AFP3-like is...    103   1e-23   Sesamum indicum [beniseed]
gb|EAZ26053.1|  hypothetical protein OsJ_09907                          103   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KHN29983.1|  Ninja-family protein AFP2                               103   2e-23   Glycine soja [wild soybean]
ref|NP_001173313.1|  Os03g0214200                                       103   2e-23   
gb|EAY89035.1|  hypothetical protein OsI_10519                          103   2e-23   Oryza sativa Indica Group [Indian rice]
emb|CDP02322.1|  unnamed protein product                                103   2e-23   Coffea canephora [robusta coffee]
ref|XP_004958230.1|  PREDICTED: ninja-family protein 3-like isofo...    103   2e-23   
gb|KDO70354.1|  hypothetical protein CISIN_1g0167841mg                99.8    2e-23   Citrus sinensis [Valencia orange]
ref|XP_007045850.1|  RNA binding protein, putative isoform 2            103   3e-23   Theobroma cacao [chocolate]
gb|KJB50518.1|  hypothetical protein B456_008G176700                    102   3e-23   Gossypium raimondii
ref|XP_010936468.1|  PREDICTED: ninja-family protein 6                  102   3e-23   Elaeis guineensis
ref|XP_009406311.1|  PREDICTED: ninja-family protein AFP3-like          102   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007045849.1|  ABI five binding protein 2, putative isoform 1     103   3e-23   Theobroma cacao [chocolate]
ref|XP_002467685.1|  hypothetical protein SORBIDRAFT_01g032370          100   4e-23   Sorghum bicolor [broomcorn]
ref|XP_011000075.1|  PREDICTED: ninja-family protein AFP3-like          102   4e-23   Populus euphratica
ref|XP_008339804.1|  PREDICTED: ninja-family protein AFP3-like        99.4    4e-23   Malus domestica [apple tree]
emb|CDY04085.1|  BnaC02g38000D                                          101   5e-23   Brassica napus [oilseed rape]
ref|XP_010228506.1|  PREDICTED: ninja-family protein Os03g0419100...    102   5e-23   
ref|XP_008810752.1|  PREDICTED: ninja-family protein 6-like             102   5e-23   Phoenix dactylifera
ref|XP_008656995.1|  PREDICTED: ninja-family protein 6-like             101   5e-23   Zea mays [maize]
ref|XP_006437917.1|  hypothetical protein CICLE_v10031813mg             102   6e-23   Citrus clementina
emb|CBI27295.3|  unnamed protein product                                102   6e-23   Vitis vinifera
ref|XP_004984009.1|  PREDICTED: ninja-family protein 6-like             102   6e-23   Setaria italica
ref|XP_009399138.1|  PREDICTED: ninja-family protein AFP3-like          102   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002274025.1|  PREDICTED: ninja-family protein AFP2 isoform X1    102   7e-23   Vitis vinifera
ref|XP_008361875.1|  PREDICTED: ninja-family protein AFP1-like          103   8e-23   
gb|KHN31942.1|  Ninja-family protein AFP2                               102   8e-23   Glycine soja [wild soybean]
ref|XP_003516385.1|  PREDICTED: ninja-family protein AFP2-like          102   8e-23   Glycine max [soybeans]
ref|XP_010228505.1|  PREDICTED: ninja-family protein Os03g0419100...    101   9e-23   Brachypodium distachyon [annual false brome]
ref|XP_004297228.1|  PREDICTED: ninja-family protein AFP2-like          100   2e-22   Fragaria vesca subsp. vesca
ref|NP_001150339.1|  ninja-family protein 6                             100   2e-22   Zea mays [maize]
ref|XP_002463155.1|  hypothetical protein SORBIDRAFT_02g038620          100   2e-22   Sorghum bicolor [broomcorn]
ref|XP_009397240.1|  PREDICTED: ninja-family protein AFP3-like          100   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411123.1|  PREDICTED: ninja-family protein AFP3-like          100   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243841.1|  PREDICTED: ninja-family protein AFP3               100   3e-22   Prunus mume [ume]
ref|XP_006348683.1|  PREDICTED: ninja-family protein AFP3-like          100   3e-22   Solanum tuberosum [potatoes]
ref|XP_002324118.2|  hypothetical protein POPTR_0017s13000g             100   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007223056.1|  hypothetical protein PRUPE_ppa006974mg             100   3e-22   Prunus persica
gb|EYU34604.1|  hypothetical protein MIMGU_mgv1a010027mg              99.8    4e-22   Erythranthe guttata [common monkey flower]
gb|EPS72568.1|  hypothetical protein M569_02189                       94.7    4e-22   Genlisea aurea
ref|XP_010320856.1|  PREDICTED: ninja-family protein AFP3               100   4e-22   Solanum lycopersicum
ref|XP_010091583.1|  hypothetical protein L484_026430                 99.8    4e-22   Morus notabilis
gb|AGT16625.1|  hypothetical protein SHCRBa_261_H05_F_190             99.4    5e-22   Saccharum hybrid cultivar R570
gb|KEH21656.1|  ABI five-binding protein                              99.4    6e-22   Medicago truncatula
ref|XP_010066842.1|  PREDICTED: ninja-family protein AFP3-like        93.6    9e-22   Eucalyptus grandis [rose gum]
gb|KJB80382.1|  hypothetical protein B456_013G094600                  98.6    9e-22   Gossypium raimondii
gb|KHG14342.1|  Ninja-family protein AFP3                             98.2    1e-21   Gossypium arboreum [tree cotton]
emb|CDP00441.1|  unnamed protein product                              99.0    1e-21   Coffea canephora [robusta coffee]
gb|EAY90484.1|  hypothetical protein OsI_12072                        98.2    1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001050378.1|  Os03g0419100                                     98.2    1e-21   
gb|EAZ27349.1|  hypothetical protein OsJ_11293                        97.8    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416832.1|  PREDICTED: ninja-family protein AFP3-like        97.8    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009623485.1|  PREDICTED: ninja-family protein AFP2-like is...  97.8    2e-21   Nicotiana tomentosiformis
ref|XP_009394318.1|  PREDICTED: ninja-family protein 6-like           97.4    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396433.1|  PREDICTED: ninja-family protein 6-like           97.4    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHA43418.1|  ninja-family protein AFP1-like protein                98.6    3e-21   Solanum nigrum
ref|XP_009623484.1|  PREDICTED: ninja-family protein AFP1-like is...  97.4    3e-21   Nicotiana tomentosiformis
ref|NP_001147185.1|  ninja-family protein 5                           97.1    3e-21   Zea mays [maize]
ref|XP_008350890.1|  PREDICTED: ninja-family protein AFP3-like        97.8    3e-21   Malus domestica [apple tree]
ref|XP_008389402.1|  PREDICTED: ninja-family protein AFP3-like        97.4    3e-21   Malus domestica [apple tree]
gb|KCW64879.1|  hypothetical protein EUGRSUZ_G02444                   97.4    4e-21   Eucalyptus grandis [rose gum]
ref|XP_009356414.1|  PREDICTED: ninja-family protein AFP3             97.1    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_010527971.1|  PREDICTED: ninja-family protein AFP2             96.7    5e-21   Tarenaya hassleriana [spider flower]
ref|XP_011085686.1|  PREDICTED: ninja-family protein AFP3-like        96.3    6e-21   Sesamum indicum [beniseed]
ref|XP_010923621.1|  PREDICTED: ninja-family protein AFP3             95.9    7e-21   Elaeis guineensis
ref|XP_011009405.1|  PREDICTED: ninja-family protein AFP3-like        96.3    8e-21   Populus euphratica
ref|XP_010680683.1|  PREDICTED: ninja-family protein AFP1             97.1    9e-21   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002512070.1|  RNA binding protein, putative                    95.9    1e-20   Ricinus communis
ref|XP_009760153.1|  PREDICTED: ninja-family protein AFP1-like is...  95.9    1e-20   Nicotiana sylvestris
ref|XP_009760154.1|  PREDICTED: ninja-family protein AFP1-like is...  95.9    1e-20   Nicotiana sylvestris
ref|XP_010550299.1|  PREDICTED: ninja-family protein AFP1-like        92.4    1e-20   Tarenaya hassleriana [spider flower]
gb|EMS53692.1|  hypothetical protein TRIUR3_09869                     94.7    1e-20   Triticum urartu
ref|XP_008446443.1|  PREDICTED: ninja-family protein AFP3-like        95.1    2e-20   Cucumis melo [Oriental melon]
ref|XP_004237223.1|  PREDICTED: ninja-family protein AFP3 isoform X1  95.1    2e-20   Solanum lycopersicum
gb|KDP41313.1|  hypothetical protein JCGZ_15720                       94.7    2e-20   Jatropha curcas
ref|XP_004135434.1|  PREDICTED: ninja-family protein AFP1-like        95.1    3e-20   Cucumis sativus [cucumbers]
ref|XP_009592703.1|  PREDICTED: ninja-family protein AFP3-like is...  95.5    3e-20   Nicotiana tomentosiformis
ref|XP_004165617.1|  PREDICTED: ninja-family protein AFP1-like        95.1    3e-20   
ref|XP_004489525.1|  PREDICTED: ninja-family protein AFP3-like        94.7    3e-20   Cicer arietinum [garbanzo]
emb|CBW38448.1|  ABA responsive protein                               90.1    4e-20   Helianthus annuus
ref|XP_006845867.1|  hypothetical protein AMTR_s00154p00057990        90.9    4e-20   
ref|XP_009407390.1|  PREDICTED: ninja-family protein AFP3-like        94.0    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011011869.1|  PREDICTED: ninja-family protein AFP2-like        94.0    4e-20   Populus euphratica
ref|XP_011101763.1|  PREDICTED: ninja-family protein AFP1-like        95.1    4e-20   Sesamum indicum [beniseed]
ref|XP_010044396.1|  PREDICTED: ninja-family protein AFP3-like        93.6    5e-20   Eucalyptus grandis [rose gum]
ref|XP_006379694.1|  hypothetical protein POPTR_0008s09620g           93.6    6e-20   Populus trichocarpa [western balsam poplar]
gb|EMT13868.1|  hypothetical protein F775_31150                       94.0    7e-20   Aegilops tauschii
ref|XP_002306022.2|  hypothetical protein POPTR_0004s11980g           93.6    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009779157.1|  PREDICTED: ninja-family protein AFP3-like        94.0    8e-20   Nicotiana sylvestris
gb|AGT16981.1|  Protein of unknown function DUF1675                   92.8    9e-20   Saccharum hybrid cultivar R570
gb|EYU28869.1|  hypothetical protein MIMGU_mgv1a008006mg              93.6    9e-20   Erythranthe guttata [common monkey flower]
ref|XP_011018739.1|  PREDICTED: ninja-family protein AFP2-like        92.4    2e-19   Populus euphratica
gb|AAR06258.1|  ABRC5                                                 89.4    2e-19   Helianthus annuus
ref|XP_011102058.1|  PREDICTED: ninja-family protein AFP3-like        92.0    2e-19   Sesamum indicum [beniseed]
ref|XP_002465644.1|  hypothetical protein SORBIDRAFT_01g042880        92.4    3e-19   Sorghum bicolor [broomcorn]
ref|XP_006302500.1|  hypothetical protein CARUB_v10020599mg           91.7    3e-19   Capsella rubella
gb|AGT15870.1|  hypothetical protein SHCRBa_252_E12_R_390             92.0    3e-19   Saccharum hybrid cultivar R570
gb|AGT16721.1|  hypothetical protein SHCRBa_127_L16_F_40              92.0    3e-19   Saccharum hybrid cultivar R570
gb|AGT16149.1|  ABI five biding protein 3                             91.7    4e-19   Saccharum hybrid cultivar R570
ref|XP_008785998.1|  PREDICTED: ninja-family protein AFP3-like        90.9    5e-19   
ref|XP_009105006.1|  PREDICTED: ninja-family protein AFP1-like        90.5    7e-19   Brassica rapa
emb|CDY07354.1|  BnaA07g24330D                                        90.5    7e-19   Brassica napus [oilseed rape]
ref|XP_004985196.1|  PREDICTED: ninja-family protein 1-like           90.9    7e-19   Setaria italica
ref|XP_010511949.1|  PREDICTED: ninja-family protein AFP1-like        90.5    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010415560.1|  PREDICTED: ninja-family protein AFP1-like        90.5    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010470901.1|  PREDICTED: ninja-family protein AFP1-like        90.5    9e-19   Camelina sativa [gold-of-pleasure]
emb|CDY04272.1|  BnaC06g25430D                                        90.1    1e-18   Brassica napus [oilseed rape]
ref|XP_010495560.1|  PREDICTED: ninja-family protein AFP2             90.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|NP_564956.1|  ABI five binding protein                            90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67141.1|  unknown                                               90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476399.1|  PREDICTED: ninja-family protein AFP2-like        90.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010458838.1|  PREDICTED: ninja-family protein AFP2-like        90.1    1e-18   Camelina sativa [gold-of-pleasure]
gb|AAL07175.1|  unknown protein                                       90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52486.1|AC018364_4  unknown protein; 57564-56338                89.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563933.1|  ABI five binding protein 2                          90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417093.1|  hypothetical protein EUTSA_v10008099mg           89.7    2e-18   Eutrema salsugineum
emb|CDY33807.1|  BnaA09g46130D                                        89.4    2e-18   Brassica napus [oilseed rape]
ref|XP_009117975.1|  PREDICTED: ninja-family protein AFP2-like        89.4    2e-18   Brassica rapa
ref|XP_002890019.1|  hypothetical protein ARALYDRAFT_471533           89.4    2e-18   Arabidopsis lyrata subsp. lyrata
emb|CDY16104.1|  BnaC08g40190D                                        89.4    2e-18   Brassica napus [oilseed rape]
ref|XP_006305186.1|  hypothetical protein CARUB_v10009552mg           89.4    2e-18   Capsella rubella
ref|XP_011070935.1|  PREDICTED: ninja-family protein AFP2-like        89.0    3e-18   Sesamum indicum [beniseed]
gb|EEC82402.1|  hypothetical protein OsI_26773                        87.8    5e-18   Oryza sativa Indica Group [Indian rice]
gb|KFK41350.1|  hypothetical protein AALP_AA2G118900                  87.8    6e-18   Arabis alpina [alpine rockcress]
ref|XP_006391038.1|  hypothetical protein EUTSA_v10018761mg           88.2    6e-18   Eutrema salsugineum
ref|XP_004231691.1|  PREDICTED: ninja-family protein AFP3-like        87.4    6e-18   Solanum lycopersicum
ref|XP_004231669.2|  PREDICTED: ninja-family protein AFP3-like        87.0    9e-18   Solanum lycopersicum
ref|XP_010315690.1|  PREDICTED: ninja-family protein AFP3-like        86.3    1e-17   Solanum lycopersicum
ref|XP_002887227.1|  hypothetical protein ARALYDRAFT_894706           87.0    1e-17   Arabidopsis lyrata subsp. lyrata
emb|CDY40905.1|  BnaC06g30430D                                        86.3    3e-17   Brassica napus [oilseed rape]
ref|XP_007037582.1|  RNA binding-like protein                         87.8    3e-17   Theobroma cacao [chocolate]
ref|XP_010315753.1|  PREDICTED: ninja-family protein AFP3-like        85.5    4e-17   Solanum lycopersicum
ref|XP_010317361.1|  PREDICTED: ninja-family protein AFP3-like        85.5    5e-17   Solanum lycopersicum
ref|XP_009148664.1|  PREDICTED: ninja-family protein AFP2             84.7    6e-17   Brassica rapa
emb|CDX98125.1|  BnaA06g08760D                                        84.3    1e-16   Brassica napus [oilseed rape]
dbj|BAJ98416.1|  predicted protein                                    85.5    1e-16   Hordeum vulgare subsp. vulgare [barley]
emb|CDY36406.1|  BnaC05g10070D                                        84.3    1e-16   Brassica napus [oilseed rape]
ref|XP_003522990.1|  PREDICTED: ninja-family protein AFP3-like is...  84.0    1e-16   Glycine max [soybeans]
sp|B6SLJ0.1|NNJA3_MAIZE  RecName: Full=Ninja-family protein 3         84.0    1e-16   Zea mays [maize]
gb|KHN17830.1|  Ninja-family protein AFP3                             83.6    1e-16   Glycine soja [wild soybean]
gb|ACN33721.1|  unknown                                               83.6    1e-16   Zea mays [maize]
ref|XP_006578537.1|  PREDICTED: ninja-family protein AFP3-like is...  83.6    1e-16   Glycine max [soybeans]
ref|NP_001161740.1|  hypothetical protein LOC100192929 isoform 2      83.6    1e-16   Zea mays [maize]
ref|NP_001161741.1|  hypothetical protein LOC100192929 isoform 3      83.6    1e-16   Zea mays [maize]
ref|XP_003527115.1|  PREDICTED: ninja-family protein AFP3-like is...  83.6    2e-16   Glycine max [soybeans]
gb|ACU23969.1|  unknown                                               83.6    2e-16   Glycine max [soybeans]
ref|XP_006582022.1|  PREDICTED: ninja-family protein AFP3-like is...  83.2    2e-16   Glycine max [soybeans]
gb|EMT27031.1|  hypothetical protein F775_13020                       81.3    2e-16   Aegilops tauschii
gb|KEH18131.1|  ninja-family protein AFP1                             83.2    2e-16   Medicago truncatula
ref|XP_010105505.1|  hypothetical protein L484_007123                 82.8    3e-16   Morus notabilis
ref|XP_003599003.1|  hypothetical protein MTR_3g025970                80.1    4e-16   
ref|XP_007138357.1|  hypothetical protein PHAVU_009G202000g           82.0    5e-16   Phaseolus vulgaris [French bean]
ref|XP_008658076.1|  PREDICTED: hypothetical protein LOC100192929...  83.2    5e-16   Zea mays [maize]
ref|NP_001131584.1|  hypothetical protein LOC100192929 isoform 1      83.2    5e-16   Zea mays [maize]
ref|XP_002514649.1|  RNA binding protein, putative                    80.5    5e-16   
ref|XP_004510250.1|  PREDICTED: uncharacterized protein LOC101492383  82.4    6e-16   Cicer arietinum [garbanzo]
ref|XP_006848485.1|  hypothetical protein AMTR_s00013p00255370        84.0    7e-16   Amborella trichopoda
gb|AES69254.2|  ninja-family protein AFP1                             81.3    8e-16   Medicago truncatula
ref|XP_007049691.1|  UPF0737 protein AFP3, putative                   83.2    9e-16   Theobroma cacao [chocolate]
ref|XP_008240010.1|  PREDICTED: ninja-family protein 1-like           81.3    9e-16   Prunus mume [ume]
gb|KDP26350.1|  hypothetical protein JCGZ_17508                       82.8    1e-15   Jatropha curcas
ref|XP_004499859.1|  PREDICTED: ninja-family protein AFP3-like        80.5    1e-15   Cicer arietinum [garbanzo]
ref|XP_007208775.1|  hypothetical protein PRUPE_ppa023628mg           80.9    1e-15   Prunus persica
emb|CDX95951.1|  BnaA07g27800D                                        81.3    2e-15   Brassica napus [oilseed rape]
ref|XP_009105470.1|  PREDICTED: ninja-family protein AFP1             80.9    2e-15   Brassica rapa
ref|XP_007134133.1|  hypothetical protein PHAVU_010G022000g           81.3    2e-15   Phaseolus vulgaris [French bean]
gb|EYU44202.1|  hypothetical protein MIMGU_mgv1a011530mg              80.1    2e-15   Erythranthe guttata [common monkey flower]
gb|KHN27321.1|  Ninja-family protein AFP3                             80.5    2e-15   Glycine soja [wild soybean]
ref|XP_002531097.1|  hypothetical protein RCOM_1417730                82.8    2e-15   
gb|KJB50707.1|  hypothetical protein B456_008G199500                  79.7    3e-15   Gossypium raimondii
gb|KDO65985.1|  hypothetical protein CISIN_1g011821mg                 82.0    3e-15   Citrus sinensis [Valencia orange]
ref|XP_003520982.1|  PREDICTED: ninja-family protein AFP2-like        80.5    3e-15   Glycine max [soybeans]
gb|KJB50705.1|  hypothetical protein B456_008G199500                  80.1    3e-15   Gossypium raimondii
ref|XP_008450871.1|  PREDICTED: ninja-family protein 6-like isofo...  79.7    4e-15   Cucumis melo [Oriental melon]
ref|XP_008450949.1|  PREDICTED: ninja-family protein 6-like isofo...  79.7    4e-15   Cucumis melo [Oriental melon]
gb|KHG19654.1|  Ninja-family protein AFP3                             79.7    4e-15   Gossypium arboreum [tree cotton]
gb|KJB42530.1|  hypothetical protein B456_007G156700                  80.9    5e-15   Gossypium raimondii
ref|XP_004231689.1|  PREDICTED: ninja-family protein AFP3-like        79.3    5e-15   Solanum lycopersicum
ref|XP_010906183.1|  PREDICTED: ninja-family protein AFP3-like        77.8    5e-15   Elaeis guineensis
ref|XP_004137434.1|  PREDICTED: ninja-family protein AFP2-like        79.3    7e-15   
ref|XP_006443552.1|  hypothetical protein CICLE_v10019961mg           80.5    9e-15   Citrus clementina
ref|XP_002884637.1|  hypothetical protein ARALYDRAFT_340917           78.2    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_009614852.1|  PREDICTED: ninja-family protein 3-like           79.0    1e-14   Nicotiana tomentosiformis
emb|CDP03912.1|  unnamed protein product                              80.5    1e-14   Coffea canephora [robusta coffee]
ref|XP_010317133.1|  PREDICTED: ninja-family protein AFP3-like        76.3    1e-14   Solanum lycopersicum
ref|XP_002438161.1|  hypothetical protein SORBIDRAFT_10g008970        79.0    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010274057.1|  PREDICTED: uncharacterized protein LOC104609435  80.1    1e-14   Nelumbo nucifera [Indian lotus]
emb|CAN68929.1|  hypothetical protein VITISV_044375                   80.9    1e-14   Vitis vinifera
emb|CBI25670.3|  unnamed protein product                              77.4    2e-14   Vitis vinifera
ref|XP_004290175.1|  PREDICTED: ninja-family protein AFP2-like        78.6    2e-14   Fragaria vesca subsp. vesca
gb|KHG16149.1|  Ninja-family protein AFP3                             79.0    2e-14   Gossypium arboreum [tree cotton]
gb|KDP31355.1|  hypothetical protein JCGZ_11731                       77.0    2e-14   Jatropha curcas
gb|KJB10904.1|  hypothetical protein B456_001G231200                  79.0    3e-14   Gossypium raimondii
ref|XP_010464339.1|  PREDICTED: ninja-family protein AFP1-like        77.0    3e-14   Camelina sativa [gold-of-pleasure]
emb|CBI15312.3|  unnamed protein product                              80.1    3e-14   Vitis vinifera
ref|XP_008792918.1|  PREDICTED: uncharacterized protein LOC103709393  79.0    3e-14   Phoenix dactylifera
ref|XP_010104165.1|  hypothetical protein L484_007004                 78.2    5e-14   Morus notabilis
gb|KFK38175.1|  hypothetical protein AALP_AA3G079100                  76.3    5e-14   Arabis alpina [alpine rockcress]
ref|XP_008235433.1|  PREDICTED: AFP homolog 2                         77.8    6e-14   Prunus mume [ume]
ref|XP_002862294.1|  predicted protein                                76.3    6e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_002271712.2|  PREDICTED: ninja-family protein AFP1-like        77.4    6e-14   Vitis vinifera
ref|XP_009372621.1|  PREDICTED: ninja-family protein 1-like           75.5    6e-14   Pyrus x bretschneideri [bai li]
gb|KHN24813.1|  Ninja-family protein AFP3                             77.0    6e-14   Glycine soja [wild soybean]
ref|XP_003547791.1|  PREDICTED: ninja-family protein AFP2-like        77.0    6e-14   Glycine max [soybeans]
ref|XP_007199261.1|  hypothetical protein PRUPE_ppa022619mg           77.4    7e-14   Prunus persica
dbj|BAK08070.1|  predicted protein                                    77.0    1e-13   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009372227.1|  PREDICTED: ninja-family protein 2-like           76.6    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_008346212.1|  PREDICTED: ninja-family protein Os03g0419100...  76.3    2e-13   Malus domestica [apple tree]
emb|CDY08008.1|  BnaC03g35150D                                        74.7    2e-13   Brassica napus [oilseed rape]
ref|XP_004231670.1|  PREDICTED: ninja-family protein AFP3-like        74.3    2e-13   
gb|AAF20221.1|AC012395_8  putative RNA-binding protein                77.0    3e-13   
ref|XP_010663438.1|  PREDICTED: extensin-like                         75.9    3e-13   
ref|NP_187381.2|  nuclear transport factor 2 and RNA recognition ...  77.0    3e-13   
emb|CDY34910.1|  BnaA01g32410D                                        73.9    3e-13   
ref|XP_006299766.1|  hypothetical protein CARUB_v10015962mg           76.3    5e-13   
ref|XP_010418109.1|  PREDICTED: uncharacterized protein LOC104703731  76.6    5e-13   
gb|KDO65719.1|  hypothetical protein CISIN_1g038750mg                 73.2    5e-13   
ref|XP_006579502.1|  PREDICTED: ninja-family protein Os03g0419100...  73.6    6e-13   
ref|XP_006579503.1|  PREDICTED: ninja-family protein Os03g0419100...  73.6    6e-13   
gb|KHN48747.1|  Ninja-family protein AFP3                             70.5    6e-13   
ref|XP_010486270.1|  PREDICTED: ninja-family protein AFP3-like        73.6    6e-13   
ref|XP_011089064.1|  PREDICTED: AFP homolog 2-like                    74.7    8e-13   
ref|XP_010547110.1|  PREDICTED: ninja-family protein Os03g0419100     73.9    9e-13   
ref|XP_006440767.1|  hypothetical protein CICLE_v10021061mg           73.6    1e-12   
ref|XP_008374952.1|  PREDICTED: ninja-family protein Os03g0419100...  72.8    1e-12   
ref|XP_009787345.1|  PREDICTED: ninja-family protein Os03g0419100...  73.6    1e-12   
emb|CDX74054.1|  BnaA03g29930D                                        72.4    1e-12   
ref|XP_004301111.1|  PREDICTED: ninja-family protein 3-like           71.6    2e-12   
ref|XP_010045600.1|  PREDICTED: ninja-family protein 1-like           73.9    2e-12   
ref|XP_009134956.1|  PREDICTED: ninja-family protein 6                72.0    2e-12   
ref|XP_010905136.1|  PREDICTED: uncharacterized protein LOC105032389  73.2    3e-12   
ref|XP_008382772.1|  PREDICTED: uncharacterized protein LOC103445531  73.2    3e-12   
ref|XP_008794639.1|  PREDICTED: uncharacterized protein LOC103710605  72.8    3e-12   
ref|XP_010463607.1|  PREDICTED: ninja-family protein AFP4-like        71.6    3e-12   
ref|XP_009124452.1|  PREDICTED: ninja-family protein AFP3-like        71.2    3e-12   
gb|KGN58375.1|  hypothetical protein Csa_3G633290                     71.2    3e-12   
ref|XP_002884305.1|  two or more abres-containing gene 2              70.9    7e-12   
ref|XP_010485451.1|  PREDICTED: ninja-family protein AFP4-like        70.9    7e-12   
ref|XP_010448534.1|  PREDICTED: ninja-family protein AFP4-like        70.5    7e-12   
ref|XP_010045601.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  72.0    8e-12   
ref|XP_010317131.1|  PREDICTED: ninja-family protein AFP2-like        68.6    9e-12   
ref|XP_010317132.1|  PREDICTED: ninja-family protein AFP3-like        68.6    1e-11   
ref|XP_004162648.1|  PREDICTED: ninja-family protein AFP3-like        70.1    1e-11   
gb|EPS61358.1|  hypothetical protein M569_13439                       66.6    1e-11   
ref|XP_006352677.1|  PREDICTED: ninja-family protein AFP3-like        69.3    1e-11   
ref|XP_009347966.1|  PREDICTED: ninja-family protein 6-like           69.7    1e-11   
gb|KFK37674.1|  hypothetical protein AALP_AA3G013800                  69.3    2e-11   
emb|CDY68672.1|  BnaA05g37500D                                        69.3    2e-11   
ref|XP_009147379.1|  PREDICTED: ninja-family protein AFP4             69.3    2e-11   
ref|NP_566163.1|  Ninja-family protein AFP4                           69.7    2e-11   
ref|XP_009339605.1|  PREDICTED: ninja-family protein Os03g0419100...  69.7    2e-11   
ref|XP_010549993.1|  PREDICTED: ninja-family protein AFP4             68.9    3e-11   
ref|XP_009347958.1|  PREDICTED: ninja-family protein AFP3-like        68.9    3e-11   
ref|XP_009412728.1|  PREDICTED: ninja-family protein Os07g0602900...  69.7    3e-11   
ref|XP_004231690.1|  PREDICTED: ninja-family protein AFP3-like        66.2    5e-11   
ref|XP_002989654.1|  hypothetical protein SELMODRAFT_447751           69.7    6e-11   
ref|XP_002986103.1|  hypothetical protein SELMODRAFT_446487           69.7    6e-11   
ref|XP_010696260.1|  PREDICTED: ninja-family protein 3-like           68.9    7e-11   
ref|XP_010069628.1|  PREDICTED: ninja-family protein Os07g0602900     68.9    8e-11   
ref|XP_008393370.1|  PREDICTED: ninja-family protein AFP3-like        65.1    8e-11   
ref|XP_010315660.1|  PREDICTED: ninja-family protein AFP3-like        65.9    8e-11   
emb|CDY43256.1|  BnaC05g48490D                                        67.4    8e-11   
ref|XP_011089656.1|  PREDICTED: uncharacterized protein LOC105170552  68.9    8e-11   
ref|XP_006299473.1|  hypothetical protein CARUB_v10015638mg           67.8    8e-11   
ref|XP_008351896.1|  PREDICTED: ninja-family protein Os03g0419100...  66.6    1e-10   
ref|XP_006408444.1|  hypothetical protein EUTSA_v10021165mg           67.4    1e-10   
gb|ABK26057.1|  unknown                                               65.5    1e-10   
gb|EYU40630.1|  hypothetical protein MIMGU_mgv1a021447mg              64.3    2e-10   
ref|XP_010315661.1|  PREDICTED: ninja-family protein AFP3-like is...  64.7    2e-10   
ref|XP_004231671.1|  PREDICTED: ninja-family protein AFP3-like is...  65.1    2e-10   
ref|XP_009797015.1|  PREDICTED: uncharacterized protein LOC104243513  66.2    3e-10   
ref|XP_010315754.1|  PREDICTED: ninja-family protein AFP3-like        63.2    7e-10   
ref|XP_001779397.1|  predicted protein                                65.5    2e-09   
gb|ACN30588.1|  unknown                                               64.3    2e-09   
ref|XP_009134646.1|  PREDICTED: ninja-family protein AFP4-like        63.2    3e-09   
emb|CDX74273.1|  BnaA03g27740D                                        63.2    3e-09   
ref|XP_009629107.1|  PREDICTED: ninja-family protein 2-like           63.5    3e-09   
ref|XP_008352847.1|  PREDICTED: ninja-family protein AFP3-like        62.4    6e-09   
ref|XP_004231602.1|  PREDICTED: ninja-family protein AFP1-like        60.8    7e-09   
ref|XP_001782651.1|  predicted protein                                63.5    9e-09   
ref|XP_010315657.1|  PREDICTED: ninja-family protein AFP3-like is...  60.1    1e-08   
ref|XP_010315659.1|  PREDICTED: ninja-family protein Os07g0602900...  59.3    1e-08   
ref|XP_010315658.1|  PREDICTED: ninja-family protein Os07g0602900...  58.5    2e-08   
emb|CDX91976.1|  BnaC03g32780D                                        60.1    3e-08   
gb|KHN18361.1|  Ninja-family protein AFP3                             55.5    4e-07   
ref|XP_010315691.1|  PREDICTED: ninja-family protein Os03g0214200...  54.7    4e-07   
dbj|BAJ91403.1|  predicted protein                                    54.7    7e-07   
ref|XP_006600584.1|  PREDICTED: ninja-family protein AFP3-like is...  55.8    7e-07   
ref|XP_006600585.1|  PREDICTED: ninja-family protein AFP3-like is...  55.8    7e-07   
ref|XP_006600582.1|  PREDICTED: ninja-family protein AFP3-like is...  55.8    8e-07   
ref|XP_006600583.1|  PREDICTED: ninja-family protein AFP3-like is...  55.8    9e-07   
ref|XP_008777907.1|  PREDICTED: ninja-family protein AFP3-like        55.8    1e-06   
dbj|BAD26583.1|  RNA-binding protein                                  51.6    4e-06   
emb|CBI28024.3|  unnamed protein product                              52.0    1e-05   
ref|XP_010656282.1|  PREDICTED: ninja-family protein mc410 isofor...  52.8    3e-05   
ref|XP_002283979.1|  PREDICTED: ninja-family protein mc410 isofor...  52.8    3e-05   
gb|EYU30732.1|  hypothetical protein MIMGU_mgv1a006501mg              52.0    3e-05   
ref|XP_011078285.1|  PREDICTED: ninja-family protein mc410            52.0    4e-05   
gb|AFG59973.1|  hypothetical protein 0_6449_01                        49.7    4e-05   
ref|XP_010249603.1|  PREDICTED: ninja-family protein mc410            51.6    6e-05   
ref|XP_006451247.1|  hypothetical protein CICLE_v10008049mg           50.8    9e-05   
ref|XP_002514251.1|  conserved hypothetical protein                   50.8    1e-04   
gb|AFG59977.1|  hypothetical protein 0_6449_01                        48.1    1e-04   
gb|KHG17837.1|  Ninja-family protein                                  49.7    2e-04   
ref|XP_006338155.1|  PREDICTED: ninja-family protein mc410-like i...  49.7    2e-04   
ref|XP_004239269.1|  PREDICTED: ninja-family protein mc410            49.7    2e-04   
ref|XP_009415225.1|  PREDICTED: ninja-family protein 7-like           49.7    2e-04   
ref|XP_009392413.1|  PREDICTED: ninja-family protein Os05g0558800...  49.3    3e-04   
ref|XP_011045446.1|  PREDICTED: ninja-family protein mc410-like i...  49.3    3e-04   
ref|XP_004287452.1|  PREDICTED: ninja-family protein mc410            49.3    3e-04   
ref|XP_011048351.1|  PREDICTED: ninja-family protein mc410            49.3    3e-04   
ref|XP_011045445.1|  PREDICTED: ninja-family protein mc410-like i...  49.3    3e-04   
ref|XP_011045442.1|  PREDICTED: ninja-family protein mc410-like i...  49.3    3e-04   
ref|XP_006389458.1|  hypothetical protein POPTR_0024s00450g           48.9    3e-04   
gb|KDP32541.1|  hypothetical protein JCGZ_14753                       48.1    4e-04   
gb|KDP33720.1|  hypothetical protein JCGZ_07291                       48.9    4e-04   
gb|KDP46171.1|  hypothetical protein JCGZ_06682                       48.1    4e-04   
ref|XP_008390569.1|  PREDICTED: ninja-family protein mc410            48.5    4e-04   
ref|XP_007152895.1|  hypothetical protein PHAVU_004G169100g           48.9    4e-04   
emb|CDX92901.1|  BnaC07g41590D                                        48.5    4e-04   
ref|XP_009129148.1|  PREDICTED: AFP homolog 2 isoform X1              48.5    5e-04   
ref|XP_009129161.1|  PREDICTED: AFP homolog 2 isoform X2              48.5    5e-04   
ref|XP_006412898.1|  hypothetical protein EUTSA_v10025262mg           48.5    5e-04   
ref|XP_006283796.1|  hypothetical protein CARUB_v10004886mg           48.5    6e-04   
ref|XP_002867433.1|  hypothetical protein ARALYDRAFT_491865           48.5    6e-04   
ref|NP_194620.1|  novel interactor of JAZ                             48.5    6e-04   
ref|XP_010540975.1|  PREDICTED: AFP homolog 2-like isoform X2         48.1    6e-04   
emb|CDY50931.1|  BnaA03g59090D                                        48.5    6e-04   
gb|AAK96863.1|  putative protein                                      48.5    6e-04   
ref|XP_010540972.1|  PREDICTED: AFP homolog 2-like isoform X1         48.1    6e-04   
ref|XP_009137815.1|  PREDICTED: AFP homolog 2-like                    48.1    6e-04   
emb|CDY06858.1|  BnaC01g09570D                                        48.5    6e-04   
ref|XP_010438370.1|  PREDICTED: AFP homolog 2-like                    48.1    6e-04   
ref|XP_009779745.1|  PREDICTED: ninja-family protein mc410            48.5    6e-04   
ref|XP_009586636.1|  PREDICTED: ninja-family protein mc410            48.5    6e-04   
sp|Q53HY2.1|NINJA_TOBAC  RecName: Full=Ninja-family protein mc410     48.5    6e-04   
emb|CDY35233.1|  BnaA01g07980D                                        48.1    6e-04   
ref|XP_010548698.1|  PREDICTED: AFP homolog 2-like isoform X2         48.1    6e-04   
ref|XP_010548697.1|  PREDICTED: AFP homolog 2-like isoform X1         48.1    7e-04   
ref|XP_002325016.1|  hypothetical protein POPTR_0018s09210g           48.1    8e-04   
ref|XP_008458598.1|  PREDICTED: ninja-family protein mc410            48.1    8e-04   
ref|XP_010102745.1|  hypothetical protein L484_000007                 46.6    8e-04   
ref|XP_008374876.1|  PREDICTED: ninja-family protein mc410-like       48.1    9e-04   
ref|XP_009352522.1|  PREDICTED: ninja-family protein mc410            48.1    9e-04   
ref|XP_004139437.1|  PREDICTED: ninja-family protein mc410-like       47.8    9e-04   
ref|XP_008462697.1|  PREDICTED: ninja-family protein mc410-like       47.8    0.001   
ref|XP_003517065.1|  PREDICTED: ninja-family protein mc410-like i...  47.8    0.001   



>ref|XP_010528407.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
 ref|XP_010528409.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
 ref|XP_010528410.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
Length=313

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS L 
Sbjct  257  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPLM  313



>ref|XP_010089637.1| hypothetical protein L484_021030 [Morus notabilis]
 gb|EXB38108.1| hypothetical protein L484_021030 [Morus notabilis]
Length=355

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P+  F
Sbjct  299  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPASFF  355



>gb|KJB33416.1| hypothetical protein B456_006G010000 [Gossypium raimondii]
Length=342

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+VSPS +F
Sbjct  286  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVSPSFIF  342



>ref|XP_007032759.1| ABI five binding protein 3, putative [Theobroma cacao]
 gb|EOY03685.1| ABI five binding protein 3, putative [Theobroma cacao]
Length=352

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVA PLKHI+V+PS LF
Sbjct  296  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAQPLKHIVVNPSFLF  352



>ref|XP_006395274.1| hypothetical protein EUTSA_v10004771mg [Eutrema salsugineum]
 gb|ESQ32560.1| hypothetical protein EUTSA_v10004771mg [Eutrema salsugineum]
Length=268

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  212  GKKIDGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  265



>gb|KHG26156.1| Ninja-family protein AFP2 [Gossypium arboreum]
Length=342

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+VSPS +F
Sbjct  286  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVSPSFIF  342



>ref|NP_189598.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 ref|NP_001030794.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 ref|NP_001078222.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 sp|Q94F39.1|AFP3_ARATH RecName: Full=Ninja-family protein AFP3; AltName: Full=ABI five-binding 
protein 3; Short=ABI5-binding protein 3 [Arabidopsis 
thaliana]
 gb|AAK60331.1|AF385741_1 AT3g29575/MWE13_2 [Arabidopsis thaliana]
 gb|AAM91506.1| AT3g29575/MWE13_2 [Arabidopsis thaliana]
 dbj|BAH20080.1| AT3G29575 [Arabidopsis thaliana]
 gb|AEE77588.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 gb|AEE77589.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 gb|AEE77590.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
Length=231

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  175  GKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  228



>ref|XP_002527618.1| hypothetical protein RCOM_1025320 [Ricinus communis]
 gb|EEF34757.1| hypothetical protein RCOM_1025320 [Ricinus communis]
Length=133

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  77   GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  129



>gb|KDP27248.1| hypothetical protein JCGZ_19947 [Jatropha curcas]
Length=393

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+VSP  L 
Sbjct  337  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVSPYPLL  393



>ref|XP_010502975.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
 ref|XP_010502976.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
Length=237

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG DVAHPLKHI+V+PS
Sbjct  181  GKKIDGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVVNPS  234



>gb|KDO72773.1| hypothetical protein CISIN_1g022431mg [Citrus sinensis]
Length=268

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  212  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  264



>ref|XP_008365427.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=358

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+VSPS L 
Sbjct  302  GKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVSPSPLL  358



>gb|KDO72774.1| hypothetical protein CISIN_1g022431mg [Citrus sinensis]
Length=297

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  241  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  293



>ref|XP_006482754.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482755.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006482756.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006482757.1| PREDICTED: ninja-family protein AFP3-like isoform X4 [Citrus 
sinensis]
Length=403

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  347  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  399



>ref|XP_006431301.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 ref|XP_006431302.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44541.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44542.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
Length=403

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  347  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  399



>ref|XP_006431300.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44540.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
Length=374

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  318  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  370



>ref|XP_006482758.1| PREDICTED: ninja-family protein AFP3-like isoform X5 [Citrus 
sinensis]
Length=374

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P
Sbjct  318  GKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP  370



>ref|XP_007215559.1| hypothetical protein PRUPE_ppa007375mg [Prunus persica]
 gb|EMJ16758.1| hypothetical protein PRUPE_ppa007375mg [Prunus persica]
Length=370

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  314  GKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  367



>ref|XP_008230885.1| PREDICTED: ninja-family protein AFP3-like [Prunus mume]
Length=365

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  309  GKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  362



>ref|XP_009365923.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=359

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  303  GKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVNPSPLL  359



>ref|XP_009365884.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=359

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  303  GKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVNPSPLL  359



>ref|XP_008357782.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
 ref|XP_008357783.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=357

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+IEGFLYRY+KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  301  GKRIEGFLYRYKKGEEVRILCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  354



>ref|XP_010514662.1| PREDICTED: ninja-family protein AFP3-like [Camelina sativa]
 ref|XP_010514663.1| PREDICTED: ninja-family protein AFP3-like [Camelina sativa]
Length=232

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG DVA+PLKHI+V+PS
Sbjct  176  GKKIDGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGSDVAYPLKHIVVNPS  229



>ref|XP_010258036.1| PREDICTED: ninja-family protein AFP3 [Nelumbo nucifera]
Length=419

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+IEGFLY+YRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPL+HI+V+PS
Sbjct  361  GKRIEGFLYKYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLRHIVVNPS  414



>emb|CAN77669.1| hypothetical protein VITISV_038107 [Vitis vinifera]
Length=1100

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2     GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
             GKK++GFLYRY+KGEEVRIVCVCHG FLSPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  1044  GKKVDGFLYRYKKGEEVRIVCVCHGTFLSPAEFVKHAGGSDVAHPLRHIVVYPSSLL  1100



>ref|XP_009797625.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=337

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLYRY+KGEEVRIVCVCHGNFLSPAEFVKHAGG DVA+PL+HI+V+P+ L 
Sbjct  280  GKKIEGFLYRYKKGEEVRIVCVCHGNFLSPAEFVKHAGGSDVANPLRHIVVNPAPLM  336



>ref|XP_003562743.1| PREDICTED: ninja-family protein 1-like [Brachypodium distachyon]
Length=335

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  277  GKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  330



>dbj|BAJ90997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  256  GKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  309



>sp|B1B5D3.1|NNJA1_WHEAT RecName: Full=Ninja-family protein 1; AltName: Full=ABI five-binding 
protein A1; Short=ABI5-binding protein A1; Short=TaAFP-A1 
[Triticum aestivum]
 dbj|BAG12827.1| ABI5 binding protein A1 [Triticum aestivum]
Length=315

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  257  GKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  310



>emb|CBI21211.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   110 bits (276),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKK++GFLYRY+KGEEVRIVCVCHG FLSPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  641  GKKVDGFLYRYKKGEEVRIVCVCHGTFLSPAEFVKHAGGSDVAHPLRHIVVYPSSLL  697



>ref|XP_002277117.2| PREDICTED: ninja-family protein AFP3-like [Vitis vinifera]
Length=387

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKK++GFLYRY+KGEEVRIVCVCHG FLSPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  331  GKKVDGFLYRYKKGEEVRIVCVCHGTFLSPAEFVKHAGGSDVAHPLRHIVVYPSSLL  387



>ref|XP_010425750.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
 ref|XP_010425751.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
Length=238

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG DVAHPLKHI+V+ S
Sbjct  182  GKKIDGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVVNLS  235



>ref|XP_004232160.1| PREDICTED: ninja-family protein AFP3 [Solanum lycopersicum]
Length=317

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLYRY+KGEEV+I+CVCHGNFLSPAEFVKHAGGGDVA+PLK I+V+PS L 
Sbjct  260  GKKIEGFLYRYQKGEEVKIMCVCHGNFLSPAEFVKHAGGGDVANPLKQIVVNPSPLL  316



>emb|CDX85274.1| BnaC07g25850D [Brassica napus]
Length=265

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKG+EVRIVCVCHG+FLSPAEF+KHAGG DV HPLKHI+V+PS
Sbjct  209  GKKIDGFLYRYRKGQEVRIVCVCHGSFLSPAEFIKHAGGSDVTHPLKHIVVNPS  262



>ref|XP_003531858.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=383

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGGDVA+PLKHI+VSPS L
Sbjct  328  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGGDVANPLKHIVVSPSLL  383



>ref|XP_006338361.1| PREDICTED: ninja-family protein AFP3-like [Solanum tuberosum]
Length=314

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLYRY+KGEEV+I+CVCHGNFLSPAEFVKHAGGGDVA+PLK I+V+PS L 
Sbjct  257  GKKIEGFLYRYQKGEEVKIMCVCHGNFLSPAEFVKHAGGGDVANPLKQIVVNPSPLL  313



>ref|XP_009111795.1| PREDICTED: ninja-family protein AFP3 [Brassica rapa]
 emb|CDY19988.1| BnaA09g02630D [Brassica napus]
Length=255

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLYRYRKG+EVRIVCVCHG+FL+PAEFVKHAGG DVAHPLKHI+V+PS
Sbjct  199  GRKIDGFLYRYRKGDEVRIVCVCHGSFLTPAEFVKHAGGRDVAHPLKHIVVNPS  252



>ref|XP_009360511.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=355

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            K+IEGFLYRY+KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS
Sbjct  300  KRIEGFLYRYKKGEEVRILCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPS  352



>sp|B1B5D4.1|NNJA2_WHEAT RecName: Full=Ninja-family protein 2; AltName: Full=ABI five-binding 
protein B1; Short=ABI5-binding protein B1; Short=TaAFP-B1 
[Triticum aestivum]
 dbj|BAG12828.1| ABI5 binding protein B1 [Triticum aestivum]
Length=316

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+P+
Sbjct  258  GKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPA  311



>ref|XP_009151770.1| PREDICTED: ninja-family protein AFP3-like [Brassica rapa]
 emb|CDX86364.1| BnaA06g30810D [Brassica napus]
Length=267

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKG+EVRIVCVCHG+FLSPAEF+KHAGG DV HPLKHI+V+PS
Sbjct  211  GKKIDGFLYRYRKGQEVRIVCVCHGSFLSPAEFIKHAGGSDVTHPLKHIVVNPS  264



>ref|XP_004304226.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=366

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK++EGFLYRY+KGEEVRIVCVCHG+FL+PAEFVKHAGGGDV HPLKHI+V+P+ + 
Sbjct  310  GKRVEGFLYRYKKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVPHPLKHIVVNPTPIL  366



>ref|XP_010906161.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Elaeis 
guineensis]
Length=367

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLYRYRKGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+P+
Sbjct  309  GRRIEGFLYRYRKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPT  362



>ref|XP_009392469.1| PREDICTED: ninja-family protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KIEGFLY+YRKGEEVRIVCVCHG FL+PAEFVKHAGGGDV+HPL+HI+V+PS
Sbjct  309  GRKIEGFLYKYRKGEEVRIVCVCHGTFLTPAEFVKHAGGGDVSHPLRHIVVNPS  362



>ref|XP_010906162.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Elaeis 
guineensis]
Length=366

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLYRYRKGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+P+
Sbjct  308  GRRIEGFLYRYRKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPT  361



>ref|XP_011467882.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=365

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GK++EGFLYRY+KGEEVRIVCVCHG+FL+PAEFVKHAGGGDV HPLKHI+V+P+ + 
Sbjct  309  GKRVEGFLYRYKKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVPHPLKHIVVNPTPIL  365



>sp|B1B5D5.1|NNJA3_WHEAT RecName: Full=Ninja-family protein 3; AltName: Full=ABI five-binding 
protein D1; Short=ABI5-binding protein D1; Short=TaAFP-D1 
[Triticum aestivum]
 dbj|BAG12829.1| ABI5 binding protein D1 [Triticum aestivum]
Length=310

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            KKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  253  KKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  305



>ref|XP_009588665.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana tomentosiformis]
Length=321

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLY Y+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  265  GKKIEGFLYGYKKGEEVRIVCVCHGDFLSPAEFVKHAGGGDVQHPLKHIVVNPSPLL  321



>gb|KHN13550.1| Ninja-family protein AFP2 [Glycine soja]
Length=381

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGGDVA+PLKHI+VSPS L
Sbjct  326  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGGDVANPLKHIVVSPSFL  381



>ref|XP_003552572.2| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=377

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGGDVA+PLKHI+VSPS L
Sbjct  322  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGGDVANPLKHIVVSPSFL  377



>ref|XP_010260112.1| PREDICTED: ninja-family protein AFP3-like [Nelumbo nucifera]
Length=417

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+YRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPL+HI+V+PS
Sbjct  359  GRRIEGFLYKYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVTHPLRHIVVNPS  412



>ref|XP_007139479.1| hypothetical protein PHAVU_008G032900g [Phaseolus vulgaris]
 gb|ESW11473.1| hypothetical protein PHAVU_008G032900g [Phaseolus vulgaris]
Length=379

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            G+++EGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGGDVA+PLKHI+VSPS L
Sbjct  324  GRRVEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGGDVANPLKHIVVSPSIL  379



>ref|XP_006658776.1| PREDICTED: ninja-family protein Os07g0602900-like [Oryza brachyantha]
Length=298

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  240  GRKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  293



>ref|XP_009605136.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana tomentosiformis]
Length=338

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLYRY KGEEVRIVCVCHGNF SPAEFVKHAGG DVA+PL+HI+V+PS L 
Sbjct  281  GKKIEGFLYRYNKGEEVRIVCVCHGNFHSPAEFVKHAGGSDVANPLRHIVVNPSPLL  337



>ref|XP_008791349.1| PREDICTED: ninja-family protein AFP3 [Phoenix dactylifera]
Length=102

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+Y+ GEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  44   GRRIEGFLYKYKNGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPS  97



>ref|XP_009764520.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=315

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKI+GFLY Y+KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  259  GKKIDGFLYGYKKGEEVRIVCVCHGDFLSPAEFVKHAGGGDVQHPLKHIVVNPSPLL  315



>gb|KHN14039.1| Ninja-family protein AFP2 [Glycine soja]
Length=383

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGG DVA+PLKHI+VSPS L
Sbjct  328  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGSDVANPLKHIVVSPSLL  383



>ref|XP_008805142.1| PREDICTED: ninja-family protein AFP3-like [Phoenix dactylifera]
Length=361

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLYRY+KGEE+RIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  303  GRRIEGFLYRYKKGEELRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPS  356



>ref|XP_006291750.1| hypothetical protein CARUB_v10017919mg, partial [Capsella rubella]
 gb|EOA24648.1| hypothetical protein CARUB_v10017919mg, partial [Capsella rubella]
Length=246

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRY KGEEVRIVCVCHG+FLSPAEF+KHAGG DVA+PLKHI+V+PS
Sbjct  190  GKKIDGFLYRYGKGEEVRIVCVCHGSFLSPAEFIKHAGGSDVANPLKHIVVNPS  243



>dbj|BAB01982.1| unnamed protein product [Arabidopsis thaliana]
Length=261

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  151
            GKKI GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+
Sbjct  175  GKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIV  224



>ref|XP_004490204.1| PREDICTED: ninja-family protein AFP1-like [Cicer arietinum]
Length=367

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  309  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPSA  363



>gb|KEH27866.1| ninja-family protein AFP1 [Medicago truncatula]
Length=570

 Score =   107 bits (266),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS
Sbjct  339  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPS  392



>ref|XP_009416563.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=310

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEG LYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDVAHPL+HI+V+PS
Sbjct  252  GRRIEGLLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVAHPLRHIVVNPS  305



>ref|XP_010939184.1| PREDICTED: ninja-family protein Os07g0602900 [Elaeis guineensis]
Length=371

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+Y+KGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  313  GRRIEGFLYKYKKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPS  366



>emb|CDY44386.1| BnaA02g29910D [Brassica napus]
Length=251

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRY KG+EVRIVCVCHG+FL+PAEFVKHAGG DV HPLKHI+V+PS
Sbjct  195  GKKIDGFLYRYMKGQEVRIVCVCHGSFLTPAEFVKHAGGRDVTHPLKHIVVNPS  248



>sp|Q6YVY6.1|NNJA2_ORYSJ RecName: Full=Ninja-family protein Os07g0602900 [Oryza sativa 
Japonica Group]
 dbj|BAC84471.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD31712.1| hypothetical protein [Oryza sativa Japonica Group]
Length=319

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLY+YRK EEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  261  GRKIDGFLYKYRKREEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  314



>emb|CDY00093.1| BnaC09g02080D [Brassica napus]
Length=254

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLYRYRKG+EVRIVCVCHG+FL+PAEFVKHAGG DVA PLKHI+V+PS
Sbjct  198  GRKIDGFLYRYRKGDEVRIVCVCHGSFLTPAEFVKHAGGRDVARPLKHIVVNPS  251



>ref|XP_006649630.1| PREDICTED: ninja-family protein Os03g0214200-like [Oryza brachyantha]
Length=401

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+P
Sbjct  343  GKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNP  395



>ref|XP_007153513.1| hypothetical protein PHAVU_003G042000g [Phaseolus vulgaris]
 gb|ESW25507.1| hypothetical protein PHAVU_003G042000g [Phaseolus vulgaris]
Length=406

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  349  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPSA  403



>ref|XP_003520115.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=411

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  354  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPSA  408



>ref|XP_011098751.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Sesamum 
indicum]
Length=324

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            G KIEGFLYRYRKGEEVRIVCVCHG FLSPAEFVKH GGGDV HPLKHI+V+P  L 
Sbjct  268  GHKIEGFLYRYRKGEEVRIVCVCHGMFLSPAEFVKHGGGGDVEHPLKHIVVNPFPLL  324



>ref|XP_011098752.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Sesamum 
indicum]
Length=323

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            G KIEGFLYRYRKGEEVRIVCVCHG FLSPAEFVKH GGGDV HPLKHI+V+P  L 
Sbjct  267  GHKIEGFLYRYRKGEEVRIVCVCHGMFLSPAEFVKHGGGGDVEHPLKHIVVNPFPLL  323



>gb|EAZ26053.1| hypothetical protein OsJ_09907 [Oryza sativa Japonica Group]
Length=363

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+P
Sbjct  305  GKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNP  357



>gb|KHN29983.1| Ninja-family protein AFP2 [Glycine soja]
Length=369

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  312  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPSA  366



>ref|NP_001173313.1| Os03g0214200 [Oryza sativa Japonica Group]
 sp|Q10Q07.1|NNJA1_ORYSJ RecName: Full=Ninja-family protein Os03g0214200 [Oryza sativa 
Japonica Group]
 gb|ABF94628.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG94685.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92041.1| Os03g0214200 [Oryza sativa Japonica Group]
Length=401

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+P
Sbjct  343  GKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNP  395



>gb|EAY89035.1| hypothetical protein OsI_10519 [Oryza sativa Indica Group]
Length=401

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+P
Sbjct  343  GKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNP  395



>emb|CDP02322.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKKIEGFLYRY+KGEEV+IVCVCHG+FLSPAEFVKHAGG +V HPL+HI+V+PS L 
Sbjct  279  GKKIEGFLYRYQKGEEVKIVCVCHGSFLSPAEFVKHAGGTEVEHPLRHIVVNPSPLI  335



>ref|XP_004958230.1| PREDICTED: ninja-family protein 3-like isoform X1 [Setaria italica]
 ref|XP_004958231.1| PREDICTED: ninja-family protein 3-like isoform X2 [Setaria italica]
Length=318

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G+K +GFLY+YRKGEEVRIVCVCHGNFL+PAEFV+HAGGGDV +PL+HI+V+P
Sbjct  260  GRKTDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVRHAGGGDVTNPLRHIVVNP  312



>gb|KDO70354.1| hypothetical protein CISIN_1g0167841mg, partial [Citrus sinensis]
Length=137

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KIEG LYRY KGEEVRI+CVCHG+FLSPAEFVKHAGGGDV HPL+HI+V+P+
Sbjct  79   GRKIEGILYRYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVDHPLRHIVVNPA  132



>ref|XP_007045850.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY01682.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
Length=380

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK++EG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDV HPL+HI+V+PS
Sbjct  322  GKRVEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVDHPLRHIVVNPS  375



>gb|KJB50518.1| hypothetical protein B456_008G176700 [Gossypium raimondii]
Length=350

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDV HPL+HI+V+P+
Sbjct  292  GKRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVDHPLRHIVVNPN  345



>ref|XP_010936468.1| PREDICTED: ninja-family protein 6 [Elaeis guineensis]
Length=360

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+YRKGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+ S
Sbjct  302  GRRIEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNTS  355



>ref|XP_009406311.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=356

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G++IEGFLY+Y+KGEEVRIVCVCHG+FL+PAEFVKHAGGGDV HPL+HI+V+P
Sbjct  295  GRRIEGFLYKYKKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVTHPLRHIVVNP  347



>ref|XP_007045849.1| ABI five binding protein 2, putative isoform 1 [Theobroma cacao]
 gb|EOY01681.1| ABI five binding protein 2, putative isoform 1 [Theobroma cacao]
Length=420

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK++EG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDV HPL+HI+V+PS
Sbjct  362  GKRVEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVDHPLRHIVVNPS  415



>ref|XP_002467685.1| hypothetical protein SORBIDRAFT_01g032370 [Sorghum bicolor]
 gb|EER94683.1| hypothetical protein SORBIDRAFT_01g032370 [Sorghum bicolor]
Length=187

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV++PL+HI+V+P+
Sbjct  132  RRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVSNPLRHIVVNPA  184



>ref|XP_011000075.1| PREDICTED: ninja-family protein AFP3-like [Populus euphratica]
Length=357

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG-DVAHPLKHIIVSPSCLF  172
            GK+IEGFLY+YRKGEEVRIVCVCHG+FLSPAEFVKHAGGG DV  PLKHI+V PS  F
Sbjct  300  GKRIEGFLYQYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDDVEQPLKHIVVHPSPFF  357



>ref|XP_008339804.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=161

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+K+EG LYRY KG+EVRI+CVCHG+FLSPAEFVKHAGG DVAHPL+HI+V+P+
Sbjct  105  GRKVEGILYRYGKGQEVRIMCVCHGSFLSPAEFVKHAGGSDVAHPLRHIVVNPA  158



>emb|CDY04085.1| BnaC02g38000D [Brassica napus]
Length=249

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            KKI+GFLYRY KG+EVRIVCVCHG+FL+PAEFVKHAGG DV HPLKHI+V+PS
Sbjct  194  KKIDGFLYRYMKGQEVRIVCVCHGSFLTPAEFVKHAGGRDVTHPLKHIVVNPS  246



>ref|XP_010228506.1| PREDICTED: ninja-family protein Os03g0419100-like isoform X2 
[Brachypodium distachyon]
Length=301

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEE-VRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKG E VRIVCVCHGNFL+PAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  242  GKKIDGFLYRYRKGGEGVRIVCVCHGNFLTPAEFVKHAGGGDVSNPLRHIVVNPS  296



>ref|XP_008810752.1| PREDICTED: ninja-family protein 6-like [Phoenix dactylifera]
Length=362

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+Y+KG EVRIVCVCHG+FL+PAEFV+HAGGGDVAHPLKHI+V+PS
Sbjct  304  GRRIEGFLYKYKKGGEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLKHIVVNPS  357



>ref|XP_008656995.1| PREDICTED: ninja-family protein 6-like [Zea mays]
 tpg|DAA45816.1| TPA: putative DUF1675 domain containing family protein [Zea mays]
Length=291

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV++PL+HI+V+P+
Sbjct  236  RRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVSNPLRHIVVNPA  288



>ref|XP_006437917.1| hypothetical protein CICLE_v10031813mg [Citrus clementina]
 ref|XP_006484218.1| PREDICTED: ninja-family protein AFP2-like [Citrus sinensis]
 gb|ESR51157.1| hypothetical protein CICLE_v10031813mg [Citrus clementina]
Length=382

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+KIEG LYRY KGEEVRI+CVCHG+FLSPAEFVKHAGGGDV HPL+HI+V+P+ 
Sbjct  324  GRKIEGILYRYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVDHPLRHIVVNPAA  378



>emb|CBI27295.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  295  GRRIEGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVAHPLRHIVVNPSS  349



>ref|XP_004984009.1| PREDICTED: ninja-family protein 6-like [Setaria italica]
Length=315

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  260  RRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVSNPLRHIVVNPS  312



>ref|XP_009399138.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399139.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+YR+GEEVRIVC+CHG FL+PAEFVKH GGGDVAHPL+HI+V+PS
Sbjct  265  GRRIEGFLYKYREGEEVRIVCLCHGRFLTPAEFVKHGGGGDVAHPLRHIVVNPS  318



>ref|XP_002274025.1| PREDICTED: ninja-family protein AFP2 isoform X1 [Vitis vinifera]
Length=360

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  302  GRRIEGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVAHPLRHIVVNPSS  356



>ref|XP_008361875.1| PREDICTED: ninja-family protein AFP1-like [Malus domestica]
Length=534

 Score =   103 bits (257),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+K+EG LYRY KG+EVRI+CVCHG+FLSPAEFVKHAGG DVAHPL+HI+V+P+
Sbjct  478  GRKVEGILYRYGKGQEVRIMCVCHGSFLSPAEFVKHAGGSDVAHPLRHIVVNPA  531



>gb|KHN31942.1| Ninja-family protein AFP2 [Glycine soja]
Length=381

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA+PL+HI+V+PS 
Sbjct  324  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAYPLRHIVVNPSA  378



>ref|XP_003516385.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=407

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA+PL+HI+V+PS 
Sbjct  350  GRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVAYPLRHIVVNPSA  404



>ref|XP_010228505.1| PREDICTED: ninja-family protein Os03g0419100-like isoform X1 
[Brachypodium distachyon]
Length=325

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEE-VRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKI+GFLYRYRKG E VRIVCVCHGNFL+PAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  242  GKKIDGFLYRYRKGGEGVRIVCVCHGNFLTPAEFVKHAGGGDVSNPLRHIVVNPS  296



>ref|XP_004297228.1| PREDICTED: ninja-family protein AFP2-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+KIEG LYRY KGEEVRI+CVCHG FLSPAEFVKHAGGGDV +PL+HI+V+P+ 
Sbjct  298  GRKIEGILYRYAKGEEVRIMCVCHGTFLSPAEFVKHAGGGDVTNPLRHIVVNPAA  352



>ref|NP_001150339.1| ninja-family protein 6 [Zea mays]
 sp|B6TNQ7.1|NNJA6_MAIZE RecName: Full=Ninja-family protein 6 [Zea mays]
 gb|ACG38740.1| RNA-binding protein [Zea mays]
 gb|AFW88124.1| putative DUF1675 domain containing family protein [Zea mays]
Length=288

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
             ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HI+V+P+
Sbjct  232  ARRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVPNPLRHIVVNPA  285



>ref|XP_002463155.1| hypothetical protein SORBIDRAFT_02g038620 [Sorghum bicolor]
 gb|EER99676.1| hypothetical protein SORBIDRAFT_02g038620 [Sorghum bicolor]
Length=342

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G+KI+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGG+V +PL+HI+V+P
Sbjct  284  GRKIDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGEVTNPLRHIVVNP  336



>ref|XP_009397240.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G +IEGFLY+YRKGE+VRIVCVCHG F +PAEFVKHAGGGDVAHPL+HI+V+P
Sbjct  223  GTRIEGFLYKYRKGEDVRIVCVCHGRFFTPAEFVKHAGGGDVAHPLRHIVVNP  275



>ref|XP_009411123.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G+++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+
Sbjct  297  GRRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVN  348



>ref|XP_008243841.1| PREDICTED: ninja-family protein AFP3 [Prunus mume]
Length=398

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+K+EG LYRY KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+V+P+ 
Sbjct  340  GRKVEGILYRYGKGEEVRIMCVCHGSFLSPAEFVKHAGGSDVTHPLRHIVVNPAA  394



>ref|XP_006348683.1| PREDICTED: ninja-family protein AFP3-like [Solanum tuberosum]
Length=444

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+++G LYRY KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKHI+++P+
Sbjct  386  GKRVDGILYRYNKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVAHPLKHIVINPN  439



>ref|XP_002324118.2| hypothetical protein POPTR_0017s13000g [Populus trichocarpa]
 gb|EEF04251.2| hypothetical protein POPTR_0017s13000g [Populus trichocarpa]
Length=356

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG-DVAHPLKHIIVSPSCLF  172
            GK+IEGFLY+YRKGEEV IVCVCHG+FLSPAEFVKHAGGG DV  PLKHI+V PS  F
Sbjct  299  GKRIEGFLYQYRKGEEVTIVCVCHGSFLSPAEFVKHAGGGDDVEQPLKHIVVHPSPFF  356



>ref|XP_007223056.1| hypothetical protein PRUPE_ppa006974mg [Prunus persica]
 gb|EMJ24255.1| hypothetical protein PRUPE_ppa006974mg [Prunus persica]
Length=387

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+K+EG LYRY KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+V+P+ 
Sbjct  329  GRKVEGILYRYGKGEEVRIMCVCHGSFLSPAEFVKHAGGSDVTHPLRHIVVNPAA  383



>gb|EYU34604.1| hypothetical protein MIMGU_mgv1a010027mg [Erythranthe guttata]
Length=324

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
             KIEGFLYRY+KGEEV+IVCVCHG FLSPAEFVKH GGGDVA PLKHI+V+P  LF
Sbjct  269  NKIEGFLYRYKKGEEVKIVCVCHGLFLSPAEFVKHGGGGDVAQPLKHIVVNPFPLF  324



>gb|EPS72568.1| hypothetical protein M569_02189, partial [Genlisea aurea]
Length=77

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    KIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            K+EGFLYRY+KGEEVRI+CVCHG FLSPAEFVKH GG DV HPLKHI+V+P  L 
Sbjct  23   KVEGFLYRYKKGEEVRILCVCHGQFLSPAEFVKHGGGADVEHPLKHIVVNPFPLM  77



>ref|XP_010320856.1| PREDICTED: ninja-family protein AFP3 [Solanum lycopersicum]
Length=449

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK+++G LYRY KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKHI+++P+
Sbjct  391  GKRVDGILYRYSKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVAHPLKHIVINPN  444



>ref|XP_010091583.1| hypothetical protein L484_026430 [Morus notabilis]
 gb|EXB44849.1| hypothetical protein L484_026430 [Morus notabilis]
Length=345

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LYRY KGEEVRI+CVCHG FLSPAEFVKHAGGGDV HPL+HI+++PS 
Sbjct  286  GRRVDGILYRYGKGEEVRIMCVCHGKFLSPAEFVKHAGGGDVDHPLRHIVINPSS  340



>gb|AGT16625.1| hypothetical protein SHCRBa_261_H05_F_190 [Saccharum hybrid cultivar 
R570]
Length=305

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            ++I+GFLYRY+KGE VRIVCVCHG+FL+PAEFVKHAGGGDV++PL+HI+V+P+
Sbjct  250  RRIDGFLYRYKKGENVRIVCVCHGSFLTPAEFVKHAGGGDVSNPLRHIVVNPA  302



>gb|KEH21656.1| ABI five-binding protein [Medicago truncatula]
Length=362

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GKK+EGFLY+Y KGEEVRI+CVCHG+FL+PAEFVKHAGGGDV +PLKHI+V+ S +
Sbjct  307  GKKVEGFLYKYGKGEEVRILCVCHGSFLTPAEFVKHAGGGDVTNPLKHIVVNSSLI  362



>ref|XP_010066842.1| PREDICTED: ninja-family protein AFP3-like [Eucalyptus grandis]
Length=70

 Score = 93.6 bits (231),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            GK+IEG LY+Y KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA+P KHI +S
Sbjct  13   GKRIEGILYKYGKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVANPRKHIFIS  64



>gb|KJB80382.1| hypothetical protein B456_013G094600 [Gossypium raimondii]
Length=293

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            GK+++G LY+Y KGEEVRI+CVCHGNF SPAEFVKHAGGGDV +PL+HI+++PS 
Sbjct  235  GKRVDGILYKYGKGEEVRIMCVCHGNFFSPAEFVKHAGGGDVDNPLRHIVINPSS  289



>gb|KHG14342.1| Ninja-family protein AFP3 [Gossypium arboreum]
Length=293

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            GK+++G LY+Y KGEEVRI+CVCHGNF SPAEFVKHAGGGDV +PL+HI+++PS 
Sbjct  235  GKRVDGILYKYGKGEEVRIMCVCHGNFFSPAEFVKHAGGGDVDNPLRHIVINPSS  289



>emb|CDP00441.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGG DV HPLKHI+V+P+ 
Sbjct  319  GRRVDGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGSDVTHPLKHIVVNPNA  373



>gb|EAY90484.1| hypothetical protein OsI_12072 [Oryza sativa Indica Group]
Length=307

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  249  GRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNPLRHIVVNPS  302



>ref|NP_001050378.1| Os03g0419100 [Oryza sativa Japonica Group]
 sp|Q10JI3.1|NNJA3_ORYSJ RecName: Full=Ninja-family protein Os03g0419100 [Oryza sativa 
Japonica Group]
 gb|ABF96648.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12292.1| Os03g0419100 [Oryza sativa Japonica Group]
 dbj|BAG93477.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99827.1| unnamed protein product [Oryza sativa Japonica Group]
Length=307

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  249  GRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNPLRHIVVNPS  302



>gb|EAZ27349.1| hypothetical protein OsJ_11293 [Oryza sativa Japonica Group]
Length=307

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++PL+HI+V+PS
Sbjct  249  GRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNPLRHIVVNPS  302



>ref|XP_009416832.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=338

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS--PSCLF  172
            G++IEGFLY+YRKGEEV+IVCVCHG+F +PAEFVKHAGGG+VAHPL+HI+V   PS   
Sbjct  280  GRRIEGFLYKYRKGEEVKIVCVCHGSFFTPAEFVKHAGGGEVAHPLRHIVVDTLPSAFL  338



>ref|XP_009623485.1| PREDICTED: ninja-family protein AFP2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=348

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG DVAHPLKHI++ P+
Sbjct  290  GRRIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVIKPN  343



>ref|XP_009394318.1| PREDICTED: ninja-family protein 6-like [Musa acuminata subsp. 
malaccensis]
Length=314

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+Y +GEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+PL+HI+V+ S
Sbjct  258  GRRIEGFLYKYGRGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNSS  311



>ref|XP_009396433.1| PREDICTED: ninja-family protein 6-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGG DV +PL+HI+V+ S
Sbjct  277  GRRIEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGHDVTNPLRHIVVNSS  330



>gb|AHA43418.1| ninja-family protein AFP1-like protein [Solanum nigrum]
Length=447

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LYRY KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKHI+++P+
Sbjct  389  GRRVDGILYRYGKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVAHPLKHIVINPN  442



>ref|XP_009623484.1| PREDICTED: ninja-family protein AFP1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=364

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG DVAHPLKHI++ P+
Sbjct  306  GRRIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVIKPN  359



>ref|NP_001147185.1| ninja-family protein 5 [Zea mays]
 sp|B6SM63.1|NNJA5_MAIZE RecName: Full=Ninja-family protein 5 [Zea mays]
 gb|ACG25946.1| RNA-binding protein [Zea mays]
 tpg|DAA63508.1| TPA: putative DUF1675 domain containing family protein [Zea mays]
Length=307

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G+K +GFLY+YRKGEEVRIVCVCHG+FL+PAEFV+HAGGG+V +PL+HI+V+P
Sbjct  249  GRKTDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVEHAGGGEVPNPLRHIVVNP  301



>ref|XP_008350890.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=397

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+K+EG LYRY KGEEVRI+C+CHG+FLSPAEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  339  GRKVEGILYRYGKGEEVRIMCICHGSFLSPAEFVKHAGGSDVTNPLRHIVVNPAA  393



>ref|XP_008389402.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=397

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+K+EG LYRY KGEEVRI+C+CHG+FLSPAEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  339  GRKVEGILYRYGKGEEVRIMCICHGSFLSPAEFVKHAGGSDVTNPLRHIVVNPAA  393



>gb|KCW64879.1| hypothetical protein EUGRSUZ_G02444 [Eucalyptus grandis]
Length=392

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            GK+IEG LY+Y KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA+P KHI +S
Sbjct  335  GKRIEGILYKYGKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVANPRKHIFIS  386



>ref|XP_009356414.1| PREDICTED: ninja-family protein AFP3 [Pyrus x bretschneideri]
Length=394

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+K+EG LYRY KGEEVRI+C+CHG+FLSPAEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  336  GRKVEGILYRYGKGEEVRIMCICHGSFLSPAEFVKHAGGSDVTNPLRHIVVNPAA  390



>ref|XP_010527971.1| PREDICTED: ninja-family protein AFP2 [Tarenaya hassleriana]
 ref|XP_010527972.1| PREDICTED: ninja-family protein AFP2 [Tarenaya hassleriana]
Length=345

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            G++I+G LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDV HPL+HI+V+ S  
Sbjct  289  GRRIQGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVDHPLRHIVVNTSTF  344



>ref|XP_011085686.1| PREDICTED: ninja-family protein AFP3-like [Sesamum indicum]
Length=317

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            +K EGFLYRY++G++V+IVCVCHG FLSPAEFVKH GGGDVA PLKHI+V+P  LF
Sbjct  262  RKTEGFLYRYKRGDDVKIVCVCHGLFLSPAEFVKHGGGGDVAQPLKHIVVNPFPLF  317



>ref|XP_010923621.1| PREDICTED: ninja-family protein AFP3 [Elaeis guineensis]
Length=307

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEG LYRY KG+EVRIVCVCHG+FL+PAEFV+HAGGG+VAHPL+HI+V P+
Sbjct  249  GRRIEGLLYRYGKGKEVRIVCVCHGSFLTPAEFVRHAGGGNVAHPLRHIVVYPT  302



>ref|XP_011009405.1| PREDICTED: ninja-family protein AFP3-like [Populus euphratica]
Length=367

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            K+IEGFLY+YRKGEEVRIVC+CHG+FLS AEFVKHAG GDV  PLKHI+V+P
Sbjct  312  KRIEGFLYQYRKGEEVRIVCICHGSFLSAAEFVKHAGDGDVEQPLKHIVVNP  363



>ref|XP_010680683.1| PREDICTED: ninja-family protein AFP1 [Beta vulgaris subsp. vulgaris]
Length=461

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+K+EG LY+Y KGE VRI+CVCHGNF SP+EFVKHAGG DV HPL+HI+VSPS
Sbjct  404  GRKVEGILYKYGKGEGVRIMCVCHGNFFSPSEFVKHAGGKDVEHPLRHIVVSPS  457



>ref|XP_002512070.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50739.1| RNA binding protein, putative [Ricinus communis]
Length=355

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+K+EG LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+V+ S
Sbjct  298  GRKVEGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGRDVDHPLRHIVVNTS  351



>ref|XP_009760153.1| PREDICTED: ninja-family protein AFP1-like isoform X1 [Nicotiana 
sylvestris]
Length=393

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++I+G LY+Y KGE++RI+CVCHG+FLSPAEFVKHAGG DVAHPLKHI++ P+
Sbjct  335  GRRIDGILYKYGKGEDIRIMCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVIKPN  388



>ref|XP_009760154.1| PREDICTED: ninja-family protein AFP1-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++I+G LY+Y KGE++RI+CVCHG+FLSPAEFVKHAGG DVAHPLKHI++ P+
Sbjct  319  GRRIDGILYKYGKGEDIRIMCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVIKPN  372



>ref|XP_010550299.1| PREDICTED: ninja-family protein AFP1-like, partial [Tarenaya 
hassleriana]
Length=134

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G++++G LYRY KG EVRI+CVCHG FLSPAEFVKHAGGGDV HPL+HI+V+
Sbjct  76   GRRVDGILYRYGKGSEVRIMCVCHGTFLSPAEFVKHAGGGDVDHPLRHIVVN  127



>gb|EMS53692.1| hypothetical protein TRIUR3_09869 [Triticum urartu]
Length=259

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G++I+GFLY+Y + EEVRIVCVCHG+FL+PAEFV HAGGG+VAHP++HI+V+P
Sbjct  202  GERIDGFLYQYSRAEEVRIVCVCHGSFLTPAEFVAHAGGGEVAHPMRHIVVNP  254



>ref|XP_008446443.1| PREDICTED: ninja-family protein AFP3-like [Cucumis melo]
Length=396

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVKHAGG +VAHPL+HI+V+P+ 
Sbjct  338  GRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVKHAGGKNVAHPLRHIVVNPNS  392



>ref|XP_004237223.1| PREDICTED: ninja-family protein AFP3 isoform X1 [Solanum lycopersicum]
Length=384

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG D+A+PLKHI++ P+
Sbjct  326  GRRIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDIANPLKHIVIKPN  379



>gb|KDP41313.1| hypothetical protein JCGZ_15720 [Jatropha curcas]
Length=346

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGE+VRI+CVCHG+FLSPAEFVKHAGGGDV HPL+HI+V+ S
Sbjct  288  GRRVDGILYKYGKGEDVRIMCVCHGSFLSPAEFVKHAGGGDVDHPLRHIVVNTS  341



>ref|XP_004135434.1| PREDICTED: ninja-family protein AFP1-like [Cucumis sativus]
 gb|KGN51983.1| hypothetical protein Csa_5G606730 [Cucumis sativus]
Length=396

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVKHAGG +VAHPL+HI+V+P+
Sbjct  338  GRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVKHAGGKNVAHPLRHIVVNPN  391



>ref|XP_009592703.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=427

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LY+Y KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKHI+V+P+ 
Sbjct  369  GRRVDGILYKYGKGEEVRIMCVCHGSFYSPAEFVKHAGGTDVAHPLKHIVVNPNA  423



>ref|XP_004165617.1| PREDICTED: ninja-family protein AFP1-like [Cucumis sativus]
Length=396

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVKHAGG +VAHPL+HI+V+P+
Sbjct  338  GRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVKHAGGKNVAHPLRHIVVNPN  391



>ref|XP_004489525.1| PREDICTED: ninja-family protein AFP3-like [Cicer arietinum]
Length=360

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            GK+I+GFLY+Y KGEEVRI+CVCHG+FL+PAEFVKHAGG DV +PLKHI+VS
Sbjct  305  GKRIQGFLYKYGKGEEVRILCVCHGSFLTPAEFVKHAGGPDVTNPLKHIVVS  356



>emb|CBW38448.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38449.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38450.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38451.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38452.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38453.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38454.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38455.1| ABA responsive protein [Helianthus annuus]
 gb|AGH13370.1| ABA responsive protein, partial [Helianthus annuus]
 gb|AGH13371.1| ABA responsive protein, partial [Helianthus annuus]
Length=95

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            GK+I+GFLYRY + EEVRIVCVCHG+FL+PAEFVKH GGG+V HPL+HI+V+
Sbjct  40   GKRIQGFLYRYGEDEEVRIVCVCHGSFLTPAEFVKHGGGGEVEHPLRHIVVT  91



>ref|XP_006845867.1| hypothetical protein AMTR_s00154p00057990 [Amborella trichopoda]
 gb|ERN07542.1| hypothetical protein AMTR_s00154p00057990 [Amborella trichopoda]
Length=122

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPS  163
            GK++EG LY Y KGEEV IVCVCHG FL+PAEFV+HAGGGDV HPL+HI+V   SPS
Sbjct  66   GKRVEGVLYNYSKGEEVSIVCVCHGTFLTPAEFVRHAGGGDVDHPLRHIVVINPSPS  122



>ref|XP_009407390.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=320

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G++IEG LY+Y KGEEV+IVCVCHG+F SPAEFVKHAG GDVAHPL+HI+VS
Sbjct  262  GRRIEGLLYKYGKGEEVKIVCVCHGSFFSPAEFVKHAGSGDVAHPLRHIVVS  313



>ref|XP_011011869.1| PREDICTED: ninja-family protein AFP2-like [Populus euphratica]
Length=354

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+CVCHG+F SPAEFVKHAGG DV HPL+HI+V+PS
Sbjct  296  GRRVDGILYKYGKGEEVRIMCVCHGSFHSPAEFVKHAGGSDVDHPLRHIVVNPS  349



>ref|XP_011101763.1| PREDICTED: ninja-family protein AFP1-like [Sesamum indicum]
Length=435

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LY+Y KGEEVRI+CVCHGNF SPAEFVKHAGG DV HPLKHI+V+P+ 
Sbjct  377  GRRVDGILYKYGKGEEVRIMCVCHGNFHSPAEFVKHAGGTDVDHPLKHIVVNPNS  431



>ref|XP_010044396.1| PREDICTED: ninja-family protein AFP3-like [Eucalyptus grandis]
 gb|KCW86483.1| hypothetical protein EUGRSUZ_B03147 [Eucalyptus grandis]
Length=306

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+CVCHGNF SPAEFV+HAGGG+VAHPL+ I+++P+
Sbjct  247  GRRVDGILYKYGKGEEVRIMCVCHGNFHSPAEFVRHAGGGEVAHPLRQIVINPN  300



>ref|XP_006379694.1| hypothetical protein POPTR_0008s09620g [Populus trichocarpa]
 gb|ERP57491.1| hypothetical protein POPTR_0008s09620g [Populus trichocarpa]
Length=357

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+++ S
Sbjct  299  GRRVDGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGSDVNHPLRHIVINSS  352



>gb|EMT13868.1| hypothetical protein F775_31150 [Aegilops tauschii]
Length=396

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            G++I+GFLY+Y + EEVRIVCVCHG+FL+PAEFV HAGG +V HP++HI+V+P  L
Sbjct  341  GERIDGFLYQYSRAEEVRIVCVCHGSFLTPAEFVAHAGGSEVTHPMRHIVVNPPSL  396



>ref|XP_002306022.2| hypothetical protein POPTR_0004s11980g, partial [Populus trichocarpa]
 gb|EEE86533.2| hypothetical protein POPTR_0004s11980g, partial [Populus trichocarpa]
Length=390

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHA--GGGDVAHPLKHIIVSPSCLF  172
            GK+IEGFLY+YRKGEE+RIVCVCHG+FLS AEFVKHA  G GDV  PLKHI+V+P  L 
Sbjct  332  GKRIEGFLYQYRKGEELRIVCVCHGSFLSAAEFVKHAGDGDGDVEQPLKHIVVNPPPLL  390



>ref|XP_009779157.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=427

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LY+Y KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKHI+V+P+ 
Sbjct  369  GRRVDGILYKYGKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVAHPLKHIVVNPNA  423



>gb|AGT16981.1| Protein of unknown function DUF1675 [Saccharum hybrid cultivar 
R570]
Length=287

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VSP+
Sbjct  231  GNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSPT  284



>gb|EYU28869.1| hypothetical protein MIMGU_mgv1a008006mg [Erythranthe guttata]
Length=388

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G+++EG LYRY KGEEVRI+CVCHG+F SPAEFV+HAGG DV +PLKHI+V+P+ 
Sbjct  330  GRRVEGILYRYGKGEEVRIMCVCHGSFHSPAEFVRHAGGTDVDNPLKHIVVNPNS  384



>ref|XP_011018739.1| PREDICTED: ninja-family protein AFP2-like [Populus euphratica]
Length=354

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G++++G LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+++
Sbjct  296  GRRVDGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGSDVNHPLRHIVIN  347



>gb|AAR06258.1| ABRC5 [Helianthus annuus]
Length=141

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            GK+I+GFLYRY + EEVRIVCVCHG+FL+P EFVKH GGG+V HPL+HI+V+
Sbjct  86   GKRIQGFLYRYGEDEEVRIVCVCHGSFLTPPEFVKHGGGGEVEHPLRHIVVT  137



>ref|XP_011102058.1| PREDICTED: ninja-family protein AFP3-like [Sesamum indicum]
Length=366

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            G++++G LY+Y KG+EVRI+CVCHGNF SPAEF KHAGG DV HPLKHI+V+P+ 
Sbjct  308  GRRVDGILYKYGKGKEVRIMCVCHGNFHSPAEFAKHAGGTDVDHPLKHIVVNPNS  362



>ref|XP_002465644.1| hypothetical protein SORBIDRAFT_01g042880 [Sorghum bicolor]
 gb|EER92642.1| hypothetical protein SORBIDRAFT_01g042880 [Sorghum bicolor]
Length=394

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G ++EGFLY+YRKGE+VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+V+P+
Sbjct  336  GNRVEGFLYKYRKGEDVRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVNPT  389



>ref|XP_006302500.1| hypothetical protein CARUB_v10020599mg [Capsella rubella]
 gb|EOA35398.1| hypothetical protein CARUB_v10020599mg [Capsella rubella]
Length=341

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+HI+V   SPS L 
Sbjct  282  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRHIVVNTSSPSNLL  341



>gb|AGT15870.1| hypothetical protein SHCRBa_252_E12_R_390 [Saccharum hybrid cultivar 
R570]
Length=392

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VSP+
Sbjct  336  GNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSPT  389



>gb|AGT16721.1| hypothetical protein SHCRBa_127_L16_F_40 [Saccharum hybrid cultivar 
R570]
Length=392

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VSP+
Sbjct  336  GNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSPT  389



>gb|AGT16149.1| ABI five biding protein 3 [Saccharum hybrid cultivar R570]
Length=389

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VSP+
Sbjct  333  GNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSPT  386



>ref|XP_008785998.1| PREDICTED: ninja-family protein AFP3-like [Phoenix dactylifera]
Length=328

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++IEGFLY Y +GEEVRIVC CHG+ L+PAEFV+HAG G+VAHPL+HI+V+P+
Sbjct  270  GRRIEGFLYGYGEGEEVRIVCACHGSLLTPAEFVRHAGAGNVAHPLRHILVNPT  323



>ref|XP_009105006.1| PREDICTED: ninja-family protein AFP1-like [Brassica rapa]
 ref|XP_009105007.1| PREDICTED: ninja-family protein AFP1-like [Brassica rapa]
Length=346

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  287  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  346



>emb|CDY07354.1| BnaA07g24330D [Brassica napus]
Length=347

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  288  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  347



>ref|XP_004985196.1| PREDICTED: ninja-family protein 1-like [Setaria italica]
Length=364

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            G ++EGFLY+YRKGE+VRIVC+CHG F +PA FV+HAGGG+V++PL+HI+V+P
Sbjct  308  GNRLEGFLYKYRKGEQVRIVCICHGTFHTPAGFVEHAGGGNVSNPLRHIVVTP  360



>ref|XP_010511949.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=349

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+HI+V+ S 
Sbjct  289  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRHIVVNTSS  343



>ref|XP_010415560.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=346

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+HI+V+ S 
Sbjct  286  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRHIVVNTSS  340



>ref|XP_010470901.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=341

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 3/58 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSC  166
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+HI+V   SPS 
Sbjct  281  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRHIVVNTCSPSS  338



>emb|CDY04272.1| BnaC06g25430D [Brassica napus]
Length=346

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  287  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  346



>ref|XP_010495560.1| PREDICTED: ninja-family protein AFP2 [Camelina sativa]
Length=359

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  302  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  355



>ref|NP_564956.1| ABI five binding protein [Arabidopsis thaliana]
 sp|Q9LQ98.1|AFP1_ARATH RecName: Full=Ninja-family protein AFP1; AltName: Full=ABI five-binding 
protein 1; Short=ABI5-binding protein 1 [Arabidopsis 
thaliana]
 gb|AAF27062.1|AC008262_11 F4N2.22 [Arabidopsis thaliana]
 gb|AAM97023.1| expressed protein [Arabidopsis thaliana]
 gb|AAN15518.1| expressed protein [Arabidopsis thaliana]
 gb|AEE34903.1| ABI five binding protein [Arabidopsis thaliana]
Length=345

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  286  GKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  345



>gb|AAM67141.1| unknown [Arabidopsis thaliana]
Length=334

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  275  GKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  334



>ref|XP_010476399.1| PREDICTED: ninja-family protein AFP2-like [Camelina sativa]
Length=361

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  304  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  357



>ref|XP_010458838.1| PREDICTED: ninja-family protein AFP2-like [Camelina sativa]
Length=364

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  307  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  360



>gb|AAL07175.1| unknown protein [Arabidopsis thaliana]
Length=348

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  291  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  344



>gb|AAG52486.1|AC018364_4 unknown protein; 57564-56338 [Arabidopsis thaliana]
Length=335

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS L 
Sbjct  276  GKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSSPSNLL  335



>ref|NP_563933.1| ABI five binding protein 2 [Arabidopsis thaliana]
 sp|Q9LMX5.1|AFP2_ARATH RecName: Full=Ninja-family protein AFP2; AltName: Full=ABI five-binding 
protein 2; Short=ABI5-binding protein 2 [Arabidopsis 
thaliana]
 gb|AAF81300.1|AC027656_17 Strong similarity to a hypothetical protein F23O10.16 gi|7705096 
from Arabidopsis thaliana BAC F23O10 gb|AC018364 [Arabidopsis 
thaliana]
 gb|ABD85158.1| At1g13740 [Arabidopsis thaliana]
 gb|AEE29062.1| ABI five binding protein 2 [Arabidopsis thaliana]
Length=348

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  291  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  344



>ref|XP_006417093.1| hypothetical protein EUTSA_v10008099mg [Eutrema salsugineum]
 gb|ESQ35446.1| hypothetical protein EUTSA_v10008099mg [Eutrema salsugineum]
Length=344

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  287  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  340



>emb|CDY33807.1| BnaA09g46130D [Brassica napus]
Length=309

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  252  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_009117975.1| PREDICTED: ninja-family protein AFP2-like [Brassica rapa]
Length=309

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  252  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_002890019.1| hypothetical protein ARALYDRAFT_471533 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66278.1| hypothetical protein ARALYDRAFT_471533 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  271  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  324



>emb|CDY16104.1| BnaC08g40190D [Brassica napus]
Length=309

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  252  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_006305186.1| hypothetical protein CARUB_v10009552mg [Capsella rubella]
 gb|EOA38084.1| hypothetical protein CARUB_v10009552mg [Capsella rubella]
Length=357

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  300  GRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  353



>ref|XP_011070935.1| PREDICTED: ninja-family protein AFP2-like [Sesamum indicum]
Length=327

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCL  169
            G++++G LYRY K EEVRI+C+CHG+F SPAEF+KHAGG DV HPLKHI++   SPS L
Sbjct  269  GRRVDGILYRYGKREEVRIMCICHGSFHSPAEFIKHAGGTDVDHPLKHIVINRNSPSLL  327



>gb|EEC82402.1| hypothetical protein OsI_26773 [Oryza sativa Indica Group]
Length=279

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  23   LYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            L   RKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV +PL+HI+V+PS
Sbjct  228  LRTLRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPS  274



>gb|KFK41350.1| hypothetical protein AALP_AA2G118900 [Arabis alpina]
Length=319

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  166
            GK+++G LYRY  GE+VRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V+ S 
Sbjct  259  GKRVDGILYRYGNGEQVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTSS  313



>ref|XP_006391038.1| hypothetical protein EUTSA_v10018761mg [Eutrema salsugineum]
 gb|ESQ28324.1| hypothetical protein EUTSA_v10018761mg [Eutrema salsugineum]
Length=358

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPS  163
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+HI+V   SPS
Sbjct  298  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVNTCSPS  354



>ref|XP_004231691.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=254

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKK EGFLY Y++G +V+IVC+CHG FL+PAEFVKHAGGGDV +PL+ I V P+
Sbjct  201  GKKTEGFLYAYKRGGDVKIVCICHGYFLTPAEFVKHAGGGDVENPLRLITVDPN  254



>ref|XP_004231669.2| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=264

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKK EGFLY Y++G EV+IVC+CHG FL+PAEF+KHAGGGDV +PL+ I V P+
Sbjct  211  GKKTEGFLYAYKRGGEVKIVCICHGYFLTPAEFIKHAGGGDVENPLRLIKVDPN  264



>ref|XP_010315690.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=241

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKKIEGF Y Y++G EV+IVC+CHG+FL+PA+FVKHAGGGDV +PL+ I V P+
Sbjct  188  GKKIEGFFYAYKRGGEVKIVCICHGHFLTPAQFVKHAGGGDVENPLRLINVDPN  241



>ref|XP_002887227.1| hypothetical protein ARALYDRAFT_894706 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63486.1| hypothetical protein ARALYDRAFT_894706 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV---SPSCLF  172
            GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FV HAGG  V HPL+HI+V   SPS L 
Sbjct  292  GKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVIHAGGPHVDHPLRHIVVNTSSPSNLL  351



>emb|CDY40905.1| BnaC06g30430D [Brassica napus]
Length=349

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+++G LYRY  GEEV+I+CVCHG+ LSPA+FVKHAGG  V HPL+HIIV+ S L
Sbjct  290  GKRVDGILYRYGNGEEVKIMCVCHGDILSPADFVKHAGGPHVDHPLRHIIVNTSSL  345



>ref|XP_007037582.1| RNA binding-like protein [Theobroma cacao]
 gb|EOY22083.1| RNA binding-like protein [Theobroma cacao]
Length=565

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+KIEGFLY+Y KG+ V IVCVCHGNFLSP EFVKHAGG DV +P+KHI V
Sbjct  509  GRKIEGFLYKYMKGQ-VSIVCVCHGNFLSPEEFVKHAGGKDVTNPMKHINV  558



>ref|XP_010315753.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=296

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKK EGFLY Y +G EV++VC+CHG FL+PAEF+KHAGGGDV +PL+ I V P+
Sbjct  243  GKKTEGFLYAYNRGGEVKMVCICHGYFLTPAEFIKHAGGGDVENPLRLINVDPN  296



>ref|XP_010317361.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=352

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GKK  GFLY Y++G EV+IVC+CHG FL+PAEFVKHAGGGDV +PL+ I V P+
Sbjct  299  GKKTGGFLYAYKRGGEVKIVCICHGYFLTPAEFVKHAGGGDVENPLRLITVDPN  352



>ref|XP_009148664.1| PREDICTED: ninja-family protein AFP2 [Brassica rapa]
 ref|XP_009148665.1| PREDICTED: ninja-family protein AFP2 [Brassica rapa]
Length=316

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRK-GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y K GEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  258  GRRVDGILYKYGKVGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  312



>emb|CDX98125.1| BnaA06g08760D [Brassica napus]
Length=319

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRK-GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y K GEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  261  GRRVDGILYKYGKVGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  315



>dbj|BAJ98416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            ++I+GFLY+Y + +EVRIVCVCHG+FL+P EFV HAGGG VA+P++HI+V+P
Sbjct  349  ERIDGFLYQYSRVDEVRIVCVCHGSFLTPTEFVAHAGGGKVANPMRHIVVNP  400



>emb|CDY36406.1| BnaC05g10070D [Brassica napus]
Length=292

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRK-GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G++++G LY+Y K GEEVRI+C+CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  234  GRRVDGILYKYGKVGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  288



>ref|XP_003522990.1| PREDICTED: ninja-family protein AFP3-like isoformX1 [Glycine 
max]
 ref|XP_006578540.1| PREDICTED: ninja-family protein AFP3-like isoform X5 [Glycine 
max]
 gb|KHN17353.1| Ninja-family protein AFP3 [Glycine soja]
Length=247

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  193  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  242



>sp|B6SLJ0.1|NNJA3_MAIZE RecName: Full=Ninja-family protein 3 [Zea mays]
 gb|ACG25723.1| hypothetical protein [Zea mays]
Length=262

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  207  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  257



>gb|KHN17830.1| Ninja-family protein AFP3 [Glycine soja]
Length=249

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  195  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  244



>gb|ACN33721.1| unknown [Zea mays]
Length=253

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  198  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  248



>ref|XP_006578537.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Glycine 
max]
 ref|XP_006578538.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Glycine 
max]
 ref|XP_006578539.1| PREDICTED: ninja-family protein AFP3-like isoform X4 [Glycine 
max]
Length=260

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  206  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  255



>ref|NP_001161740.1| hypothetical protein LOC100192929 isoform 2 [Zea mays]
 sp|B4FM28.1|NNJA2_MAIZE RecName: Full=Ninja-family protein 2 [Zea mays]
 gb|ACF83171.1| unknown [Zea mays]
Length=262

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  207  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  257



>ref|NP_001161741.1| hypothetical protein LOC100192929 isoform 3 [Zea mays]
 sp|B6UGG4.1|NNJA4_MAIZE RecName: Full=Ninja-family protein 4 [Zea mays]
 gb|ACG48447.1| hypothetical protein [Zea mays]
Length=260

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  205  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  255



>ref|XP_003527115.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Glycine 
max]
Length=249

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  195  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  244



>gb|ACU23969.1| unknown [Glycine max]
Length=249

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  195  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  244



>ref|XP_006582022.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Glycine 
max]
 ref|XP_006582023.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Glycine 
max]
Length=262

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +VA+P+KHI V
Sbjct  208  GKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKEVANPMKHITV  257



>gb|EMT27031.1| hypothetical protein F775_13020 [Aegilops tauschii]
Length=141

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV-SPSCL  169
            G +  GFLY+Y + +E+RI+CVCHG+FL+PAEFV+HAGGG VA+PL+ IIV +PS L
Sbjct  85   GMRTVGFLYQYSRVDELRIMCVCHGSFLTPAEFVEHAGGGQVANPLRSIIVKTPSWL  141



>gb|KEH18131.1| ninja-family protein AFP1 [Medicago truncatula]
Length=296

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK + GFLYRY K +EV IVCVCHG+  SPAEFV+HAGG D+ HPL+HI V+ S  
Sbjct  240  GKVVNGFLYRYSKCDEVSIVCVCHGSTFSPAEFVQHAGGTDITHPLRHITVNSSAF  295



>ref|XP_010105505.1| hypothetical protein L484_007123 [Morus notabilis]
 gb|EXC04891.1| hypothetical protein L484_007123 [Morus notabilis]
Length=314

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+I+GFLY+Y KG+ V IVCVCHGNFLSPAEFVKHAGG +V +P++HI V
Sbjct  259  GKRIDGFLYKYTKGQ-VSIVCVCHGNFLSPAEFVKHAGGKEVTNPMRHINV  308



>ref|XP_003599003.1| hypothetical protein MTR_3g025970 [Medicago truncatula]
Length=114

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLY+YR GE V IVCVCHG+FL+P EFV HAGG +VA+P+KHI V P
Sbjct  60   GKRIEGFLYKYRSGE-VCIVCVCHGSFLTPKEFVMHAGGKEVANPMKHITVYP  111



>ref|XP_007138357.1| hypothetical protein PHAVU_009G202000g [Phaseolus vulgaris]
 gb|ESW10351.1| hypothetical protein PHAVU_009G202000g [Phaseolus vulgaris]
Length=230

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK+IEGFLY+YR GE V IVCVCHG+FL+PAEFV HAGG +VA+P+KHI V
Sbjct  176  GKRIEGFLYKYRTGE-VCIVCVCHGSFLTPAEFVMHAGGKEVANPMKHITV  225



>ref|XP_008658076.1| PREDICTED: hypothetical protein LOC100192929 isoform X1 [Zea 
mays]
Length=391

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  336  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  386



>ref|NP_001131584.1| hypothetical protein LOC100192929 isoform 1 [Zea mays]
 sp|B4FAF3.1|NNJA1_MAIZE RecName: Full=Ninja-family protein 1 [Zea mays]
 gb|ACF79096.1| unknown [Zea mays]
 gb|ACF80050.1| unknown [Zea mays]
 gb|ACG38610.1| hypothetical protein [Zea mays]
 gb|AFW89199.1| hypothetical protein ZEAMMB73_953040 [Zea mays]
Length=393

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVS  157
            G ++EGFLY+Y KGE VRIVC+CHG+FL+P+EFV+HAG G V +PL+HI+VS
Sbjct  338  GSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVS  388



>ref|XP_002514649.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF47755.1| RNA binding protein, putative [Ricinus communis]
Length=155

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            G+KIEG LY+Y K  +V IVCVCHG+FLSPAEFV+HAGG +VA+P+KHI V  S  F
Sbjct  100  GRKIEGILYKYSK-SQVTIVCVCHGSFLSPAEFVRHAGGNNVANPMKHITVCSSFSF  155



>ref|XP_004510250.1| PREDICTED: uncharacterized protein LOC101492383 [Cicer arietinum]
Length=355

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK + GFLYRY K ++V IVCVCHG+  SPAEFV+HAGG D+ HPL+HI V
Sbjct  299  GKTVNGFLYRYSKSDQVTIVCVCHGSTFSPAEFVQHAGGTDITHPLRHITV  349



>ref|XP_006848485.1| hypothetical protein AMTR_s00013p00255370 [Amborella trichopoda]
 gb|ERN10066.1| hypothetical protein AMTR_s00013p00255370 [Amborella trichopoda]
Length=515

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK I GFLYRY KGE + IVCVCHG+FLSPAEFV+HAG  DV+ PLKHII++P+
Sbjct  460  GKTINGFLYRYTKGE-ISIVCVCHGSFLSPAEFVRHAGVTDVSQPLKHIIMAPT  512



>gb|AES69254.2| ninja-family protein AFP1 [Medicago truncatula]
Length=219

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  160
            GK+IEGFLY+YR GE V IVCVCHG+FL+P EFV HAGG +VA+P+KHI V P
Sbjct  165  GKRIEGFLYKYRSGE-VCIVCVCHGSFLTPKEFVMHAGGKEVANPMKHITVYP  216



>ref|XP_007049691.1| UPF0737 protein AFP3, putative [Theobroma cacao]
 gb|EOX93848.1| UPF0737 protein AFP3, putative [Theobroma cacao]
Length=440

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK I GFLYRY K  EV I+CVCHG+  +PAEFV+HAGG DV+HPL+HI V PS
Sbjct  386  GKTINGFLYRYTK-SEVSIICVCHGSSFTPAEFVQHAGGSDVSHPLRHITVIPS  438



>ref|XP_008240010.1| PREDICTED: ninja-family protein 1-like [Prunus mume]
Length=292

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+K EG LY+YR+G+ V I+C CHG+FLSPAEFVKHAGG +VA+PL+HII+
Sbjct  236  GRKTEGVLYKYRQGQ-VGILCACHGSFLSPAEFVKHAGGNEVANPLRHIII  285



>gb|KDP26350.1| hypothetical protein JCGZ_17508 [Jatropha curcas]
Length=465

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            G+ I GFLYRY K  EV I+CVCHG+  SPAEFV+HAGG DV+HPLKHI V PS
Sbjct  411  GRTINGFLYRYTK-TEVSIICVCHGSSFSPAEFVQHAGGTDVSHPLKHITVIPS  463



>ref|XP_004499859.1| PREDICTED: ninja-family protein AFP3-like [Cicer arietinum]
Length=223

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+IEGFLY+YR GE V IVCVCHG+FL+PAEFV HA G +VA+P+KHI V P  L
Sbjct  169  GKRIEGFLYKYRSGE-VCIVCVCHGSFLTPAEFVMHAEGKEVANPMKHITVYPVSL  223



>ref|XP_007208775.1| hypothetical protein PRUPE_ppa023628mg [Prunus persica]
 gb|EMJ09974.1| hypothetical protein PRUPE_ppa023628mg [Prunus persica]
Length=292

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+K EG LY+YR+G+ V I+C CHG+FLSPAEFVKHAGG +VA+PL+HII+
Sbjct  236  GRKTEGVLYKYRQGQ-VGILCACHGSFLSPAEFVKHAGGNEVANPLRHIII  285



>emb|CDX95951.1| BnaA07g27800D [Brassica napus]
Length=336

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+++G LYRY  GEEV+I+C CH + LSPA+FVKHAGG  V HPL+HIIV  S L
Sbjct  277  GKRVDGILYRYGNGEEVKIMCACHCDILSPADFVKHAGGPHVDHPLRHIIVDTSSL  332



>ref|XP_009105470.1| PREDICTED: ninja-family protein AFP1 [Brassica rapa]
Length=326

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK+++G LYRY  GEEV+I+C CH + LSPA+FVKHAGG  V HPL+HIIV  S L
Sbjct  267  GKRVDGILYRYGNGEEVKIMCACHCDILSPADFVKHAGGPHVDHPLRHIIVDTSSL  322



>ref|XP_007134133.1| hypothetical protein PHAVU_010G022000g [Phaseolus vulgaris]
 gb|ESW06127.1| hypothetical protein PHAVU_010G022000g [Phaseolus vulgaris]
Length=363

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK + GFLYRY K E V I+C CHG+  SPAEFV+HAGG D+ HPL+HI V PS L
Sbjct  308  GKTVNGFLYRYNKSE-VSIICACHGSTFSPAEFVQHAGGTDITHPLRHITVIPSAL  362



>gb|EYU44202.1| hypothetical protein MIMGU_mgv1a011530mg [Erythranthe guttata]
Length=278

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  172
            GKK+EGFLY+YRKG  V+IVCVCHG FL+PA+F+ H G  +V HPLKHI+V+P  LF
Sbjct  223  GKKVEGFLYKYRKGG-VKIVCVCHGLFLTPAQFLNHGGFHNVDHPLKHIVVNPFPLF  278



>gb|KHN27321.1| Ninja-family protein AFP3 [Glycine soja]
Length=289

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            G+ + GFLYRY K E V IVCVCHG+  SPAEFV+HAGG D  HPL+HI V PS  
Sbjct  234  GRTVNGFLYRYTKSE-VSIVCVCHGSTFSPAEFVQHAGGTDTTHPLRHITVIPSAF  288



>ref|XP_002531097.1| hypothetical protein RCOM_1417730 [Ricinus communis]
 gb|EEF31311.1| hypothetical protein RCOM_1417730 [Ricinus communis]
Length=639

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK I GFLYRY K  EV I+CVCHG+  SPAEFV+HAGG DV+HPL+HI V PS +
Sbjct  585  GKTINGFLYRYTK-TEVSIICVCHGSSFSPAEFVQHAGGTDVSHPLRHITVIPSAI  639



>gb|KJB50707.1| hypothetical protein B456_008G199500 [Gossypium raimondii]
Length=229

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+KI+GFLY+Y KG+ V IVCVCHGNFLSP EFV+HAG  DV +P+KHI V
Sbjct  173  GRKIQGFLYKYTKGQ-VCIVCVCHGNFLSPEEFVRHAGAKDVTNPMKHINV  222



>gb|KDO65985.1| hypothetical protein CISIN_1g011821mg [Citrus sinensis]
Length=477

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            GK I GFLYRY K  EV IVCVCHG   SPAEFV HAGG DV+ PLKHI V PS +
Sbjct  423  GKTINGFLYRYTK-TEVSIVCVCHGTSFSPAEFVLHAGGTDVSQPLKHITVIPSAI  477



>ref|XP_003520982.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=354

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  169
            G+ + GFLYRY K E V IVCVCHG+  SPAEFV+HAGG D  HPL+HI V PS  
Sbjct  299  GRTVNGFLYRYTKSE-VSIVCVCHGSTFSPAEFVQHAGGTDTTHPLRHITVIPSAF  353



>gb|KJB50705.1| hypothetical protein B456_008G199500 [Gossypium raimondii]
 gb|KJB50709.1| hypothetical protein B456_008G199500 [Gossypium raimondii]
 gb|KJB50710.1| hypothetical protein B456_008G199500 [Gossypium raimondii]
Length=309

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+KI+GFLY+Y KG+ V IVCVCHGNFLSP EFV+HAG  DV +P+KHI V
Sbjct  253  GRKIQGFLYKYTKGQ-VCIVCVCHGNFLSPEEFVRHAGAKDVTNPMKHINV  302



>ref|XP_008450871.1| PREDICTED: ninja-family protein 6-like isoform X1 [Cucumis melo]
Length=316

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHI  148
            G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA+PLKHI
Sbjct  258  GRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVANPLKHI  305



>ref|XP_008450949.1| PREDICTED: ninja-family protein 6-like isoform X2 [Cucumis melo]
Length=316

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHI  148
            G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA+PLKHI
Sbjct  258  GRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVANPLKHI  305



>gb|KHG19654.1| Ninja-family protein AFP3 [Gossypium arboreum]
Length=309

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            G+KI+GFLY+Y KG+ V IVCVCHGNFLSP EFV+HAG  DV +P+KHI V
Sbjct  253  GRKIQGFLYKYTKGQ-VCIVCVCHGNFLSPEEFVRHAGAKDVTNPMKHINV  302



>gb|KJB42530.1| hypothetical protein B456_007G156700 [Gossypium raimondii]
Length=405

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  154
            GK I GFLYRY K E V I+CVCHG+  SPAEFV+HAGG DV+HPL+HI V
Sbjct  348  GKTINGFLYRYTKSE-VSIICVCHGSLFSPAEFVQHAGGSDVSHPLRHITV  397



>ref|XP_004231689.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=262

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPL  139
            GKK EGFLY Y++G EV+IVC+CHG FL+PAEFVKHA GGDV +PL
Sbjct  210  GKKTEGFLYAYKRGGEVKIVCICHGYFLTPAEFVKHASGGDVENPL  255



>ref|XP_010906183.1| PREDICTED: ninja-family protein AFP3-like [Elaeis guineensis]
Length=150

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  163
            GK + GFLYRY K E V IVCVCHG+  SPAEFV+HAGG +++ PL+ I+V PS
Sbjct  98   GKTVTGFLYRYTKAE-VHIVCVCHGSSFSPAEFVRHAGGTNISQPLRQIVVVPS  150



>ref|XP_004137434.1| PREDICTED: ninja-family protein AFP2-like [Cucumis sativus]
 gb|KGN64057.1| hypothetical protein Csa_1G039230 [Cucumis sativus]
Length=314

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHI  148
            G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA+P+KHI
Sbjct  258  GRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVANPMKHI  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820