BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP006A03 244 bp,:Filtered

Length=244
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   49.3    1e-04   Nicotiana tomentosiformis
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   49.3    1e-04   Nicotiana tomentosiformis
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         49.3    1e-04   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   48.9    1e-04   Nicotiana sylvestris
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  48.9    2e-04   Nicotiana sylvestris
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       48.9    2e-04   Nicotiana sylvestris
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       48.9    2e-04   Nicotiana tomentosiformis
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  48.5    2e-04   Nicotiana tomentosiformis
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      47.8    4e-04   Solanum lycopersicum
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       47.0    7e-04   Eucalyptus grandis [rose gum]
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         46.6    0.001   Cicer arietinum [garbanzo]
gb|KJB63488.1|  hypothetical protein B456_010G002000                  46.6    0.001   Gossypium raimondii



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  750  EVSFRASSTTKEDLFGSITWTNGKYKVRSPFVV  782



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  724  EVSFRASSTTKEDLFGSITWTNGKYKVRSPFVV  756



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS  + ++FGSITWT+GKYKVRSP VV
Sbjct  734  EVSFKASSKPKEDLFGSITWTNGKYKVRSPFVV  766



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  751  EVSFRASSTTKEDMFGSITWTNGKYKVRSPFVV  783



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  725  EVSFRASSTTKEDMFGSITWTNGKYKVRSPFVV  757



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F ASS  + ++FGSITWT+GKYKVRSP VV
Sbjct  733  EVSFKASSPSKEDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   VTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
            V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  734  VSFKASSTSKEDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
            ++TF A+S LET +FGSITWT+G+YKVRSP VV
Sbjct  584  QLTFKATS-LETELFGSITWTNGRYKVRSPFVV  615



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             ++F ASS  + ++FGSITWT+GKYKVRSP V+
Sbjct  734  EMSFKASSKPKEDLFGSITWTNGKYKVRSPFVI  766



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
            +V  +  SS++ ++FGSITWT+G+YKVRSPIVV
Sbjct  728  QVVLSLQSSVKEDLFGSITWTNGQYKVRSPIVV  760



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  112
            +V F+++S+LE ++FGSITW++GK+ VRSP V+ +
Sbjct  734  KVVFSSTSTLEEDLFGSITWSNGKHSVRSPFVLAI  768



>gb|KJB63488.1| hypothetical protein B456_010G002000 [Gossypium raimondii]
Length=561

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    RVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  106
             V+F+A++ L+ ++FGSI W++GKYKVRSP  V
Sbjct  523  EVSFSAANPLKEDVFGSIAWSNGKYKVRSPFAV  555



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559512047520