BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005H06 397 bp,:Filtered

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787447.1|  PREDICTED: uncharacterized protein LOC104235394    108   2e-24   Nicotiana sylvestris
ref|XP_009605340.1|  PREDICTED: uncharacterized protein LOC104099910    107   2e-24   Nicotiana tomentosiformis
ref|XP_004231460.1|  PREDICTED: uncharacterized protein LOC101257515    103   1e-22   Solanum lycopersicum
ref|XP_009768111.1|  PREDICTED: uncharacterized protein LOC104219174    102   2e-22   Nicotiana sylvestris
gb|EYU40468.1|  hypothetical protein MIMGU_mgv1a001739mg                102   2e-22   Erythranthe guttata [common monkey flower]
gb|EYU38019.1|  hypothetical protein MIMGU_mgv1a001387mg                102   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_009590719.1|  PREDICTED: uncharacterized protein LOC104087857    102   3e-22   Nicotiana tomentosiformis
gb|KDP24731.1|  hypothetical protein JCGZ_25332                         100   6e-22   Jatropha curcas
ref|XP_010266120.1|  PREDICTED: uncharacterized protein LOC104603723    100   8e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006365304.1|  PREDICTED: uncharacterized protein LOC102602700    100   1e-21   Solanum tuberosum [potatoes]
ref|XP_009341563.1|  PREDICTED: uncharacterized protein LOC103933597  94.4    1e-21   Pyrus x bretschneideri [bai li]
ref|XP_008378030.1|  PREDICTED: uncharacterized protein LOC103441109  99.8    2e-21   Malus domestica [apple tree]
ref|XP_010530946.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_008236114.1|  PREDICTED: uncharacterized protein LOC103334905  98.6    4e-21   Prunus mume [ume]
ref|XP_002525750.1|  conserved hypothetical protein                   98.6    4e-21   Ricinus communis
ref|XP_007199711.1|  hypothetical protein PRUPE_ppa001587mg           98.2    5e-21   Prunus persica
ref|XP_008367426.1|  PREDICTED: uncharacterized protein LOC103431055  98.2    6e-21   Malus domestica [apple tree]
ref|XP_011088683.1|  PREDICTED: uncharacterized protein LOC105169840  98.2    6e-21   Sesamum indicum [beniseed]
ref|XP_009350609.1|  PREDICTED: uncharacterized protein LOC103942123  97.4    7e-21   Pyrus x bretschneideri [bai li]
ref|XP_008447869.1|  PREDICTED: uncharacterized protein LOC103490222  97.4    1e-20   Cucumis melo [Oriental melon]
ref|XP_004161036.1|  PREDICTED: uncharacterized protein LOC101231393  97.4    1e-20   
ref|XP_004144947.1|  PREDICTED: uncharacterized protein LOC101212808  97.4    1e-20   Cucumis sativus [cucumbers]
ref|XP_004249001.1|  PREDICTED: uncharacterized protein LOC101251428  97.4    1e-20   Solanum lycopersicum
ref|XP_004153581.1|  PREDICTED: uncharacterized protein LOC101216367  97.4    1e-20   
ref|XP_006384620.1|  hypothetical protein POPTR_0004s19350g           96.7    2e-20   Populus trichocarpa [western balsam poplar]
gb|KHG02196.1|  hypothetical protein F383_24299                       95.9    3e-20   Gossypium arboreum [tree cotton]
gb|KHG02195.1|  hypothetical protein F383_24299                       95.9    3e-20   Gossypium arboreum [tree cotton]
ref|XP_011458082.1|  PREDICTED: uncharacterized protein LOC101306595  95.9    4e-20   Fragaria vesca subsp. vesca
ref|XP_010103335.1|  hypothetical protein L484_014375                 95.9    4e-20   Morus notabilis
ref|XP_011045194.1|  PREDICTED: uncharacterized protein LOC105140...  95.5    4e-20   Populus euphratica
ref|XP_011045186.1|  PREDICTED: uncharacterized protein LOC105140...  95.5    4e-20   Populus euphratica
ref|XP_006364524.1|  PREDICTED: uncharacterized protein LOC102602...  95.5    5e-20   Solanum tuberosum [potatoes]
gb|AET01058.2|  BZIP transcription factor                             95.1    6e-20   Medicago truncatula
ref|XP_003618099.1|  BZIP transcription factor bZIP107                95.1    6e-20   
ref|XP_011092941.1|  PREDICTED: uncharacterized protein LOC105173003  95.1    6e-20   Sesamum indicum [beniseed]
emb|CBI37791.3|  unnamed protein product                              94.7    7e-20   Vitis vinifera
gb|KJB47752.1|  hypothetical protein B456_008G040200                  94.7    8e-20   Gossypium raimondii
ref|XP_006596578.1|  PREDICTED: uncharacterized protein LOC100797677  94.7    9e-20   
ref|XP_010526868.1|  PREDICTED: uncharacterized protein LOC104804308  94.7    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_002278825.1|  PREDICTED: uncharacterized protein LOC100264167  94.0    2e-19   Vitis vinifera
gb|KHG20272.1|  DNA-directed RNA polymerase subunit beta'             93.2    3e-19   Gossypium arboreum [tree cotton]
gb|KDO68276.1|  hypothetical protein CISIN_1g036103mg                 92.0    3e-19   Citrus sinensis [Valencia orange]
ref|XP_006575762.1|  PREDICTED: uncharacterized protein LOC778196     93.2    3e-19   Glycine max [soybeans]
ref|XP_007017991.1|  Uncharacterized protein isoform 2                92.4    3e-19   Theobroma cacao [chocolate]
emb|CDP14515.1|  unnamed protein product                              93.2    3e-19   Coffea canephora [robusta coffee]
ref|XP_002312913.1|  hypothetical protein POPTR_0009s14490g           93.2    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004491637.1|  PREDICTED: uncharacterized protein LOC101496...  92.8    4e-19   Cicer arietinum [garbanzo]
ref|XP_004491636.1|  PREDICTED: uncharacterized protein LOC101496...  92.4    5e-19   
ref|XP_011046294.1|  PREDICTED: uncharacterized protein LOC105140944  92.4    6e-19   Populus euphratica
ref|XP_007142561.1|  hypothetical protein PHAVU_008G291200g           92.4    6e-19   Phaseolus vulgaris [French bean]
ref|NP_565405.2|  uncharacterized protein                             92.0    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467462.1|  PREDICTED: uncharacterized protein LOC104747516  92.0    7e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007017990.1|  Uncharacterized protein isoform 1                91.7    9e-19   Theobroma cacao [chocolate]
ref|XP_009104109.1|  PREDICTED: uncharacterized protein LOC103830114  92.0    9e-19   Brassica rapa
ref|XP_002867084.1|  predicted protein                                91.7    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006435325.1|  hypothetical protein CICLE_v10000566mg           91.3    1e-18   Citrus clementina
emb|CAA18745.1|  putative protein                                     91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195250.2|  uncharacterized protein                             91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24171.1|  hypothetical protein F383_30825                       91.3    2e-18   Gossypium arboreum [tree cotton]
ref|XP_007227284.1|  hypothetical protein PRUPE_ppa017438mg           90.5    2e-18   Prunus persica
ref|XP_006412129.1|  hypothetical protein EUTSA_v10024384mg           91.3    2e-18   Eutrema salsugineum
ref|XP_006422465.1|  hypothetical protein CICLE_v10027792mg           90.9    2e-18   Citrus clementina
emb|CAN74079.1|  hypothetical protein VITISV_000980                   90.5    2e-18   Vitis vinifera
ref|XP_006486631.1|  PREDICTED: uncharacterized protein LOC102624434  90.9    2e-18   Citrus sinensis [Valencia orange]
gb|KHN29876.1|  hypothetical protein glysoja_039552                   90.5    2e-18   Glycine soja [wild soybean]
ref|XP_002886097.1|  hypothetical protein ARALYDRAFT_480593           90.5    2e-18   Arabidopsis lyrata subsp. lyrata
gb|KJB32731.1|  hypothetical protein B456_005G258200                  90.5    3e-18   Gossypium raimondii
ref|XP_007041654.1|  Uncharacterized protein TCM_006485               90.5    3e-18   Theobroma cacao [chocolate]
ref|XP_006297058.1|  hypothetical protein CARUB_v10013059mg           90.1    4e-18   Capsella rubella
gb|KJB15937.1|  hypothetical protein B456_002G205400                  89.4    7e-18   Gossypium raimondii
gb|KJB15935.1|  hypothetical protein B456_002G205400                  89.4    8e-18   Gossypium raimondii
ref|XP_010515622.1|  PREDICTED: uncharacterized protein LOC104791429  89.0    8e-18   Camelina sativa [gold-of-pleasure]
emb|CBI18874.3|  unnamed protein product                              88.2    2e-17   Vitis vinifera
emb|CDX76322.1|  BnaA08g10780D                                        88.2    2e-17   Brassica napus [oilseed rape]
gb|KFK40096.1|  hypothetical protein AALP_AA3G329900                  87.8    2e-17   Arabis alpina [alpine rockcress]
gb|KHG10498.1|  chromosome segregation suda                           88.2    2e-17   Gossypium arboreum [tree cotton]
ref|XP_010664089.1|  PREDICTED: uncharacterized protein LOC100250...  88.2    2e-17   Vitis vinifera
ref|XP_009108621.1|  PREDICTED: uncharacterized protein LOC103834...  88.2    2e-17   Brassica rapa
ref|XP_002284833.1|  PREDICTED: uncharacterized protein LOC100250...  87.8    2e-17   Vitis vinifera
ref|XP_009108620.1|  PREDICTED: uncharacterized protein LOC103834...  88.2    2e-17   Brassica rapa
emb|CDY17530.1|  BnaC03g65330D                                        87.8    2e-17   Brassica napus [oilseed rape]
emb|CDX69122.1|  BnaC01g03310D                                        87.8    2e-17   Brassica napus [oilseed rape]
gb|KDP36830.1|  hypothetical protein JCGZ_08121                       87.8    2e-17   Jatropha curcas
ref|XP_010536454.1|  PREDICTED: girdin                                87.0    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_009150859.1|  PREDICTED: uncharacterized protein LOC103874196  86.7    4e-17   Brassica rapa
emb|CDX88008.1|  BnaA06g25990D                                        86.7    5e-17   Brassica napus [oilseed rape]
ref|XP_006283094.1|  hypothetical protein CARUB_v10004111mg           86.7    6e-17   Capsella rubella
ref|XP_010242855.1|  PREDICTED: uncharacterized protein LOC104587099  86.3    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010437501.1|  PREDICTED: uncharacterized protein LOC104721261  86.3    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010446961.1|  PREDICTED: uncharacterized protein LOC104729685  85.9    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008448313.1|  PREDICTED: uncharacterized protein LOC103490...  85.5    1e-16   Cucumis melo [Oriental melon]
ref|XP_008448314.1|  PREDICTED: uncharacterized protein LOC103490...  85.5    2e-16   Cucumis melo [Oriental melon]
ref|XP_004140041.1|  PREDICTED: uncharacterized protein LOC101209035  85.1    2e-16   Cucumis sativus [cucumbers]
emb|CDY07877.1|  BnaC03g47450D                                        85.1    2e-16   Brassica napus [oilseed rape]
ref|XP_002300656.2|  hypothetical protein POPTR_0002s01300g           84.7    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007136143.1|  hypothetical protein PHAVU_009G021600g           84.7    3e-16   Phaseolus vulgaris [French bean]
ref|XP_010477296.1|  PREDICTED: uncharacterized protein LOC104756...  83.6    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002307776.2|  hypothetical protein POPTR_0005s27080g           83.6    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008387877.1|  PREDICTED: uncharacterized protein LOC103450325  83.6    6e-16   Malus domestica [apple tree]
ref|XP_011041260.1|  PREDICTED: uncharacterized protein LOC105137263  83.6    6e-16   Populus euphratica
ref|XP_008377093.1|  PREDICTED: uncharacterized protein LOC103440204  83.6    6e-16   Malus domestica [apple tree]
ref|XP_010477295.1|  PREDICTED: uncharacterized protein LOC104756...  83.6    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010498486.1|  PREDICTED: uncharacterized protein LOC104776171  83.2    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004292917.1|  PREDICTED: uncharacterized protein LOC101299932  82.8    8e-16   Fragaria vesca subsp. vesca
emb|CDY29526.1|  BnaA06g14440D                                        83.6    8e-16   Brassica napus [oilseed rape]
gb|KFK30164.1|  hypothetical protein AALP_AA7G225400                  83.2    9e-16   Arabis alpina [alpine rockcress]
ref|XP_010432310.1|  PREDICTED: uncharacterized protein LOC104716609  83.2    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009149628.1|  PREDICTED: uncharacterized protein LOC103872948  82.4    1e-15   Brassica rapa
ref|XP_003527645.1|  PREDICTED: uncharacterized protein LOC100787793  82.8    1e-15   Glycine max [soybeans]
gb|KJB57975.1|  hypothetical protein B456_009G188500                  82.8    1e-15   Gossypium raimondii
gb|KHN20126.1|  hypothetical protein glysoja_014704                   82.8    1e-15   Glycine soja [wild soybean]
ref|XP_006303171.1|  hypothetical protein CARUB_v10008623mg           82.4    1e-15   Capsella rubella
emb|CDY31475.1|  BnaC05g15840D                                        82.4    1e-15   Brassica napus [oilseed rape]
gb|KHG14730.1|  RING finger protein                                   82.4    1e-15   Gossypium arboreum [tree cotton]
ref|XP_010094591.1|  hypothetical protein L484_024887                 82.4    1e-15   Morus notabilis
ref|XP_010690263.1|  PREDICTED: uncharacterized protein LOC104903834  82.4    2e-15   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009336566.1|  PREDICTED: uncharacterized protein LOC103929136  81.3    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_011034901.1|  PREDICTED: uncharacterized protein LOC105132868  81.6    3e-15   Populus euphratica
gb|KEH36289.1|  DUF630 family protein                                 81.3    3e-15   Medicago truncatula
ref|XP_010028814.1|  PREDICTED: uncharacterized protein LOC104419015  81.3    5e-15   Eucalyptus grandis [rose gum]
ref|XP_003523534.1|  PREDICTED: uncharacterized protein LOC100815394  80.9    5e-15   Glycine max [soybeans]
ref|XP_004500892.1|  PREDICTED: uncharacterized protein LOC101491047  80.9    5e-15   Cicer arietinum [garbanzo]
ref|XP_010459737.1|  PREDICTED: uncharacterized protein LOC104740...  80.5    6e-15   Camelina sativa [gold-of-pleasure]
gb|KHN33814.1|  hypothetical protein glysoja_013820                   80.5    6e-15   Glycine soja [wild soybean]
ref|XP_010459736.1|  PREDICTED: uncharacterized protein LOC104740...  80.5    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002510652.1|  conserved hypothetical protein                   80.1    1e-14   Ricinus communis
gb|KFK44168.1|  hypothetical protein AALP_AA1G223500                  79.7    1e-14   Arabis alpina [alpine rockcress]
ref|XP_006416388.1|  hypothetical protein EUTSA_v10007083mg           79.7    1e-14   Eutrema salsugineum
ref|XP_003522575.1|  PREDICTED: uncharacterized protein LOC100782...  79.3    2e-14   Glycine max [soybeans]
gb|KHN35508.1|  hypothetical protein glysoja_044742                   79.3    2e-14   Glycine soja [wild soybean]
ref|XP_003527939.1|  PREDICTED: uncharacterized protein LOC100787627  77.8    8e-14   Glycine max [soybeans]
gb|KHN47007.1|  Protein disulfide-isomerase                           77.8    9e-14   Glycine soja [wild soybean]
ref|NP_173477.1|  uncharacterized protein                             77.0    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAF80644.1|AC069251_37  F2D10.1                                    74.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893116.1|  hypothetical protein ARALYDRAFT_312968           75.9    3e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_007137433.1|  hypothetical protein PHAVU_009G126600g           75.9    3e-13   Phaseolus vulgaris [French bean]
ref|XP_006828953.1|  hypothetical protein AMTR_s00001p00231880        75.1    4e-13   
ref|XP_004502488.1|  PREDICTED: uncharacterized protein LOC101512546  75.5    4e-13   Cicer arietinum [garbanzo]
gb|KGN47552.1|  hypothetical protein Csa_6G358160                     74.3    7e-13   Cucumis sativus [cucumbers]
ref|XP_008361511.1|  PREDICTED: uncharacterized protein LOC103425208  74.7    7e-13   
ref|XP_008464871.1|  PREDICTED: uncharacterized protein LOC103502...  74.3    9e-13   
ref|XP_008464870.1|  PREDICTED: uncharacterized protein LOC103502...  73.9    9e-13   Cucumis melo [Oriental melon]
gb|KEH35310.1|  DUF630 family protein                                 74.3    1e-12   Medicago truncatula
ref|XP_010935229.1|  PREDICTED: uncharacterized protein LOC105055178  70.9    2e-11   Elaeis guineensis
ref|XP_008781739.1|  PREDICTED: uncharacterized protein LOC103701465  70.1    3e-11   Phoenix dactylifera
ref|XP_010063118.1|  PREDICTED: uncharacterized protein LOC104450310  70.1    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010941397.1|  PREDICTED: uncharacterized protein LOC105059688  69.3    5e-11   Elaeis guineensis
ref|XP_006856710.1|  hypothetical protein AMTR_s00054p00177020        68.9    6e-11   Amborella trichopoda
gb|KDP46633.1|  hypothetical protein JCGZ_04567                       68.6    9e-11   Jatropha curcas
gb|KJB83421.1|  hypothetical protein B456_013G246900                  68.6    9e-11   Gossypium raimondii
ref|XP_010913768.1|  PREDICTED: uncharacterized protein LOC105039...  68.2    1e-10   Elaeis guineensis
ref|XP_010110717.1|  hypothetical protein L484_009205                 68.6    1e-10   Morus notabilis
gb|KJB83420.1|  hypothetical protein B456_013G246900                  68.2    1e-10   Gossypium raimondii
gb|KHG01672.1|  hypothetical protein F383_23132                       68.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_006453295.1|  hypothetical protein CICLE_v10007457mg           68.2    1e-10   Citrus clementina
ref|XP_007213633.1|  hypothetical protein PRUPE_ppa001853mg           68.2    1e-10   Prunus persica
ref|XP_010913766.1|  PREDICTED: uncharacterized protein LOC105039...  67.8    2e-10   Elaeis guineensis
emb|CBI40119.3|  unnamed protein product                              67.4    2e-10   Vitis vinifera
ref|XP_004292707.1|  PREDICTED: uncharacterized protein LOC101303966  67.8    2e-10   Fragaria vesca subsp. vesca
ref|XP_002453379.1|  hypothetical protein SORBIDRAFT_04g005030        67.4    2e-10   Sorghum bicolor [broomcorn]
ref|XP_007014353.1|  Uncharacterized protein isoform 1                67.4    2e-10   Theobroma cacao [chocolate]
ref|XP_002266764.1|  PREDICTED: uncharacterized protein LOC100245404  67.4    2e-10   Vitis vinifera
emb|CAN72045.1|  hypothetical protein VITISV_004545                   67.4    2e-10   Vitis vinifera
ref|XP_008223790.1|  PREDICTED: uncharacterized protein LOC103323567  67.4    2e-10   Prunus mume [ume]
ref|XP_008372262.1|  PREDICTED: uncharacterized protein LOC103435647  67.4    3e-10   Malus domestica [apple tree]
ref|XP_002527719.1|  conserved hypothetical protein                   67.4    3e-10   Ricinus communis
ref|XP_009334574.1|  PREDICTED: uncharacterized protein LOC103927383  67.4    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_004297892.1|  PREDICTED: uncharacterized protein LOC101298310  67.0    3e-10   Fragaria vesca subsp. vesca
ref|XP_007138789.1|  hypothetical protein PHAVU_009G237700g           67.0    3e-10   Phaseolus vulgaris [French bean]
ref|XP_010539656.1|  PREDICTED: uncharacterized protein LOC104813668  66.6    4e-10   Tarenaya hassleriana [spider flower]
gb|KFK40285.1|  hypothetical protein AALP_AA3G355000                  66.6    4e-10   Arabis alpina [alpine rockcress]
gb|EYU38760.1|  hypothetical protein MIMGU_mgv1a001690mg              66.6    5e-10   Erythranthe guttata [common monkey flower]
ref|XP_010415018.1|  PREDICTED: uncharacterized protein LOC104701085  66.2    5e-10   Camelina sativa [gold-of-pleasure]
emb|CDP15631.1|  unnamed protein product                              66.2    6e-10   Coffea canephora [robusta coffee]
ref|XP_011019979.1|  PREDICTED: uncharacterized protein LOC105122534  66.2    7e-10   Populus euphratica
ref|XP_010489454.1|  PREDICTED: uncharacterized protein LOC104767122  66.2    7e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002308122.1|  hypothetical protein POPTR_0006s07660g           65.9    7e-10   Populus trichocarpa [western balsam poplar]
emb|CDX82615.1|  BnaC07g02510D                                        65.9    7e-10   Brassica napus [oilseed rape]
ref|XP_010688436.1|  PREDICTED: uncharacterized protein LOC104902374  65.9    7e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010063403.1|  PREDICTED: uncharacterized protein LOC104450514  66.2    7e-10   Eucalyptus grandis [rose gum]
ref|XP_008680889.1|  PREDICTED: uncharacterized protein LOC103656015  65.9    7e-10   Zea mays [maize]
ref|XP_010467742.1|  PREDICTED: uncharacterized protein LOC104747751  65.9    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003610071.1|  Transcription factor bZIP106                     65.9    8e-10   
gb|KCW80885.1|  hypothetical protein EUGRSUZ_C02248                   65.5    9e-10   Eucalyptus grandis [rose gum]
gb|AES92268.2|  DUF630 family protein                                 65.9    9e-10   Medicago truncatula
ref|XP_004954692.1|  PREDICTED: uncharacterized protein LOC101785694  65.1    1e-09   Setaria italica
ref|XP_010929390.1|  PREDICTED: uncharacterized protein LOC105050877  65.5    1e-09   Elaeis guineensis
ref|XP_010048589.1|  PREDICTED: uncharacterized protein LOC104437347  65.5    1e-09   Eucalyptus grandis [rose gum]
ref|XP_006409086.1|  hypothetical protein EUTSA_v10022561mg           65.5    1e-09   Eutrema salsugineum
emb|CDY39136.1|  BnaA07g01320D                                        65.1    1e-09   Brassica napus [oilseed rape]
ref|XP_009102233.1|  PREDICTED: uncharacterized protein LOC103828380  65.1    1e-09   Brassica rapa
ref|XP_009408068.1|  PREDICTED: uncharacterized protein LOC103990598  65.1    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04672.1|  BnaC05g17100D                                        65.1    1e-09   Brassica napus [oilseed rape]
ref|XP_009149695.1|  PREDICTED: uncharacterized protein LOC103873018  65.1    2e-09   Brassica rapa
ref|XP_006416268.1|  hypothetical protein EUTSA_v10006728mg           65.1    2e-09   Eutrema salsugineum
ref|XP_008219621.1|  PREDICTED: uncharacterized protein LOC103319804  65.1    2e-09   Prunus mume [ume]
ref|XP_007227662.1|  hypothetical protein PRUPE_ppa001150mg           65.1    2e-09   Prunus persica
gb|KJB15218.1|  hypothetical protein B456_002G165300                  62.0    2e-09   Gossypium raimondii
ref|XP_009408191.1|  PREDICTED: uncharacterized protein LOC103990689  64.7    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW66328.1|  hypothetical protein ZEAMMB73_916371                  64.7    2e-09   Zea mays [maize]
ref|XP_004507886.1|  PREDICTED: uncharacterized protein LOC101505055  64.7    2e-09   Cicer arietinum [garbanzo]
emb|CDY08177.1|  BnaA06g15490D                                        64.7    2e-09   Brassica napus [oilseed rape]
emb|CCM72968.1|  protein of unknown function                          61.6    2e-09   Arabidopsis halleri subsp. halleri
ref|XP_006306696.1|  hypothetical protein CARUB_v10008218mg           64.7    2e-09   Capsella rubella
ref|XP_011077703.1|  PREDICTED: uncharacterized protein LOC105161647  64.3    2e-09   Sesamum indicum [beniseed]
emb|CCM73006.1|  protein of unknown function                          61.6    2e-09   Arabidopsis halleri subsp. gemmifera
emb|CCM72969.1|  protein of unknown function                          61.6    2e-09   Arabidopsis halleri subsp. halleri
emb|CCM73007.1|  protein of unknown function                          61.6    2e-09   Arabidopsis halleri subsp. gemmifera
ref|XP_003550653.1|  PREDICTED: uncharacterized protein LOC100776...  64.3    2e-09   
emb|CCM73008.1|  protein of unknown function                          61.2    2e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010498631.1|  PREDICTED: uncharacterized protein LOC104776294  64.3    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010477421.1|  PREDICTED: uncharacterized protein LOC104756514  64.3    3e-09   Camelina sativa [gold-of-pleasure]
gb|KHN17621.1|  hypothetical protein glysoja_005818                   64.3    3e-09   Glycine soja [wild soybean]
ref|XP_002300979.2|  hypothetical protein POPTR_0002s08250g           64.3    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010259879.1|  PREDICTED: uncharacterized protein LOC104599165  64.3    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007019109.1|  Uncharacterized protein TCM_035147               64.3    3e-09   Theobroma cacao [chocolate]
emb|CBI19002.3|  unnamed protein product                              63.9    4e-09   Vitis vinifera
ref|XP_002284506.1|  PREDICTED: uncharacterized protein LOC100254101  63.9    4e-09   Vitis vinifera
emb|CAN81539.1|  hypothetical protein VITISV_026340                   63.9    4e-09   Vitis vinifera
gb|KHN22673.1|  hypothetical protein glysoja_027561                   63.5    4e-09   Glycine soja [wild soybean]
gb|AAD12027.1|  hypothetical protein                                  63.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010999400.1|  PREDICTED: uncharacterized protein LOC105107244  63.5    5e-09   Populus euphratica
ref|XP_003543739.1|  PREDICTED: uncharacterized protein LOC100818...  63.5    5e-09   Glycine max [soybeans]
ref|XP_009112579.1|  PREDICTED: uncharacterized protein LOC103837...  63.5    5e-09   Brassica rapa
ref|XP_009112577.1|  PREDICTED: uncharacterized protein LOC103837...  63.5    5e-09   Brassica rapa
ref|XP_010541139.1|  PREDICTED: uncharacterized protein LOC104814668  63.5    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_004148319.1|  PREDICTED: uncharacterized protein LOC101219989  63.5    5e-09   
ref|XP_010095406.1|  hypothetical protein L484_013362                 63.5    5e-09   Morus notabilis
gb|KGN61160.1|  hypothetical protein Csa_2G060410                     63.5    5e-09   Cucumis sativus [cucumbers]
ref|NP_179499.2|  uncharacterized protein                             63.2    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004163025.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.2    6e-09   
gb|KHN35792.1|  hypothetical protein glysoja_013217                   63.2    6e-09   Glycine soja [wild soybean]
gb|KJB59267.1|  hypothetical protein B456_009G246800                  63.2    7e-09   Gossypium raimondii
ref|XP_003534891.1|  PREDICTED: uncharacterized protein LOC100775...  63.2    7e-09   Glycine max [soybeans]
emb|CCM73003.1|  protein of unknown function                          60.1    7e-09   Arabidopsis halleri subsp. halleri
ref|XP_002890461.1|  hypothetical protein ARALYDRAFT_472413           63.2    7e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010459896.1|  PREDICTED: uncharacterized protein LOC104740870  63.2    7e-09   Camelina sativa [gold-of-pleasure]
gb|EPS69223.1|  hypothetical protein M569_05540                       63.2    7e-09   Genlisea aurea
gb|KJB59268.1|  hypothetical protein B456_009G246800                  63.2    7e-09   Gossypium raimondii
emb|CDX87516.1|  BnaA07g33570D                                        62.4    7e-09   Brassica napus [oilseed rape]
gb|ACC68166.1|  unknown                                               63.2    8e-09   Arabidopsis halleri subsp. halleri
ref|XP_002884177.1|  hypothetical protein ARALYDRAFT_480823           63.2    8e-09   Arabidopsis lyrata subsp. lyrata
emb|CDX88372.1|  BnaC06g38160D                                        62.8    8e-09   Brassica napus [oilseed rape]
ref|NP_173593.1|  uncharacterized protein                             62.8    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65905.1|  hypothetical protein M569_08874                       62.8    9e-09   Genlisea aurea
ref|XP_008451443.1|  PREDICTED: uncharacterized protein LOC103492734  62.8    9e-09   Cucumis melo [Oriental melon]
gb|KEH37419.1|  DUF630 family protein                                 62.8    9e-09   Medicago truncatula
gb|KHN15320.1|  hypothetical protein glysoja_026615                   62.8    9e-09   Glycine soja [wild soybean]
ref|XP_003547444.1|  PREDICTED: uncharacterized protein LOC100780704  62.8    9e-09   Glycine max [soybeans]
ref|XP_003594980.1|  BZIP transcription factor bZIP82                 62.8    9e-09   
ref|XP_009336426.1|  PREDICTED: uncharacterized protein LOC103929008  62.8    9e-09   Pyrus x bretschneideri [bai li]
gb|AES65231.2|  DUF630 family protein                                 62.8    1e-08   Medicago truncatula
ref|XP_009106406.1|  PREDICTED: uncharacterized protein LOC103832...  62.4    1e-08   Brassica rapa
ref|XP_009106405.1|  PREDICTED: uncharacterized protein LOC103832...  62.4    1e-08   Brassica rapa
ref|XP_009106404.1|  PREDICTED: uncharacterized protein LOC103832...  62.4    1e-08   Brassica rapa
ref|XP_002307441.2|  hypothetical protein POPTR_0005s20130g           62.4    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006363013.1|  PREDICTED: uncharacterized protein LOC102593432  62.4    1e-08   Solanum tuberosum [potatoes]
ref|XP_004243552.1|  PREDICTED: uncharacterized protein LOC101254220  62.4    1e-08   Solanum lycopersicum
ref|XP_004161185.1|  PREDICTED: uncharacterized protein LOC101228924  62.4    1e-08   
ref|XP_004142702.1|  PREDICTED: uncharacterized protein LOC101217905  62.4    1e-08   
ref|XP_008444173.1|  PREDICTED: uncharacterized protein LOC103487594  62.4    1e-08   
gb|KGN54556.1|  hypothetical protein Csa_4G361900                     62.4    1e-08   Cucumis sativus [cucumbers]
ref|XP_008391622.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    1e-08   
ref|XP_007154731.1|  hypothetical protein PHAVU_003G142800g           62.4    1e-08   Phaseolus vulgaris [French bean]
ref|XP_006850921.1|  hypothetical protein AMTR_s00025p00180200        62.4    1e-08   Amborella trichopoda
ref|XP_004957549.1|  PREDICTED: uncharacterized protein LOC101772362  62.4    1e-08   Setaria italica
ref|XP_010263219.1|  PREDICTED: uncharacterized protein LOC104601549  62.0    2e-08   Nelumbo nucifera [Indian lotus]
emb|CDY28161.1|  BnaA01g06880D                                        59.3    2e-08   Brassica napus [oilseed rape]
tpg|DAA40690.1|  TPA: hypothetical protein ZEAMMB73_156394            62.0    2e-08   Zea mays [maize]
emb|CDP10928.1|  unnamed protein product                              62.0    2e-08   Coffea canephora [robusta coffee]
ref|XP_010243493.1|  PREDICTED: uncharacterized protein LOC104587543  62.0    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011069512.1|  PREDICTED: uncharacterized protein LOC105155337  61.6    2e-08   Sesamum indicum [beniseed]
ref|XP_009613914.1|  PREDICTED: uncharacterized protein LOC104106953  61.6    2e-08   Nicotiana tomentosiformis
ref|XP_002460609.1|  hypothetical protein SORBIDRAFT_02g031860        61.6    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006299799.1|  hypothetical protein CARUB_v10015995mg           61.6    2e-08   Capsella rubella
gb|EPS73984.1|  hypothetical protein M569_00764                       61.6    2e-08   Genlisea aurea
ref|NP_001062261.1|  Os08g0519700                                     58.5    2e-08   
ref|XP_009391038.1|  PREDICTED: uncharacterized protein LOC103977...  61.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487966.1|  PREDICTED: uncharacterized protein LOC101503248  61.2    3e-08   Cicer arietinum [garbanzo]
emb|CDY41788.1|  BnaC02g13680D                                        61.2    3e-08   
ref|XP_003572403.2|  PREDICTED: YLP motif-containing protein 1-like   61.2    3e-08   
ref|XP_009391037.1|  PREDICTED: uncharacterized protein LOC103977...  61.2    3e-08   
gb|EAZ07655.1|  hypothetical protein OsI_29908                        61.6    3e-08   
ref|XP_006644314.1|  PREDICTED: uncharacterized protein LOC102718120  61.2    3e-08   
gb|KJB15938.1|  hypothetical protein B456_002G205400                  61.2    3e-08   
ref|XP_006660288.1|  PREDICTED: uncharacterized protein LOC102722518  61.2    3e-08   
gb|EMS52673.1|  hypothetical protein TRIUR3_25202                     61.2    3e-08   
ref|XP_009409753.1|  PREDICTED: uncharacterized protein LOC103991932  60.8    4e-08   
ref|NP_194742.1|  uncharacterized protein                             60.8    4e-08   
emb|CDX68628.1|  BnaC01g08250D                                        60.8    4e-08   
ref|XP_011027508.1|  PREDICTED: uncharacterized protein LOC105127...  60.8    4e-08   
ref|XP_011027507.1|  PREDICTED: uncharacterized protein LOC105127...  60.8    4e-08   
gb|KFK44283.1|  hypothetical protein AALP_AA1G238200                  60.8    4e-08   
ref|XP_002887687.1|  hypothetical protein ARALYDRAFT_476915           60.8    5e-08   
ref|XP_008378436.1|  PREDICTED: uncharacterized protein LOC103441537  60.5    5e-08   
ref|XP_010433027.1|  PREDICTED: uncharacterized protein LOC104717...  60.5    5e-08   
ref|NP_177874.1|  uncharacterized protein                             60.5    5e-08   
ref|XP_010433026.1|  PREDICTED: uncharacterized protein LOC104717...  60.5    6e-08   
ref|XP_008653055.1|  PREDICTED: putative DNA helicase INO80 isofo...  60.5    6e-08   
ref|XP_004973959.1|  PREDICTED: uncharacterized protein LOC101780...  60.1    6e-08   
tpg|DAA62660.1|  TPA: hypothetical protein ZEAMMB73_968005            60.5    6e-08   
ref|XP_002444742.1|  hypothetical protein SORBIDRAFT_07g026940        60.1    6e-08   
ref|XP_008653054.1|  PREDICTED: uncharacterized protein LOC103633...  60.5    6e-08   
ref|XP_002869395.1|  hypothetical protein ARALYDRAFT_491740           60.1    8e-08   
gb|EMT13936.1|  hypothetical protein F775_24236                       58.9    8e-08   
ref|XP_009792413.1|  PREDICTED: uncharacterized protein LOC104239475  59.7    8e-08   
ref|XP_008798140.1|  PREDICTED: uncharacterized protein LOC103713113  59.7    8e-08   
ref|XP_010943939.1|  PREDICTED: uncharacterized protein LOC105061549  59.7    9e-08   
ref|XP_010905438.1|  PREDICTED: uncharacterized protein LOC105032641  59.7    1e-07   
gb|EAY74707.1|  hypothetical protein OsI_02600                        59.3    1e-07   
ref|XP_010911407.1|  PREDICTED: uncharacterized protein LOC105037440  59.3    1e-07   
ref|XP_008804991.1|  PREDICTED: uncharacterized protein LOC103718...  59.3    1e-07   
ref|XP_009128059.1|  PREDICTED: uncharacterized protein LOC103852916  58.9    2e-07   
ref|XP_008801451.1|  PREDICTED: keratin, type II cytoskeletal 1       58.9    2e-07   
gb|EMS49762.1|  hypothetical protein TRIUR3_19434                     58.5    2e-07   
ref|XP_006390082.1|  hypothetical protein EUTSA_v10018106mg           58.9    2e-07   
ref|XP_010927207.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.9    2e-07   
ref|NP_001043426.1|  Os01g0585600                                     58.9    2e-07   
gb|EEE54881.1|  hypothetical protein OsJ_02382                        58.9    2e-07   
gb|AFW61506.1|  hypothetical protein ZEAMMB73_167223                  58.9    2e-07   
ref|XP_008804994.1|  PREDICTED: uncharacterized protein LOC103718...  58.9    2e-07   
ref|XP_006434225.1|  hypothetical protein CICLE_v10000180mg           58.9    2e-07   
ref|XP_002538308.1|  hypothetical protein RCOM_1840540                57.4    2e-07   
ref|XP_010447764.1|  PREDICTED: uncharacterized protein LOC104730309  58.5    2e-07   
ref|XP_010438215.1|  PREDICTED: uncharacterized protein LOC104721846  58.5    2e-07   
ref|XP_007146081.1|  hypothetical protein PHAVU_006G011000g           58.2    3e-07   
gb|EMT30605.1|  hypothetical protein F775_00567                       58.5    3e-07   
ref|XP_007146080.1|  hypothetical protein PHAVU_006G011000g           58.2    3e-07   
gb|KDO80599.1|  hypothetical protein CISIN_1g002249mg                 58.2    3e-07   
ref|XP_006472799.1|  PREDICTED: uncharacterized protein LOC102610149  58.2    3e-07   
emb|CDX71474.1|  BnaC04g17090D                                        57.8    4e-07   
gb|KFK42143.1|  hypothetical protein AALP_AA2G216900                  58.2    4e-07   
ref|XP_004969399.1|  PREDICTED: uncharacterized protein LOC101757...  57.8    4e-07   
ref|XP_010238463.1|  PREDICTED: uncharacterized protein LOC100823419  57.8    4e-07   
gb|AFW72734.1|  hypothetical protein ZEAMMB73_697028                  57.8    4e-07   
ref|XP_009390292.1|  PREDICTED: uncharacterized protein LOC103976714  57.8    5e-07   
ref|XP_009103575.1|  PREDICTED: uncharacterized protein LOC103829648  57.4    5e-07   
ref|XP_008646044.1|  PREDICTED: uncharacterized protein LOC103627530  57.4    5e-07   
emb|CDY04477.1|  BnaA07g13030D                                        57.4    5e-07   
ref|XP_006593607.1|  PREDICTED: uncharacterized protein LOC100779...  57.4    6e-07   
ref|NP_001063849.1|  Os09g0547300                                     57.4    6e-07   
ref|XP_006593606.1|  PREDICTED: uncharacterized protein LOC100779...  57.4    6e-07   
dbj|BAJ85200.1|  predicted protein                                    57.0    7e-07   
ref|XP_006412747.1|  hypothetical protein EUTSA_v10024537mg           57.0    7e-07   
ref|XP_010268975.1|  PREDICTED: uncharacterized protein LOC104605784  57.0    7e-07   
gb|ABK94129.1|  unknown                                               56.6    7e-07   
gb|EMT31600.1|  hypothetical protein F775_01622                       57.0    8e-07   
ref|XP_007141574.1|  hypothetical protein PHAVU_008G207400g           57.0    8e-07   
ref|XP_010548603.1|  PREDICTED: uncharacterized protein LOC104819...  56.6    8e-07   
ref|XP_010548598.1|  PREDICTED: uncharacterized protein LOC104819...  57.0    8e-07   
ref|XP_010907649.1|  PREDICTED: uncharacterized protein LOC105034...  56.6    9e-07   
ref|XP_010907650.1|  PREDICTED: uncharacterized protein LOC105034...  56.2    1e-06   
ref|XP_004486732.1|  PREDICTED: uncharacterized protein LOC101506...  56.6    1e-06   
ref|XP_006293746.1|  hypothetical protein CARUB_v10022708mg           56.6    1e-06   
ref|XP_011030972.1|  PREDICTED: uncharacterized protein LOC105130262  56.2    1e-06   
ref|XP_006408664.1|  hypothetical protein EUTSA_v10001916mg           56.2    1e-06   
ref|XP_010521606.1|  PREDICTED: uncharacterized protein LOC104800492  56.2    1e-06   
ref|NP_180277.1|  uncharacterized protein                             56.2    1e-06   
ref|XP_003617082.1|  BZIP transcription factor bZIP114                56.2    1e-06   
ref|XP_009419692.1|  PREDICTED: uncharacterized protein LOC103999621  56.2    1e-06   
ref|XP_010426683.1|  PREDICTED: uncharacterized protein LOC104711...  56.2    1e-06   
ref|XP_010515532.1|  PREDICTED: uncharacterized protein LOC104791366  56.2    1e-06   
ref|XP_010503820.1|  PREDICTED: uncharacterized protein LOC104780964  56.2    1e-06   
ref|XP_010510816.1|  PREDICTED: uncharacterized protein LOC104787...  56.2    1e-06   
gb|AET00041.2|  BZIP transcription factor                             56.2    1e-06   
ref|XP_008646506.1|  PREDICTED: uncharacterized protein LOC103627992  55.8    1e-06   
ref|XP_002880877.1|  hypothetical protein ARALYDRAFT_481592           56.2    1e-06   
ref|XP_007048543.1|  Uncharacterized protein TCM_001604               56.2    1e-06   
ref|XP_010473097.1|  PREDICTED: uncharacterized protein LOC104752607  56.2    1e-06   
ref|XP_002521654.1|  conserved hypothetical protein                   56.2    1e-06   
ref|XP_010510817.1|  PREDICTED: uncharacterized protein LOC104787...  56.2    1e-06   
ref|XP_011006527.1|  PREDICTED: uncharacterized protein LOC105112503  56.2    1e-06   
gb|KEH35111.1|  BZIP transcription factor                             56.2    1e-06   
gb|EAY95166.1|  hypothetical protein OsI_16984                        55.8    2e-06   
ref|XP_004501975.1|  PREDICTED: uncharacterized protein LOC101512544  55.8    2e-06   
ref|NP_001053560.1|  Os04g0562800                                     55.8    2e-06   
ref|XP_010426682.1|  PREDICTED: uncharacterized protein LOC104711...  55.8    2e-06   
emb|CAN75994.1|  hypothetical protein VITISV_005354                   55.5    2e-06   
ref|XP_010243726.1|  PREDICTED: uncharacterized protein LOC104587...  55.8    2e-06   
ref|XP_010243725.1|  PREDICTED: uncharacterized protein LOC104587...  55.8    2e-06   
ref|XP_010231954.1|  PREDICTED: uncharacterized protein LOC100827...  55.5    2e-06   
ref|XP_003569275.1|  PREDICTED: uncharacterized protein LOC100827...  55.5    2e-06   
emb|CBI24357.3|  unnamed protein product                              55.5    2e-06   
ref|XP_009392341.1|  PREDICTED: uncharacterized protein LOC103978309  55.5    2e-06   
ref|XP_002876080.1|  proline-rich family protein                      55.5    2e-06   
emb|CAB62651.1|  putative protein                                     55.5    2e-06   
ref|XP_004515356.1|  PREDICTED: uncharacterized protein LOC101490151  55.5    2e-06   
ref|NP_190697.2|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1     55.5    2e-06   
ref|XP_006290733.1|  hypothetical protein CARUB_v10016827mg           55.5    3e-06   
ref|XP_010526651.1|  PREDICTED: uncharacterized protein LOC104804158  55.1    3e-06   
ref|XP_002273628.1|  PREDICTED: uncharacterized protein LOC100264970  55.5    3e-06   
ref|NP_001190052.1|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1  55.5    3e-06   
ref|XP_002307100.1|  hypothetical protein POPTR_0005s07940g           55.1    3e-06   
ref|XP_006300721.1|  hypothetical protein CARUB_v10019768mg           55.1    3e-06   
gb|KHN26029.1|  hypothetical protein glysoja_038251                   55.1    3e-06   
ref|XP_011080509.1|  PREDICTED: uncharacterized protein LOC105163756  55.1    3e-06   
ref|XP_002299694.2|  hypothetical protein POPTR_0001s18130g           55.1    3e-06   
ref|XP_007048000.1|  HAT transposon superfamily isoform 2             54.7    3e-06   
ref|XP_003545492.1|  PREDICTED: uncharacterized protein LOC778156     55.1    3e-06   
ref|XP_008453799.1|  PREDICTED: uncharacterized protein LOC103494417  55.1    3e-06   
ref|XP_002989601.1|  hypothetical protein SELMODRAFT_447743           55.1    3e-06   
ref|XP_010261252.1|  PREDICTED: uncharacterized protein LOC104600...  54.7    4e-06   
ref|XP_010428828.1|  PREDICTED: uncharacterized protein LOC104713417  55.1    4e-06   
ref|XP_010471944.1|  PREDICTED: uncharacterized protein LOC104751646  55.1    4e-06   
ref|XP_010691307.1|  PREDICTED: uncharacterized protein LOC104904665  55.1    4e-06   
ref|XP_009344392.1|  PREDICTED: uncharacterized protein LOC103936...  54.7    4e-06   
ref|XP_010261247.1|  PREDICTED: uncharacterized protein LOC104600...  54.7    4e-06   
emb|CAH67171.1|  H0211B05.8                                           54.7    4e-06   
ref|XP_003518464.1|  PREDICTED: uncharacterized protein LOC100809...  54.7    4e-06   
gb|KHN38439.1|  hypothetical protein glysoja_004104                   54.7    4e-06   
ref|XP_007047999.1|  HAT transposon superfamily isoform 1             54.7    4e-06   
ref|XP_010098052.1|  hypothetical protein L484_026183                 54.7    4e-06   
ref|XP_002986032.1|  hypothetical protein SELMODRAFT_425043           54.7    4e-06   
ref|XP_002455853.1|  hypothetical protein SORBIDRAFT_03g026230        54.7    4e-06   
ref|XP_011007598.1|  PREDICTED: uncharacterized protein LOC105113217  54.7    5e-06   
ref|XP_009361552.1|  PREDICTED: uncharacterized protein LOC103951820  51.6    5e-06   
ref|XP_008810999.1|  PREDICTED: uncharacterized protein LOC103722...  54.3    5e-06   
ref|XP_010090541.1|  hypothetical protein L484_016591                 54.3    5e-06   
ref|XP_011090236.1|  PREDICTED: uncharacterized protein LOC105170964  54.3    6e-06   
ref|XP_006384761.1|  hypothetical protein POPTR_0004s20860g           54.3    6e-06   
gb|KDP42900.1|  hypothetical protein JCGZ_23842                       54.3    6e-06   
ref|XP_007208069.1|  hypothetical protein PRUPE_ppa001740mg           54.3    6e-06   
ref|XP_008383423.1|  PREDICTED: uncharacterized protein LOC103446128  53.9    6e-06   
ref|XP_011096879.1|  PREDICTED: uncharacterized protein LOC105175929  54.3    6e-06   
ref|XP_009627348.1|  PREDICTED: uncharacterized protein LOC104117918  53.5    6e-06   
ref|XP_008361470.1|  PREDICTED: uncharacterized protein LOC103425176  53.9    6e-06   
ref|XP_008813601.1|  PREDICTED: uncharacterized protein LOC103724193  54.3    7e-06   
ref|XP_008646600.1|  PREDICTED: vegetative cell wall protein gp1-...  52.8    7e-06   
ref|XP_010689398.1|  PREDICTED: uncharacterized protein LOC104903109  53.9    7e-06   
ref|XP_007159634.1|  hypothetical protein PHAVU_002G254100g           53.9    7e-06   
ref|XP_010416694.1|  PREDICTED: uncharacterized protein LOC104702533  53.9    7e-06   
gb|KJB40973.1|  hypothetical protein B456_007G085700                  53.9    7e-06   
ref|XP_008449860.1|  PREDICTED: uncharacterized protein LOC103491612  53.9    8e-06   
ref|XP_004165478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.9    8e-06   
ref|XP_004149654.1|  PREDICTED: uncharacterized protein LOC101220706  53.9    8e-06   
emb|CBI14821.3|  unnamed protein product                              53.9    8e-06   
ref|XP_009786426.1|  PREDICTED: uncharacterized protein LOC104234...  53.9    8e-06   
ref|XP_002516075.1|  conserved hypothetical protein                   53.9    8e-06   
ref|XP_011001614.1|  PREDICTED: uncharacterized protein LOC105108845  53.9    8e-06   
ref|XP_002304192.2|  hypothetical protein POPTR_0003s05350g           53.5    9e-06   
ref|NP_001146678.1|  uncharacterized protein LOC100280278             53.5    9e-06   
ref|XP_004957489.1|  PREDICTED: uncharacterized protein LOC101781416  53.5    9e-06   
ref|XP_008676695.1|  PREDICTED: uncharacterized protein LOC100217...  53.5    9e-06   
ref|XP_008385608.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    9e-06   
ref|XP_008651371.1|  PREDICTED: uncharacterized protein LOC100280...  53.5    9e-06   
ref|XP_010544315.1|  PREDICTED: uncharacterized protein LOC104816964  53.5    9e-06   
dbj|BAD25922.1|  leucine zipper protein-like                          53.5    1e-05   
gb|KFK34370.1|  hypothetical protein AALP_AA5G136500                  53.5    1e-05   
ref|XP_008383425.1|  PREDICTED: uncharacterized protein LOC103446...  53.5    1e-05   
gb|EAZ08839.1|  hypothetical protein OsI_31101                        53.5    1e-05   
gb|EAZ44492.1|  hypothetical protein OsJ_29110                        53.5    1e-05   
ref|XP_006397664.1|  hypothetical protein EUTSA_v10001315mg           53.5    1e-05   
ref|XP_009786427.1|  PREDICTED: uncharacterized protein LOC104234...  53.1    1e-05   
gb|KDP33297.1|  hypothetical protein JCGZ_13084                       53.1    1e-05   
ref|XP_004979657.1|  PREDICTED: uncharacterized protein LOC101769040  53.1    1e-05   
ref|XP_008675404.1|  PREDICTED: uncharacterized protein LOC103651534  53.1    1e-05   
ref|XP_002460581.1|  hypothetical protein SORBIDRAFT_02g031210        53.1    1e-05   
emb|CDP18480.1|  unnamed protein product                              53.1    1e-05   
ref|XP_008385611.1|  PREDICTED: uncharacterized protein LOC103448142  52.8    1e-05   
ref|XP_006837374.1|  hypothetical protein AMTR_s00111p00120840        53.1    1e-05   
ref|XP_006341679.1|  PREDICTED: uncharacterized protein LOC102589286  53.1    1e-05   
gb|AFO63282.1|  bZIP2                                                 53.1    2e-05   
gb|KJB18187.1|  hypothetical protein B456_003G038100                  52.8    2e-05   
gb|EPS60621.1|  hypothetical protein M569_14181                       52.8    2e-05   
gb|KDO66391.1|  hypothetical protein CISIN_1g004364mg                 52.4    2e-05   
ref|XP_004146924.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    2e-05   
ref|XP_010236290.1|  PREDICTED: uncharacterized protein LOC104583946  52.8    2e-05   
ref|XP_009406823.1|  PREDICTED: uncharacterized protein LOC103989637  52.8    2e-05   
ref|XP_004168010.1|  PREDICTED: uncharacterized LOC101210456          52.8    2e-05   
gb|EYU19135.1|  hypothetical protein MIMGU_mgv1a002741mg              52.8    2e-05   
ref|XP_003558025.1|  PREDICTED: uncharacterized protein LOC100843292  52.8    2e-05   
gb|KHG20396.1|  Ferric uptake regulation                              52.8    2e-05   
ref|XP_009628236.1|  PREDICTED: uncharacterized protein LOC104118...  52.8    2e-05   
ref|XP_004235711.1|  PREDICTED: uncharacterized protein LOC101250783  52.8    2e-05   
gb|KHG02568.1|  U-box domain-containing 43 -like protein              52.8    2e-05   
ref|XP_010931963.1|  PREDICTED: uncharacterized protein LOC105052734  52.8    2e-05   
gb|KJB18186.1|  hypothetical protein B456_003G038100                  52.8    2e-05   
ref|XP_010647502.1|  PREDICTED: uncharacterized protein LOC100245...  52.8    2e-05   
gb|KDO66390.1|  hypothetical protein CISIN_1g004364mg                 52.4    2e-05   
ref|XP_002306282.2|  hypothetical protein POPTR_0005s07120g           52.8    2e-05   
gb|EEE69119.1|  hypothetical protein OsJ_28204                        52.4    2e-05   
gb|KDO66388.1|  hypothetical protein CISIN_1g004364mg                 52.0    2e-05   
ref|XP_010254134.1|  PREDICTED: uncharacterized protein LOC104595215  52.4    2e-05   
ref|XP_004491177.1|  PREDICTED: uncharacterized protein LOC101511610  52.4    3e-05   
ref|XP_010647501.1|  PREDICTED: uncharacterized protein LOC100245...  52.4    3e-05   
ref|XP_009133690.1|  PREDICTED: uncharacterized protein LOC103858146  52.4    3e-05   
ref|XP_011459456.1|  PREDICTED: uncharacterized protein LOC101301...  52.4    3e-05   
ref|XP_004291725.1|  PREDICTED: uncharacterized protein LOC101301...  52.4    3e-05   
ref|XP_010275436.1|  PREDICTED: uncharacterized protein LOC104610494  52.4    3e-05   
ref|XP_009628246.1|  PREDICTED: uncharacterized protein LOC104118...  52.0    3e-05   
emb|CDX83412.1|  BnaA03g20940D                                        52.0    3e-05   
gb|KDO66385.1|  hypothetical protein CISIN_1g004364mg                 52.0    3e-05   
ref|XP_006470442.1|  PREDICTED: uncharacterized protein LOC102624...  52.0    3e-05   
ref|XP_006446375.1|  hypothetical protein CICLE_v10014363mg           52.0    3e-05   
gb|EAZ07922.1|  hypothetical protein OsI_30176                        52.0    3e-05   
ref|XP_010680576.1|  PREDICTED: uncharacterized protein LOC104895704  52.0    3e-05   
ref|NP_001062449.2|  Os08g0551200                                     52.0    3e-05   
ref|XP_002313698.2|  hypothetical protein POPTR_0009s13960g           52.0    3e-05   
ref|XP_009366362.1|  PREDICTED: uncharacterized protein LOC103956149  52.0    3e-05   
ref|XP_011022764.1|  PREDICTED: uncharacterized protein LOC105124...  52.0    3e-05   



>ref|XP_009787447.1| PREDICTED: uncharacterized protein LOC104235394 [Nicotiana sylvestris]
Length=809

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SKIDDLPAVALCRDRC FLDEAI  R +LAEAHLAYL SL+++G SLHHFF+Q++
Sbjct  1    MGCTSSKIDDLPAVALCRDRCTFLDEAIHYRYALAEAHLAYLHSLKSVGLSLHHFFEQNV  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_009605340.1| PREDICTED: uncharacterized protein LOC104099910 [Nicotiana tomentosiformis]
Length=807

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SKIDDLPAVALCRDRC FLDEAI  R +LAEAHLAYL SL+++G SLHHFF+Q++
Sbjct  1    MGCTSSKIDDLPAVALCRDRCTFLDEAIHYRYALAEAHLAYLHSLKSVGLSLHHFFEQNV  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_004231460.1| PREDICTED: uncharacterized protein LOC101257515 [Solanum lycopersicum]
Length=890

 Score =   103 bits (256),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK DDLPAVALCR+RCAFLD+AI  R + AEAHLAYL SL+++GASLH FF  DL
Sbjct  1    MGCATSKHDDLPAVALCRERCAFLDQAIHHRYAFAEAHLAYLHSLKSVGASLHRFFQNDL  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_009768111.1| PREDICTED: uncharacterized protein LOC104219174 [Nicotiana sylvestris]
Length=891

 Score =   102 bits (255),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK DDLPAVALCR+RCAFLDEAI  R + AEAH+AYL SL+A+G SLH FF  DL
Sbjct  1    MGCATSKHDDLPAVALCRERCAFLDEAIHHRYAFAEAHVAYLHSLKAVGVSLHRFFQHDL  60

Query  11   D  9
            D
Sbjct  61   D  61



>gb|EYU40468.1| hypothetical protein MIMGU_mgv1a001739mg [Erythranthe guttata]
Length=766

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK+DDLPAVALCRDRC+FLDEA+R R + AEAH AYL SL+++G SL  FF+QDL
Sbjct  1    MGCATSKLDDLPAVALCRDRCSFLDEAVRHRFAFAEAHAAYLLSLKSVGVSLDRFFNQDL  60

Query  11   D  9
            D
Sbjct  61   D  61



>gb|EYU38019.1| hypothetical protein MIMGU_mgv1a001387mg [Erythranthe guttata]
Length=827

 Score =   102 bits (253),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK+DD PAVALCR+RCAFLDEA+R R + AEAH+AYL SL+A+G SL  FF+QDL
Sbjct  1    MGCASSKLDDTPAVALCRERCAFLDEAVRHRFAFAEAHMAYLHSLKAVGLSLDRFFNQDL  60

Query  11   DA  6
            DA
Sbjct  61   DA  62



>ref|XP_009590719.1| PREDICTED: uncharacterized protein LOC104087857 [Nicotiana tomentosiformis]
Length=883

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK DDLPAVALCR+RCAFLDEAI  R + AEAH+AYL SL+A+G SLH FF  DL
Sbjct  1    MGCATSKHDDLPAVALCRERCAFLDEAIHHRYAFAEAHVAYLHSLKAVGVSLHRFFQHDL  60

Query  11   D  9
            D
Sbjct  61   D  61



>gb|KDP24731.1| hypothetical protein JCGZ_25332 [Jatropha curcas]
Length=838

 Score =   100 bits (250),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCTTSK+DDLPAVALCR+RCAFLD+AI QR + A+AH AY+ SLR +G SLHHF +QD
Sbjct  1    MGCTTSKLDDLPAVALCRERCAFLDQAILQRFAFADAHNAYIHSLRTVGNSLHHFIEQD  59



>ref|XP_010266120.1| PREDICTED: uncharacterized protein LOC104603723 [Nelumbo nucifera]
Length=807

 Score =   100 bits (249),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC FLDEAIRQR +LA+AH+AY+ SLRAI  SL   F QDL
Sbjct  1    MGCTSSKLDDLPAVALCRERCQFLDEAIRQRYALADAHVAYIHSLRAISLSLDGLFHQDL  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_006365304.1| PREDICTED: uncharacterized protein LOC102602700 [Solanum tuberosum]
Length=807

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SKIDDLPAVALCR+RC+FLDEAI  R +LAEAHLAYL SL+ +G S+HHFF +++
Sbjct  1    MGCTSSKIDDLPAVALCRERCSFLDEAIHYRYALAEAHLAYLHSLKTVGLSVHHFFKENV  60

Query  11   D  9
            +
Sbjct  61   E  61



>ref|XP_009341563.1| PREDICTED: uncharacterized protein LOC103933597, partial [Pyrus 
x bretschneideri]
Length=156

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC FLDEAI QR + AEAH+AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKLDDLPAVALCRERCGFLDEAIHQRYAFAEAHIAYIHSLRGIGRSLHLFIEQEV  60



>ref|XP_008378030.1| PREDICTED: uncharacterized protein LOC103441109 [Malus domestica]
Length=813

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+D+LPAVALCR+RC FLDEAI QR +LAEAH+AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKLDELPAVALCRERCGFLDEAIHQRYALAEAHIAYINSLRGIGRSLHQFIEQEV  60



>ref|XP_010530946.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104807392 
[Tarenaya hassleriana]
Length=835

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHF  27
            MGCT+SK+DDLPAVALCRDRCAFL+ AI+QR +LAE+H+AY  SLR IG SLHHF
Sbjct  1    MGCTSSKLDDLPAVALCRDRCAFLESAIQQRYALAESHMAYTHSLRGIGPSLHHF  55



>ref|XP_008236114.1| PREDICTED: uncharacterized protein LOC103334905 [Prunus mume]
Length=768

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC FLDEAI QR +LAEAH AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKLDDLPAVALCRERCGFLDEAIHQRYALAEAHFAYIHSLRDIGHSLHKFIEQEV  60



>ref|XP_002525750.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36649.1| conserved hypothetical protein [Ricinus communis]
Length=837

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCT+SK+DDLPAVALCR+RC+FLDEAI QR  LA+AH AY +SLR +G SLHHF  QD
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLDEAINQRFILADAHRAYTESLRTVGVSLHHFIQQD  59



>ref|XP_007199711.1| hypothetical protein PRUPE_ppa001587mg [Prunus persica]
 gb|EMJ00910.1| hypothetical protein PRUPE_ppa001587mg [Prunus persica]
Length=797

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC +LDEAI QR +LAEAH AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKLDDLPAVALCRERCGYLDEAIHQRYALAEAHFAYIHSLRDIGHSLHKFIEQEV  60



>ref|XP_008367426.1| PREDICTED: uncharacterized protein LOC103431055 [Malus domestica]
Length=822

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC FLDEAI QR + AEAH+AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKLDDLPAVALCRERCGFLDEAIHQRYAFAEAHIAYIHSLRGIGRSLHLFIEQEV  60



>ref|XP_011088683.1| PREDICTED: uncharacterized protein LOC105169840 [Sesamum indicum]
Length=840

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK+DD PAV LCRDRCAFLDEA++QR + AEAHL YL SL+A+G SL  FF+QDL
Sbjct  1    MGCATSKLDDSPAVLLCRDRCAFLDEALKQRFAFAEAHLGYLHSLKAVGLSLDRFFNQDL  60



>ref|XP_009350609.1| PREDICTED: uncharacterized protein LOC103942123 [Pyrus x bretschneideri]
Length=601

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK D+LPAVALCR+RC FLDEAI QR +LAEAH+AY+ SLR IG SLH F +Q++
Sbjct  1    MGCTSSKPDELPAVALCRERCGFLDEAIHQRYALAEAHIAYISSLREIGRSLHQFIEQEV  60



>ref|XP_008447869.1| PREDICTED: uncharacterized protein LOC103490222 [Cucumis melo]
Length=823

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC++SK+DDLPAVALCR+RCAFLDEAI  R SLAEAHLAY+ SL+ IG SLH+F ++
Sbjct  1    MGCSSSKVDDLPAVALCRERCAFLDEAIHLRYSLAEAHLAYIHSLKGIGHSLHNFIEE  58



>ref|XP_004161036.1| PREDICTED: uncharacterized protein LOC101231393 [Cucumis sativus]
Length=823

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC++SK+DDLPAVALCR+RCAFLDEAI  R SLAEAHLAY+ SL+ IG SLH+F ++
Sbjct  1    MGCSSSKVDDLPAVALCRERCAFLDEAIHLRYSLAEAHLAYIHSLKGIGHSLHNFIEE  58



>ref|XP_004144947.1| PREDICTED: uncharacterized protein LOC101212808 [Cucumis sativus]
 gb|KGN43325.1| hypothetical protein Csa_7G023990 [Cucumis sativus]
Length=823

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC++SK+DDLPAVALCR+RCAFLDEAI  R SLAEAHLAY+ SL+ IG SLH+F ++
Sbjct  1    MGCSSSKVDDLPAVALCRERCAFLDEAIHLRYSLAEAHLAYIHSLKGIGHSLHNFIEE  58



>ref|XP_004249001.1| PREDICTED: uncharacterized protein LOC101251428 [Solanum lycopersicum]
Length=803

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SKIDDLPAVALCR+RC+FLDEAI  R +LAEAHLAYL SL+ +G S+ HFF +++
Sbjct  1    MGCTSSKIDDLPAVALCRERCSFLDEAIHYRYALAEAHLAYLHSLKTVGISVQHFFKENV  60

Query  11   D  9
            +
Sbjct  61   E  61



>ref|XP_004153581.1| PREDICTED: uncharacterized protein LOC101216367 [Cucumis sativus]
Length=826

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC++SK+DDLPAVALCR+RCAFLDEAI  R SLAEAHLAY+ SL+ IG SLH+F ++
Sbjct  1    MGCSSSKVDDLPAVALCRERCAFLDEAIHLRYSLAEAHLAYIHSLKGIGHSLHNFIEE  58



>ref|XP_006384620.1| hypothetical protein POPTR_0004s19350g [Populus trichocarpa]
 gb|ERP62417.1| hypothetical protein POPTR_0004s19350g [Populus trichocarpa]
Length=813

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCT+SK++DLPAVALCRDRCAFLDEAI QR +LAEAH+AY+QSL+ IG SL+ F +++
Sbjct  1    MGCTSSKLEDLPAVALCRDRCAFLDEAIHQRYALAEAHVAYIQSLKRIGNSLYVFIEKE  59



>gb|KHG02196.1| hypothetical protein F383_24299 [Gossypium arboreum]
Length=837

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAVALCR+RCAFLDEAIRQR +LAEAH+AY  SL++ G SL++F + D 
Sbjct  1    MGCSSSKLDDLPAVALCRERCAFLDEAIRQRFALAEAHVAYTASLKSFGQSLNNFVEHDF  60



>gb|KHG02195.1| hypothetical protein F383_24299 [Gossypium arboreum]
Length=854

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAVALCR+RCAFLDEAIRQR +LAEAH+AY  SL++ G SL++F + D 
Sbjct  1    MGCSSSKLDDLPAVALCRERCAFLDEAIRQRFALAEAHVAYTASLKSFGQSLNNFVEHDF  60



>ref|XP_011458082.1| PREDICTED: uncharacterized protein LOC101306595 [Fragaria vesca 
subsp. vesca]
Length=810

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCT+SK+DDLPAVALCR+RC+FLDEAI+ R +LA+AH+ Y+ SLR IG SL HF +Q+
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLDEAIQLRHALADAHIGYIHSLRGIGQSLTHFIEQE  59



>ref|XP_010103335.1| hypothetical protein L484_014375 [Morus notabilis]
 gb|EXB95402.1| hypothetical protein L484_014375 [Morus notabilis]
Length=863

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCTTSK+DDLPAVALCR+RCA LDEA+ QR +LAEAH AY+ SL+ IG SLH F + +L
Sbjct  1    MGCTTSKLDDLPAVALCRERCASLDEAMHQRYALAEAHFAYVHSLKGIGNSLHKFVEHEL  60



>ref|XP_011045194.1| PREDICTED: uncharacterized protein LOC105140165 isoform X2 [Populus 
euphratica]
Length=822

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC TSK+DDLPAVALCR+RCA LDEAI+QR +LAEAH+AY+ SL+ IG+SLH F +++
Sbjct  1    MGCATSKLDDLPAVALCRERCASLDEAIQQRFALAEAHIAYIHSLKRIGSSLHDFIEKE  59



>ref|XP_011045186.1| PREDICTED: uncharacterized protein LOC105140165 isoform X1 [Populus 
euphratica]
Length=823

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC TSK+DDLPAVALCR+RCA LDEAI+QR +LAEAH+AY+ SL+ IG+SLH F +++
Sbjct  1    MGCATSKLDDLPAVALCRERCASLDEAIQQRFALAEAHIAYIHSLKRIGSSLHDFIEKE  59



>ref|XP_006364524.1| PREDICTED: uncharacterized protein LOC102602806 isoform X1 [Solanum 
tuberosum]
 ref|XP_006364525.1| PREDICTED: uncharacterized protein LOC102602806 isoform X2 [Solanum 
tuberosum]
Length=913

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC TSK DDLPAVALCR+RCAFLD+AI  R + AEAH+AYL SL+++GASLH FF  
Sbjct  1    MGCATSKHDDLPAVALCRERCAFLDQAIHHRYAFAEAHVAYLHSLKSVGASLHRFFQH  58



>gb|AET01058.2| BZIP transcription factor [Medicago truncatula]
Length=773

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCT+SK+DDLPAVALCR+RC+FLDEAI QR SL+ +HL+Y+ SL +IG SLHHF   D
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLDEAIHQRYSLSASHLSYINSLTSIGHSLHHFIQHD  59



>ref|XP_003618099.1| BZIP transcription factor bZIP107 [Medicago truncatula]
Length=774

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGCT+SK+DDLPAVALCR+RC+FLDEAI QR SL+ +HL+Y+ SL +IG SLHHF   D
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLDEAIHQRYSLSASHLSYINSLTSIGHSLHHFIQHD  59



>ref|XP_011092941.1| PREDICTED: uncharacterized protein LOC105173003 [Sesamum indicum]
Length=803

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK+DDLPAV+LCR RCAFLDEA+R R + A+AH AYL SL+A+G SLH FF+Q L
Sbjct  1    MGCATSKLDDLPAVSLCRHRCAFLDEALRHRFAFAQAHAAYLLSLKAVGLSLHRFFNQHL  60



>emb|CBI37791.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCTTSKIDDLPAVALCR+RCA LD+AI+QR + A  H+AY++SL+ IG SL  FFD DL
Sbjct  1    MGCTTSKIDDLPAVALCRERCACLDDAIQQRYTFAAYHVAYMKSLQVIGGSLQEFFDLDL  60

Query  11   DA  6
            D 
Sbjct  61   DG  62



>gb|KJB47752.1| hypothetical protein B456_008G040200 [Gossypium raimondii]
Length=815

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAVALCR+RCAFLDEAIRQR +LAEAH+AY  SL++ G SL++F   D 
Sbjct  1    MGCSSSKLDDLPAVALCRERCAFLDEAIRQRFALAEAHVAYTASLKSFGQSLNNFVGHDF  60



>ref|XP_006596578.1| PREDICTED: uncharacterized protein LOC100797677 [Glycine max]
Length=751

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK++DLPAVALCR+RC FLDEAI QR +LA AH+AY+ SL+AIG SLH F  QD+
Sbjct  1    MGCGSSKLEDLPAVALCRERCGFLDEAIHQRYALAAAHMAYINSLKAIGHSLHLFIQQDM  60

Query  11   DA  6
            DA
Sbjct  61   DA  62



>ref|XP_010526868.1| PREDICTED: uncharacterized protein LOC104804308 [Tarenaya hassleriana]
Length=861

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC +SK+DDLPAVALCRDRC FL+ AI+QR +LAE+H+AY  SLR IG SLHHF + 
Sbjct  1    MGCASSKLDDLPAVALCRDRCVFLEAAIQQRYALAESHVAYTHSLRGIGHSLHHFINH  58



>ref|XP_002278825.1| PREDICTED: uncharacterized protein LOC100264167 [Vitis vinifera]
Length=812

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCTTSKIDDLPAVALCR+RCA LD+AI+QR + A  H+AY++SL+ IG SL  FFD DL
Sbjct  1    MGCTTSKIDDLPAVALCRERCACLDDAIQQRYTFAAYHVAYMKSLQVIGGSLQEFFDLDL  60

Query  11   DA  6
            D 
Sbjct  61   DG  62



>gb|KHG20272.1| DNA-directed RNA polymerase subunit beta' [Gossypium arboreum]
Length=814

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAVALCR+RC+FLDEAI+QR +LAEAH+AY  SL+  G SL++F D D 
Sbjct  1    MGCSSSKLDDLPAVALCRERCSFLDEAIQQRFALAEAHVAYTASLKLFGQSLNNFVDNDF  60



>gb|KDO68276.1| hypothetical protein CISIN_1g036103mg [Citrus sinensis]
Length=474

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF-DQD  15
            MGCT SK+DDLPAVALCR+RCAFLDEAI QR  LA+ H+AY+ SL+ +G SLH+F  +QD
Sbjct  1    MGCTNSKLDDLPAVALCRERCAFLDEAIHQRYVLADTHVAYVHSLKQVGHSLHNFITNQD  60



>ref|XP_006575762.1| PREDICTED: uncharacterized protein LOC778196 [Glycine max]
Length=783

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK++DLPAVALCR+RC FLDEAI QR +LA AH+AY+ SL++IG SLH F  QD+
Sbjct  1    MGCASSKLEDLPAVALCRERCGFLDEAIHQRYALAAAHIAYINSLKSIGHSLHLFIQQDM  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_007017991.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY15216.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=588

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK++ LPAV+LCRDRC FL+EA++Q  +LA+AH+AY+QSL+ +G +LH FFDQ +
Sbjct  1    MGCATSKLEQLPAVSLCRDRCNFLEEALQQSYALADAHVAYMQSLKTLGPTLHRFFDQSI  60

Query  11   DA  6
             +
Sbjct  61   KS  62



>emb|CDP14515.1| unnamed protein product [Coffea canephora]
Length=848

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC  SK+DDLP VALCRDRCAFLDEAIRQR  +++AHL Y  SL+ +GASL+ FFD 
Sbjct  1    MGCANSKLDDLPVVALCRDRCAFLDEAIRQRYIISQAHLHYFHSLKTVGASLNRFFDH  58



>ref|XP_002312913.1| hypothetical protein POPTR_0009s14490g [Populus trichocarpa]
 gb|EEE86868.1| hypothetical protein POPTR_0009s14490g [Populus trichocarpa]
Length=808

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC TSK+DDLPAVALCR+RCA L+EAI+QR +LAEAH+AY+ SL+ IG+SLH F +++
Sbjct  1    MGCATSKLDDLPAVALCRERCASLEEAIQQRFALAEAHIAYIHSLKRIGSSLHDFIEKE  59



>ref|XP_004491637.1| PREDICTED: uncharacterized protein LOC101496497 isoform X2 [Cicer 
arietinum]
Length=800

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK+DDLPAVALCR+RC FLDEAI QR +LA +HLAY+ SL AIG SLH F   D 
Sbjct  1    MGCASSKLDDLPAVALCRERCTFLDEAIHQRYALAASHLAYINSLTAIGHSLHAFIQHDK  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_004491636.1| PREDICTED: uncharacterized protein LOC101496497 isoform X1 [Cicer 
arietinum]
Length=801

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK+DDLPAVALCR+RC FLDEAI QR +LA +HLAY+ SL AIG SLH F   D 
Sbjct  1    MGCASSKLDDLPAVALCRERCTFLDEAIHQRYALAASHLAYINSLTAIGHSLHAFIQHDK  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_011046294.1| PREDICTED: uncharacterized protein LOC105140944 [Populus euphratica]
Length=824

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK +DLPAVALCRDRCAFLDEAI QR +LAEAH+AY+ SL+ IG SL+ F ++
Sbjct  1    MGCTSSKPEDLPAVALCRDRCAFLDEAIHQRYALAEAHVAYIHSLKRIGNSLYVFIEK  58



>ref|XP_007142561.1| hypothetical protein PHAVU_008G291200g [Phaseolus vulgaris]
 gb|ESW14555.1| hypothetical protein PHAVU_008G291200g [Phaseolus vulgaris]
Length=768

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC +SK+DDLPAVALCRDRC FLDEAI QR +LA AH+AY+ SL+AIG SLH F   D
Sbjct  1    MGCASSKLDDLPAVALCRDRCVFLDEAIHQRYALAAAHIAYINSLKAIGNSLHSFIHHD  59



>ref|NP_565405.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06586.1| uncharacterized protein AT2G17110 [Arabidopsis thaliana]
Length=733

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+TSK+DDLPAVALCRDRC+FL+ AI QR +L+EAH++Y QSL+AI  SLH F + 
Sbjct  1    MGCSTSKLDDLPAVALCRDRCSFLEAAIHQRYALSEAHVSYTQSLKAISHSLHQFINH  58



>ref|XP_010467462.1| PREDICTED: uncharacterized protein LOC104747516 [Camelina sativa]
Length=732

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALCRDRC FL+ AI QR +LAEAH++Y QSL+AI  SLH F + 
Sbjct  1    MGCTTSKLDDLPAVALCRDRCGFLEAAIHQRYALAEAHVSYTQSLKAISHSLHQFINH  58



>ref|XP_007017990.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY15215.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=694

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK++ LPAV+LCRDRC FL+EA++Q  +LA+AH+AY+QSL+ +G +LH FFDQ +
Sbjct  1    MGCATSKLEQLPAVSLCRDRCNFLEEALQQSYALADAHVAYMQSLKTLGPTLHRFFDQSI  60

Query  11   DA  6
             +
Sbjct  61   KS  62



>ref|XP_009104109.1| PREDICTED: uncharacterized protein LOC103830114 [Brassica rapa]
Length=836

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC+FLD AI+QR+ L+E+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLDAAIQQRNLLSESHVAYTNSLRGIGHSLHLFINH  58



>ref|XP_002867084.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43343.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=827

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RCAFL+ AI QR +LAE+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCAFLEAAIHQRYALAESHVAYTHSLRGIGHSLHLFINH  58



>ref|XP_006435325.1| hypothetical protein CICLE_v10000566mg [Citrus clementina]
 ref|XP_006473760.1| PREDICTED: uncharacterized protein LOC102608017 [Citrus sinensis]
 gb|ESR48565.1| hypothetical protein CICLE_v10000566mg [Citrus clementina]
 gb|KDO85051.1| hypothetical protein CISIN_1g006642mg [Citrus sinensis]
Length=637

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+TSK+D+LPAVALCRDRC FL+EA+R   +LA+AH+AY+QSL+ +G +LH FFD 
Sbjct  1    MGCSTSKLDNLPAVALCRDRCRFLEEALRHSYALADAHVAYMQSLKTLGPTLHQFFDH  58



>emb|CAA18745.1| putative protein [Arabidopsis thaliana]
 emb|CAB80241.1| putative protein [Arabidopsis thaliana]
Length=828

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RCAFL+ AI QR +LAE+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCAFLEAAIHQRYALAESHVAYTHSLREIGHSLHLFINH  58



>ref|NP_195250.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190921.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86483.1| uncharacterized protein AT4G35240 [Arabidopsis thaliana]
 gb|AEE86484.1| uncharacterized protein AT4G35240 [Arabidopsis thaliana]
Length=865

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RCAFL+ AI QR +LAE+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCAFLEAAIHQRYALAESHVAYTHSLREIGHSLHLFINH  58



>gb|KHG24171.1| hypothetical protein F383_30825 [Gossypium arboreum]
Length=800

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAV+LCR+RC+FLDEAI+QR +LAEAH+AY+ SL+  G SL+ F + D 
Sbjct  1    MGCSSSKLDDLPAVSLCRERCSFLDEAIQQRFALAEAHVAYIASLKLFGQSLNSFVEYDP  60

Query  11   DA  6
            +A
Sbjct  61   EA  62



>ref|XP_007227284.1| hypothetical protein PRUPE_ppa017438mg [Prunus persica]
 gb|EMJ28483.1| hypothetical protein PRUPE_ppa017438mg [Prunus persica]
Length=615

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC  SK++DLPAVALCRDRC FL+EAI Q  ++++AH+AYL SLR +G SLH FFD
Sbjct  1    MGCAASKVEDLPAVALCRDRCKFLEEAISQTQAMSDAHVAYLASLRTLGPSLHRFFD  57



>ref|XP_006412129.1| hypothetical protein EUTSA_v10024384mg [Eutrema salsugineum]
 gb|ESQ53582.1| hypothetical protein EUTSA_v10024384mg [Eutrema salsugineum]
Length=859

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AIRQR  LAE+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCGFLEAAIRQRYLLAESHVAYTHSLRGIGHSLHLFINH  58



>ref|XP_006422465.1| hypothetical protein CICLE_v10027792mg [Citrus clementina]
 gb|ESR35705.1| hypothetical protein CICLE_v10027792mg [Citrus clementina]
Length=875

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF-DQD  15
            MGCT SK+DDLPAVALCR+RCAFLDEAI QR  LA+ H+AY+ SL+ +G SLH+F  +QD
Sbjct  1    MGCTNSKLDDLPAVALCRERCAFLDEAIHQRYVLADTHVAYVHSLKQVGHSLHNFITNQD  60



>emb|CAN74079.1| hypothetical protein VITISV_000980 [Vitis vinifera]
Length=723

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC TSK+DDLPAVALCRDRC FL++A++ R  LA+AH+AY+QSL  IG SLH  FD 
Sbjct  1    MGCATSKLDDLPAVALCRDRCNFLEDAVQLRYDLADAHVAYMQSLTTIGVSLHRVFDH  58



>ref|XP_006486631.1| PREDICTED: uncharacterized protein LOC102624434 [Citrus sinensis]
Length=866

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF-DQD  15
            MGCT SK+DDLPAVALCR+RCAFLDEAI QR  LA+ H+AY+ SL+ +G SLH+F  +QD
Sbjct  1    MGCTNSKLDDLPAVALCRERCAFLDEAIHQRYVLADTHVAYVHSLKQVGHSLHNFITNQD  60



>gb|KHN29876.1| hypothetical protein glysoja_039552 [Glycine soja]
Length=805

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC +SK++DLPAVALCR+RC FLDEAI QR + A AH+AY+ SL++IG SLH F  QD+
Sbjct  1    MGCASSKLEDLPAVALCRERCGFLDEAIHQRYARAAAHIAYINSLKSIGHSLHLFIQQDM  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_002886097.1| hypothetical protein ARALYDRAFT_480593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62356.1| hypothetical protein ARALYDRAFT_480593 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHF  27
            MGC+TSK+DDLPAVALCRDRC+FL+ AI QR +L+EAH++Y QSL+AI  SLH F
Sbjct  1    MGCSTSKLDDLPAVALCRDRCSFLEAAIHQRYALSEAHVSYTQSLKAIAHSLHQF  55



>gb|KJB32731.1| hypothetical protein B456_005G258200 [Gossypium raimondii]
Length=801

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAV+LCR+RC+FLDEAI+QR +LAEAH+AY  SL+  G SL+ F + D 
Sbjct  1    MGCSSSKLDDLPAVSLCRERCSFLDEAIQQRFALAEAHVAYFASLKLFGQSLNSFIEYDP  60

Query  11   DA  6
            +A
Sbjct  61   EA  62



>ref|XP_007041654.1| Uncharacterized protein TCM_006485 [Theobroma cacao]
 gb|EOX97485.1| Uncharacterized protein TCM_006485 [Theobroma cacao]
Length=820

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DDLPAVALCR+RC FLDEAI+QR +LAEAH+AY  SL+  G SL+ F + D 
Sbjct  1    MGCSSSKLDDLPAVALCRERCTFLDEAIQQRFALAEAHVAYTASLKLFGQSLNAFVEHDF  60

Query  11   DA  6
             A
Sbjct  61   GA  62



>ref|XP_006297058.1| hypothetical protein CARUB_v10013059mg [Capsella rubella]
 gb|EOA29956.1| hypothetical protein CARUB_v10013059mg [Capsella rubella]
Length=732

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALCRDRC FL+ AI QR +LAEAH+AY Q+L+ I   LH F + 
Sbjct  1    MGCTTSKLDDLPAVALCRDRCGFLEAAIHQRYALAEAHVAYTQALKGIAQPLHKFINH  58



>gb|KJB15937.1| hypothetical protein B456_002G205400 [Gossypium raimondii]
 gb|KJB15939.1| hypothetical protein B456_002G205400 [Gossypium raimondii]
Length=787

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DD PAVALCR+RC+FLDEAI+QR  LAEAH+AY  SL+  G SL++F D D 
Sbjct  1    MGCSSSKLDDPPAVALCRERCSFLDEAIQQRFILAEAHVAYTASLKLFGQSLNNFVDNDF  60



>gb|KJB15935.1| hypothetical protein B456_002G205400 [Gossypium raimondii]
 gb|KJB15936.1| hypothetical protein B456_002G205400 [Gossypium raimondii]
Length=814

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+DD PAVALCR+RC+FLDEAI+QR  LAEAH+AY  SL+  G SL++F D D 
Sbjct  1    MGCSSSKLDDPPAVALCRERCSFLDEAIQQRFILAEAHVAYTASLKLFGQSLNNFVDNDF  60



>ref|XP_010515622.1| PREDICTED: uncharacterized protein LOC104791429 [Camelina sativa]
Length=728

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALCRDRC FL+ AI QR +LAEAH++Y QSL  I  SLH F + 
Sbjct  1    MGCTTSKLDDLPAVALCRDRCGFLEAAIHQRYALAEAHVSYTQSLIGISHSLHQFINH  58



>emb|CBI18874.3| unnamed protein product [Vitis vinifera]
Length=718

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC TSK+DDLPAVALCRDRC FL++A++ R  LA+AH+AY+QSL  IG SLH  F
Sbjct  35   MGCATSKLDDLPAVALCRDRCNFLEDAVQLRYDLADAHVAYMQSLTTIGVSLHRVF  90



>emb|CDX76322.1| BnaA08g10780D [Brassica napus]
Length=707

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT+SK+DDLPAVALCR+RC FL+ AI+QR  LAE+H+AY  SL+ IG SLH F +   
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIQQRYDLAESHVAYTHSLKGIGHSLHLFINHHH  60

Query  11   DAF  3
              F
Sbjct  61   RCF  63



>gb|KFK40096.1| hypothetical protein AALP_AA3G329900 [Arabis alpina]
Length=684

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGCTTSK+DDLPAVALCRDRC  L+ AI+QR +L+E+H+AY +SL  IG SLH F +
Sbjct  1    MGCTTSKLDDLPAVALCRDRCNHLEAAIQQRYALSESHVAYTESLNGIGKSLHSFIN  57



>gb|KHG10498.1| chromosome segregation suda [Gossypium arboreum]
Length=725

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC  SK+D LPAV+ CRDRC FLD A+RQ  +LA+AH+AY+QSL+ +  +L HFFDQ
Sbjct  48   MGCAASKLDQLPAVSFCRDRCDFLDYALRQSYALADAHVAYMQSLKTLSPTLRHFFDQ  105



>ref|XP_010664089.1| PREDICTED: uncharacterized protein LOC100250689 isoform X2 [Vitis 
vinifera]
Length=740

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC TSK+DDLPAVALCRDRC FL++A++ R  LA+AH+AY+QSL  IG SLH  F
Sbjct  1    MGCATSKLDDLPAVALCRDRCNFLEDAVQLRYDLADAHVAYMQSLTTIGVSLHRVF  56



>ref|XP_009108621.1| PREDICTED: uncharacterized protein LOC103834294 isoform X2 [Brassica 
rapa]
Length=762

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI+QR  LAE+H+AY  SL+ IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIQQRYDLAESHVAYTHSLKGIGHSLHLFINH  58



>ref|XP_002284833.1| PREDICTED: uncharacterized protein LOC100250689 isoform X1 [Vitis 
vinifera]
Length=742

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC TSK+DDLPAVALCRDRC FL++A++ R  LA+AH+AY+QSL  IG SLH  F
Sbjct  1    MGCATSKLDDLPAVALCRDRCNFLEDAVQLRYDLADAHVAYMQSLTTIGVSLHRVF  56



>ref|XP_009108620.1| PREDICTED: uncharacterized protein LOC103834294 isoform X1 [Brassica 
rapa]
Length=763

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI+QR  LAE+H+AY  SL+ IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIQQRYDLAESHVAYTHSLKGIGHSLHLFINH  58



>emb|CDY17530.1| BnaC03g65330D [Brassica napus]
Length=710

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI+QR  LAE+H+AY  SL+ IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIQQRYHLAESHVAYTHSLKGIGHSLHLFINH  58



>emb|CDX69122.1| BnaC01g03310D [Brassica napus]
Length=751

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC+FL+ AI QR  L+E+H+AY  SLR IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCSFLEAAIHQRYLLSESHVAYTNSLRGIGHSLHLFINH  58



>gb|KDP36830.1| hypothetical protein JCGZ_08121 [Jatropha curcas]
Length=690

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+TS++D LPAV+LC DRC +L+EA+ Q  +LA+AH+AY+ SL+A+G++L  FF+Q++
Sbjct  1    MGCSTSRLDHLPAVSLCHDRCKYLEEALYQSYALADAHVAYMHSLKALGSTLRRFFEQNV  60

Query  11   DA  6
            D+
Sbjct  61   DS  62



>ref|XP_010536454.1| PREDICTED: girdin [Tarenaya hassleriana]
Length=676

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGCT SK+D LPAV+LCRDRC FL EA+R+  ++A+AH AYL SL  +G  LH FFDQ +
Sbjct  1    MGCTPSKLDGLPAVSLCRDRCKFLAEALRRSYAVADAHSAYLHSLSTVGEVLHRFFDQAV  60

Query  11   DA  6
            D+
Sbjct  61   DS  62



>ref|XP_009150859.1| PREDICTED: uncharacterized protein LOC103874196 [Brassica rapa]
Length=707

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALC DRC FL  AI+QR +LA++HLAY QSL+ +  SLH F D 
Sbjct  1    MGCTTSKLDDLPAVALCLDRCGFLQTAIQQRYALADSHLAYTQSLQVVAHSLHTFIDH  58



>emb|CDX88008.1| BnaA06g25990D [Brassica napus]
Length=715

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALC DRC FL  AI+QR +LA++HLAY QSL+ +  SLH F D 
Sbjct  1    MGCTTSKLDDLPAVALCLDRCGFLQTAIQQRYALADSHLAYTQSLQVVAQSLHTFIDH  58



>ref|XP_006283094.1| hypothetical protein CARUB_v10004111mg [Capsella rubella]
 gb|EOA15992.1| hypothetical protein CARUB_v10004111mg [Capsella rubella]
Length=870

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI QR +LAE+H+AY  SL  IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCGFLEAAIHQRYALAESHVAYTHSLIGIGHSLHLFINH  58



>ref|XP_010242855.1| PREDICTED: uncharacterized protein LOC104587099 [Nelumbo nucifera]
Length=795

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC TSK+DDLPAVALCR RC FLDEAIRQ  + A+AH+AY++SL  +  SLH  F Q+
Sbjct  1    MGCATSKLDDLPAVALCRYRCQFLDEAIRQCYAFADAHVAYIRSLERVALSLHRLFHQE  59



>ref|XP_010437501.1| PREDICTED: uncharacterized protein LOC104721261 [Camelina sativa]
Length=857

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI QR +LAE+H+AY  SL  IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIHQRYALAESHVAYTHSLVGIGHSLHLFINH  58



>ref|XP_010446961.1| PREDICTED: uncharacterized protein LOC104729685 [Camelina sativa]
Length=871

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ AI QR +LAE+H+AY  SL  IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAAIHQRYALAESHVAYTHSLIGIGHSLHLFINH  58



>ref|XP_008448313.1| PREDICTED: uncharacterized protein LOC103490544 isoform X1 [Cucumis 
melo]
Length=768

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TSK+D LPAV+LCR+RCAFL+EAI+ R + A+AH AY+ SL+ +G SLH+F +
Sbjct  1    MGCATSKLDHLPAVSLCRERCAFLNEAIQHRHTFAQAHTAYILSLQGVGKSLHNFIE  57



>ref|XP_008448314.1| PREDICTED: uncharacterized protein LOC103490544 isoform X2 [Cucumis 
melo]
Length=766

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TSK+D LPAV+LCR+RCAFL+EAI+ R + A+AH AY+ SL+ +G SLH+F +
Sbjct  1    MGCATSKLDHLPAVSLCRERCAFLNEAIQHRHTFAQAHTAYILSLQGVGKSLHNFIE  57



>ref|XP_004140041.1| PREDICTED: uncharacterized protein LOC101209035 [Cucumis sativus]
 ref|XP_004154595.1| PREDICTED: uncharacterized LOC101209035 [Cucumis sativus]
 gb|KGN46723.1| hypothetical protein Csa_6G127350 [Cucumis sativus]
Length=768

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TSK+D LPAV+LCR+RCAFL+EAI+ R + A+AH AY+ SL+ +G SLH+F +
Sbjct  1    MGCATSKLDHLPAVSLCRERCAFLNEAIQHRHTFAQAHTAYILSLQGVGKSLHNFIE  57



>emb|CDY07877.1| BnaC03g47450D [Brassica napus]
Length=715

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCTTSK+DDLPAVALC DRC FL  AI+QR +LA++HLA+ QSL+ +  SLH F D 
Sbjct  1    MGCTTSKLDDLPAVALCLDRCGFLRTAIQQRYALADSHLAHTQSLQGVAQSLHTFIDH  58



>ref|XP_002300656.2| hypothetical protein POPTR_0002s01300g [Populus trichocarpa]
 gb|EEE79929.2| hypothetical protein POPTR_0002s01300g [Populus trichocarpa]
Length=652

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ S+ID LPAV+LC DRC FL+EA+ Q  +LA+AH+AY+ SL+++G +LH FFD+ L
Sbjct  1    MGCSISRIDQLPAVSLCHDRCKFLEEALYQSYALADAHVAYMHSLKSLGPALHRFFDEAL  60



>ref|XP_007136143.1| hypothetical protein PHAVU_009G021600g [Phaseolus vulgaris]
 gb|ESW08137.1| hypothetical protein PHAVU_009G021600g [Phaseolus vulgaris]
Length=671

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TS++D LPAVALCRDRC FLDEA+RQ  +LA+AH+A++++LR +G +L  FFD
Sbjct  1    MGCNTSRLDRLPAVALCRDRCKFLDEALRQSYALADAHVAHMEALRKLGPALLCFFD  57



>ref|XP_010477296.1| PREDICTED: uncharacterized protein LOC104756407 isoform X2 [Camelina 
sativa]
Length=609

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  IG +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTIGPALHRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>ref|XP_002307776.2| hypothetical protein POPTR_0005s27080g [Populus trichocarpa]
 gb|EEE94772.2| hypothetical protein POPTR_0005s27080g [Populus trichocarpa]
Length=632

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ S+ID LPAV+LC DRC FL+EA+ Q  +LA+AH+AY+ SL+++G +L  FFDQ L
Sbjct  1    MGCSPSRIDQLPAVSLCHDRCKFLEEALYQSYALADAHVAYMHSLKSLGPTLRRFFDQTL  60



>ref|XP_008387877.1| PREDICTED: uncharacterized protein LOC103450325 [Malus domestica]
Length=643

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC  SK++DLPAVALCRDRC +L+EA+ Q  +LA++HLAYL SLR +G  LH FF
Sbjct  1    MGCAASKVEDLPAVALCRDRCKYLEEALCQTQALADSHLAYLASLRTLGPVLHRFF  56



>ref|XP_011041260.1| PREDICTED: uncharacterized protein LOC105137263 [Populus euphratica]
Length=653

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ S+ID LPAV+LC DRC FL+EA+ Q  +LA+AH+AY+ SL+++G +L  FFDQ L
Sbjct  1    MGCSPSRIDQLPAVSLCHDRCKFLEEALYQSYALADAHVAYMHSLKSLGPTLRRFFDQTL  60



>ref|XP_008377093.1| PREDICTED: uncharacterized protein LOC103440204 [Malus domestica]
Length=647

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC  SK++DLPAVALCRDRC +L+EA+ Q   LA+AH+AYL SLR +G +LH FF
Sbjct  1    MGCAASKLEDLPAVALCRDRCMYLEEALSQAPVLADAHVAYLASLRTLGPALHRFF  56



>ref|XP_010477295.1| PREDICTED: uncharacterized protein LOC104756407 isoform X1 [Camelina 
sativa]
Length=612

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  IG +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTIGPALHRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>ref|XP_010498486.1| PREDICTED: uncharacterized protein LOC104776171 [Camelina sativa]
Length=600

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFFDQAV  60

Query  11   D  9
            +
Sbjct  61   E  61



>ref|XP_004292917.1| PREDICTED: uncharacterized protein LOC101299932 [Fragaria vesca 
subsp. vesca]
Length=607

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC  SK+DDLPAVALCRDR  FLD+A+RQ  +LA+AH+AY + LR +G SL  FFD
Sbjct  1    MGCAPSKLDDLPAVALCRDRNKFLDQALRQAQALADAHVAYSECLRTLGPSLARFFD  57



>emb|CDY29526.1| BnaA06g14440D [Brassica napus]
Length=1149

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>gb|KFK30164.1| hypothetical protein AALP_AA7G225400 [Arabis alpina]
Length=834

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAV+LCR+RC FL+ AI+QR  L+++H+AY  SL+ IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVSLCRERCNFLESAIQQRYLLSQSHVAYSHSLKGIGHSLHLFINH  58



>ref|XP_010432310.1| PREDICTED: uncharacterized protein LOC104716609 [Camelina sativa]
Length=856

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGCT+SK+DDLPAVALCR+RC FL+ A  QR +LAE+H+AY  SL  IG SLH F + 
Sbjct  1    MGCTSSKLDDLPAVALCRERCNFLEAASHQRYALAESHVAYTHSLIGIGHSLHLFINH  58



>ref|XP_009149628.1| PREDICTED: uncharacterized protein LOC103872948 [Brassica rapa]
Length=600

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>ref|XP_003527645.1| PREDICTED: uncharacterized protein LOC100787793 [Glycine max]
Length=664

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TS++D LPAVALCRDRC F+DEA+RQ  +LA+AH+A++++L+ +G +L  FFD
Sbjct  1    MGCNTSRLDRLPAVALCRDRCKFVDEALRQSYALADAHVAHMEALKTLGPALLCFFD  57



>gb|KJB57975.1| hypothetical protein B456_009G188500 [Gossypium raimondii]
 gb|KJB57976.1| hypothetical protein B456_009G188500 [Gossypium raimondii]
 gb|KJB57977.1| hypothetical protein B456_009G188500 [Gossypium raimondii]
 gb|KJB57978.1| hypothetical protein B456_009G188500 [Gossypium raimondii]
Length=693

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK+D LPAV LC DRC FL +A+ Q  + A+AH+AY+QSL  +G +LH FFDQ L
Sbjct  1    MGCVTSKLDQLPAVTLCGDRCNFLQDALLQSYAFADAHVAYMQSLTTLGPALHRFFDQCL  60

Query  11   DA  6
             +
Sbjct  61   KS  62



>gb|KHN20126.1| hypothetical protein glysoja_014704 [Glycine soja]
Length=664

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TS++D LPAVALCRDRC F+DEA+RQ  +LA+AH+A++++L+ +G +L  FFD
Sbjct  1    MGCNTSRLDRLPAVALCRDRCKFVDEALRQSYALADAHVAHMEALKTLGPALLCFFD  57



>ref|XP_006303171.1| hypothetical protein CARUB_v10008623mg [Capsella rubella]
 gb|EOA36069.1| hypothetical protein CARUB_v10008623mg [Capsella rubella]
Length=605

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH FFDQ
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFFDQ  58



>emb|CDY31475.1| BnaC05g15840D [Brassica napus]
Length=602

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH FFDQ +
Sbjct  1    MGCSPSKLDGLPAVALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>gb|KHG14730.1| RING finger protein [Gossypium arboreum]
Length=693

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC TSK+D LPAV LC DRC FL +A+ Q  + A+AH+AY+QSL  +G +LH FFDQ L
Sbjct  1    MGCVTSKLDQLPAVTLCGDRCNFLQDALLQSYAFADAHVAYMQSLTTLGPALHRFFDQCL  60

Query  11   DA  6
             +
Sbjct  61   KS  62



>ref|XP_010094591.1| hypothetical protein L484_024887 [Morus notabilis]
 gb|EXB56345.1| hypothetical protein L484_024887 [Morus notabilis]
Length=624

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLPAVALCRDRC +LDEA+R   + ++AH  YL SL+ +G +L+ FF  + 
Sbjct  1    MGCANSKLDDLPAVALCRDRCKYLDEALRHSHTFSDAHAGYLDSLKTLGPTLNRFFAHNA  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_010690263.1| PREDICTED: uncharacterized protein LOC104903834 [Beta vulgaris 
subsp. vulgaris]
Length=839

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC +SK+DDLPA+ LCR+R  FL  A+ QR +L+EAH+AY+ SL+++G SLH FFD
Sbjct  1    MGCASSKLDDLPAIILCRERLEFLSTALHQRYALSEAHVAYIHSLQSVGLSLHRFFD  57



>ref|XP_009336566.1| PREDICTED: uncharacterized protein LOC103929136 [Pyrus x bretschneideri]
Length=541

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC  SK+++LPAVALCRDRC +L+EA+ Q  +LA++H+AYL SLR +G  LH FF
Sbjct  1    MGCAASKVENLPAVALCRDRCKYLEEALCQAQALADSHVAYLASLRTLGPVLHRFF  56



>ref|XP_011034901.1| PREDICTED: uncharacterized protein LOC105132868 [Populus euphratica]
Length=651

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ S+ID LPAV+LC DRC F++EA+ Q  +LA+AH+AY+ SL+++G + H FFD+ L
Sbjct  1    MGCSISRIDQLPAVSLCHDRCKFVEEALYQSYALADAHVAYMHSLKSLGPAFHRFFDEAL  60



>gb|KEH36289.1| DUF630 family protein [Medicago truncatula]
Length=696

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC  S++D LPAV+LCRDR  F+DE++RQ  SLA+AH+A++ SLR +G +L HFF Q
Sbjct  1    MGCNASRLDRLPAVSLCRDRFKFIDESLRQSYSLADAHVAHMYSLRTLGPTLLHFFKQ  58



>ref|XP_010028814.1| PREDICTED: uncharacterized protein LOC104419015 [Eucalyptus grandis]
 gb|KCW55641.1| hypothetical protein EUGRSUZ_I01506 [Eucalyptus grandis]
Length=896

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC +SK+DDLPAVALCR+RCA+LD AIR R  LA+AH  Y+ SLR +G S+  F 
Sbjct  1    MGCASSKLDDLPAVALCRERCAYLDLAIRHRYELAQAHHNYMLSLRGVGHSISEFL  56



>ref|XP_003523534.1| PREDICTED: uncharacterized protein LOC100815394 [Glycine max]
Length=662

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TS++D LPAVALCRDRC FLD+A+RQ  +LA+AH+A++++L+ +G +L  FFD
Sbjct  1    MGCNTSRLDRLPAVALCRDRCKFLDDALRQSYALADAHVAHMEALKTLGHALLCFFD  57



>ref|XP_004500892.1| PREDICTED: uncharacterized protein LOC101491047 [Cicer arietinum]
Length=700

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC TSK+D LPAVALCRDRC F+DEA+ Q  +LA+AH+A++ SLR +G +L  FF  
Sbjct  1    MGCNTSKLDRLPAVALCRDRCKFMDEALVQSYTLADAHVAHMDSLRTLGPALIFFFQH  58



>ref|XP_010459737.1| PREDICTED: uncharacterized protein LOC104740749 isoform X2 [Camelina 
sativa]
Length=620

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPA+ALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH F DQ +
Sbjct  1    MGCSPSKLDGLPAIALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFLDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>gb|KHN33814.1| hypothetical protein glysoja_013820 [Glycine soja]
Length=616

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC TS++D LPAVALCRDRC FLD+A+RQ  +LA+AH+A++++L+ +G +L  FFD
Sbjct  1    MGCNTSRLDRLPAVALCRDRCKFLDDALRQSYALADAHVAHMEALKTLGHALLCFFD  57



>ref|XP_010459736.1| PREDICTED: uncharacterized protein LOC104740749 isoform X1 [Camelina 
sativa]
Length=623

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPA+ALCRDRC  L+E +R+  +LA+AH AYL SL  +G +LH F DQ +
Sbjct  1    MGCSPSKLDGLPAIALCRDRCNSLEETLRRSYALADAHSAYLLSLNTVGPALHRFLDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>ref|XP_002510652.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52839.1| conserved hypothetical protein [Ricinus communis]
Length=709

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+TS+ID LP V+LC DRC FL+EA+ Q  +LA+AH+AY+ SL+ +G SL  FF+
Sbjct  1    MGCSTSRIDHLPVVSLCHDRCKFLEEALYQSYALADAHVAYVHSLKTLGPSLSRFFE  57



>gb|KFK44168.1| hypothetical protein AALP_AA1G223500 [Arabis alpina]
Length=596

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC++SK+D LPAV+LCRDRC  L+E +R   +LA+AH AYL SL  +G SLH FF Q +
Sbjct  1    MGCSSSKLDGLPAVSLCRDRCNSLEETLRCSYALADAHSAYLLSLTTLGPSLHRFFHQVV  60

Query  11   DA  6
            D+
Sbjct  61   DS  62



>ref|XP_006416388.1| hypothetical protein EUTSA_v10007083mg [Eutrema salsugineum]
 gb|ESQ34741.1| hypothetical protein EUTSA_v10007083mg [Eutrema salsugineum]
Length=620

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAVALCRDRC  L+E +R+  +LA+AH AYL SL  +G +L  FFDQ +
Sbjct  1    MGCSCSKLDGLPAVALCRDRCNSLEETLRRSYALADAHAAYLLSLNTVGPALRRFFDQAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>ref|XP_003522575.1| PREDICTED: uncharacterized protein LOC100782069 isoform X1 [Glycine 
max]
Length=837

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK++D PAV LCR+R AFL  A  QR +LA AH+AY +SLR IG +LH F +QDL
Sbjct  1    MGCGGSKVEDFPAVVLCRERKAFLKAASEQRYALAAAHVAYFRSLREIGDALHKFAEQDL  60



>gb|KHN35508.1| hypothetical protein glysoja_044742 [Glycine soja]
Length=872

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK++D PAV LCR+R AFL  A  QR +LA AH+AY +SLR IG +LH F +QDL
Sbjct  1    MGCGGSKVEDFPAVVLCRERKAFLKAASEQRYALAAAHVAYFRSLREIGDALHKFAEQDL  60



>ref|XP_003527939.1| PREDICTED: uncharacterized protein LOC100787627 [Glycine max]
Length=842

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK++D PAV LCR+R AFL  A  QR +LA AH+AY  SL  IG +LH F +QDL
Sbjct  1    MGCSGSKVEDFPAVVLCRERKAFLKAASEQRYALAAAHVAYFHSLSEIGHALHKFAEQDL  60



>gb|KHN47007.1| Protein disulfide-isomerase [Glycine soja]
Length=1084

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK++D PAV LCR+R AFL  A  QR +LA AH+AY  SL  IG +LH F +QDL
Sbjct  1    MGCSGSKVEDFPAVVLCRERKAFLKAASEQRYALAAAHVAYFHSLSEIGHALHKFAEQDL  60



>ref|NP_173477.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79609.1|AC027665_10 F5M15.15 [Arabidopsis thaliana]
 gb|AEE29983.1| uncharacterized protein AT1G20530 [Arabidopsis thaliana]
Length=614

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+ SK+D LPAV+LCRDRC+ L++ +R+  +LA+AH AYL SL  +G +LH FF   +
Sbjct  1    MGCSPSKLDGLPAVSLCRDRCSSLEDTLRRSYALADAHSAYLLSLNTVGPALHRFFQHAV  60

Query  11   DA  6
            ++
Sbjct  61   ES  62



>gb|AAF80644.1|AC069251_37 F2D10.1 [Arabidopsis thaliana]
Length=273

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC+ SK+D LPAV+LCRDRC+ L++ +R+  +LA+AH AYL SL  +G +LH FF
Sbjct  1    MGCSPSKLDGLPAVSLCRDRCSSLEDTLRRSYALADAHSAYLLSLNTVGPALHRFF  56



>ref|XP_002893116.1| hypothetical protein ARALYDRAFT_312968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69375.1| hypothetical protein ARALYDRAFT_312968 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC+ SK+D LPAV+LCRDRC  L++ +R+  +LA+AH AYL SL  +G +LH FF
Sbjct  1    MGCSPSKLDGLPAVSLCRDRCNSLEDTLRRSYALADAHSAYLLSLNTVGPALHRFF  56



>ref|XP_007137433.1| hypothetical protein PHAVU_009G126600g [Phaseolus vulgaris]
 gb|ESW09427.1| hypothetical protein PHAVU_009G126600g [Phaseolus vulgaris]
Length=839

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK++D PAVALCR+R  FL  A  QR +LA AH+AY  SLR IG +L  F +QDL
Sbjct  1    MGCNVSKVEDFPAVALCRERKRFLKAASEQRYALAAAHVAYFHSLREIGDALCQFAEQDL  60

Query  11   DA  6
             +
Sbjct  61   TS  62



>ref|XP_006828953.1| hypothetical protein AMTR_s00001p00231880 [Amborella trichopoda]
 gb|ERM96369.1| hypothetical protein AMTR_s00001p00231880 [Amborella trichopoda]
Length=486

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+DDL AVALCR+R  F+ +A+  R +LA AH++Y+Q+L  +G +L  F D D
Sbjct  1    MGCSSSKVDDLQAVALCRERTQFIKQAVDHRYALASAHVSYVQALSGVGQALQRFLDAD  59



>ref|XP_004502488.1| PREDICTED: uncharacterized protein LOC101512546 [Cicer arietinum]
Length=872

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+++ P V LCR+R  FL  A  QR +LA AHL+YLQSLR IG +L  F DQDL
Sbjct  1    MGCGGSKVEEFPVVTLCRERKQFLKNASEQRYALAAAHLSYLQSLRDIGNALRKFSDQDL  60



>gb|KGN47552.1| hypothetical protein Csa_6G358160 [Cucumis sativus]
Length=589

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC +SK+D+LPAVALCRDRC FLD+A+    SL ++H AY  SL    ++L   FDQD
Sbjct  1    MGCASSKLDNLPAVALCRDRCKFLDQALLFTHSLIDSHSAYADSLNKTASALRRLFDQD  59



>ref|XP_008361511.1| PREDICTED: uncharacterized protein LOC103425208 [Malus domestica]
 ref|XP_008361512.1| PREDICTED: uncharacterized protein LOC103425208 [Malus domestica]
 ref|XP_008361513.1| PREDICTED: uncharacterized protein LOC103425208 [Malus domestica]
Length=899

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLP V LCR+R  F+ +A+ QR +LA AHL+Y QSL+ IG +L  F D+DL
Sbjct  1    MGCGGSKVDDLPLVTLCRERKDFIKKALDQRYALAAAHLSYFQSLQXIGDALCKFVDEDL  60



>ref|XP_008464871.1| PREDICTED: uncharacterized protein LOC103502634 isoform X2 [Cucumis 
melo]
Length=574

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC +SK+D+LPAVALCRDRC FLD+A+    SL ++H AY  SL    ++L   FDQD
Sbjct  1    MGCASSKLDNLPAVALCRDRCKFLDQALVSTHSLIDSHSAYADSLDKTASALRRLFDQD  59



>ref|XP_008464870.1| PREDICTED: uncharacterized protein LOC103502634 isoform X1 [Cucumis 
melo]
Length=578

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC +SK+D+LPAVALCRDRC FLD+A+    SL ++H AY  SL    ++L   FDQD
Sbjct  1    MGCASSKLDNLPAVALCRDRCKFLDQALVSTHSLIDSHSAYADSLDKTASALRRLFDQD  59



>gb|KEH35310.1| DUF630 family protein [Medicago truncatula]
Length=907

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+++ P V LCR+R  FL  A  QR +LA AHL+YLQSLR IG +L  F DQDL
Sbjct  1    MGCGGSKLEEFPVVTLCRERKNFLKNASDQRYALAAAHLSYLQSLRDIGEALRRFSDQDL  60



>ref|XP_010935229.1| PREDICTED: uncharacterized protein LOC105055178 [Elaeis guineensis]
Length=812

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC  SK++D  AVALCR+R   L +AIR R +LA+AH AY +SLR++GA+LH F 
Sbjct  1    MGCAGSKLEDQEAVALCRERTLLLADAIRHRYALADAHAAYSRSLRSVGAALHAFL  56



>ref|XP_008781739.1| PREDICTED: uncharacterized protein LOC103701465 [Phoenix dactylifera]
Length=720

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC+TSK+DD  AV +CRDR  F+ EAI QR+  A  H+AY+QSLR +  +L ++   D 
Sbjct  1    MGCSTSKLDDPEAVRICRDRKNFIKEAIEQRNRFASGHIAYIQSLRRVSLALCNYVGGDE  60

Query  11   D  9
            D
Sbjct  61   D  61



>ref|XP_010063118.1| PREDICTED: uncharacterized protein LOC104450310 [Eucalyptus grandis]
 gb|KCW70303.1| hypothetical protein EUGRSUZ_F03546 [Eucalyptus grandis]
Length=727

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+D LPAV+LCRDR   L++A+ +  +LA+AH+AYL SL ++GA+L    DQ
Sbjct  1    MGCSNSKLDRLPAVSLCRDRTKLLEDALHRSYALADAHVAYLHSLHSVGAALRCLSDQ  58



>ref|XP_010941397.1| PREDICTED: uncharacterized protein LOC105059688 [Elaeis guineensis]
Length=797

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFF  24
            MGC  SK++D  AV LCR+R   L +AIR R +LA+AH AY +SLR++GA+LH F 
Sbjct  1    MGCAGSKVEDSEAVVLCRERTLLLADAIRHRYALADAHAAYSRSLRSVGAALHSFL  56



>ref|XP_006856710.1| hypothetical protein AMTR_s00054p00177020 [Amborella trichopoda]
 gb|ERN18177.1| hypothetical protein AMTR_s00054p00177020 [Amborella trichopoda]
Length=803

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DDL  V LCR+R   +  A+  R ++A AHL+Y+ SL ++GA+LH F DQ+
Sbjct  1    MGCSASKVDDLQVVTLCRERKELVRSAVDHRYAMAAAHLSYIGSLTSMGAALHRFADQE  59



>gb|KDP46633.1| hypothetical protein JCGZ_04567 [Jatropha curcas]
Length=748

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKRFIKQAVEQRTRFASGHLAYIQSLKRVSAALREYVEGDN  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFFLDSF  69



>gb|KJB83421.1| hypothetical protein B456_013G246900 [Gossypium raimondii]
Length=728

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKNFIKQAVEQRTRFATGHLAYIQSLKRVSAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   CHEFLLDSF  69



>ref|XP_010913768.1| PREDICTED: uncharacterized protein LOC105039336 isoform X2 [Elaeis 
guineensis]
Length=622

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LCRDR  F+ EA  QR+  A  H AY+QSLR +  +L ++ D D 
Sbjct  1    MGCSASKLDDEEAVRLCRDRKNFIKEAFEQRNRFASGHTAYIQSLRRVSIALCNYVDVDE  60

Query  14   -----LDAF  3
                 LDA+
Sbjct  61   HHGFFLDAY  69



>ref|XP_010110717.1| hypothetical protein L484_009205 [Morus notabilis]
 gb|EXC27882.1| hypothetical protein L484_009205 [Morus notabilis]
Length=780

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKRFIKQAVEQRARFASGHLAYIQSLKKVSAALREYIEGD  59



>gb|KJB83420.1| hypothetical protein B456_013G246900 [Gossypium raimondii]
Length=731

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKNFIKQAVEQRTRFATGHLAYIQSLKRVSAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   CHEFLLDSF  69



>gb|KHG01672.1| hypothetical protein F383_23132 [Gossypium arboreum]
Length=731

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKNFIKQAVEQRTRFATGHLAYIQSLKRVSAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   CHEFLLDSF  69



>ref|XP_006453295.1| hypothetical protein CICLE_v10007457mg [Citrus clementina]
 ref|XP_006474234.1| PREDICTED: uncharacterized protein LOC102622049 isoform X1 [Citrus 
sinensis]
 ref|XP_006474235.1| PREDICTED: uncharacterized protein LOC102622049 isoform X2 [Citrus 
sinensis]
 ref|XP_006474236.1| PREDICTED: uncharacterized protein LOC102622049 isoform X3 [Citrus 
sinensis]
 gb|ESR66535.1| hypothetical protein CICLE_v10007457mg [Citrus clementina]
 gb|KDO61852.1| hypothetical protein CISIN_1g046020mg [Citrus sinensis]
Length=826

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRRRFIKQAVEQRTRFASGHLAYIQSLKRVSAALKEYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFMLDSF  69



>ref|XP_007213633.1| hypothetical protein PRUPE_ppa001853mg [Prunus persica]
 gb|EMJ14832.1| hypothetical protein PRUPE_ppa001853mg [Prunus persica]
Length=755

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK+DD+ AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  + + D
Sbjct  1    MGCSTSKLDDVEAVQLCKDRKRFIKQALEQRTRFASGHIAYIQSLKRVSAALRDYVEGD  59



>ref|XP_010913766.1| PREDICTED: uncharacterized protein LOC105039336 isoform X1 [Elaeis 
guineensis]
Length=721

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LCRDR  F+ EA  QR+  A  H AY+QSLR +  +L ++ D D 
Sbjct  1    MGCSASKLDDEEAVRLCRDRKNFIKEAFEQRNRFASGHTAYIQSLRRVSIALCNYVDVDE  60

Query  14   -----LDAF  3
                 LDA+
Sbjct  61   HHGFFLDAY  69



>emb|CBI40119.3| unnamed protein product [Vitis vinifera]
Length=715

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK++D  A+ LC+DR  F+ +A+ QR   A  H+AY+QSLR + A+L  + + D
Sbjct  1    MGCSTSKLEDEEAIQLCKDRKRFIKQAVEQRARFASGHIAYIQSLRRVSAALRDYIEGD  59



>ref|XP_004292707.1| PREDICTED: uncharacterized protein LOC101303966 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458794.1| PREDICTED: uncharacterized protein LOC101303966 [Fragaria vesca 
subsp. vesca]
Length=912

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLP V LC++R  ++  A   R +LA AHL Y QSL+ IG +L  F D+DL
Sbjct  1    MGCGGSKVDDLPLVTLCKERRDYIKTASDSRYALAAAHLTYFQSLKQIGDALCKFVDEDL  60



>ref|XP_002453379.1| hypothetical protein SORBIDRAFT_04g005030 [Sorghum bicolor]
 gb|EES06355.1| hypothetical protein SORBIDRAFT_04g005030 [Sorghum bicolor]
Length=613

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+D+  AV  C DR +F+ +AI QRD LA +H+AY+QSLR +  +L ++F +D
Sbjct  1    MGCSSSKLDEEAAVKTCHDRKSFVKKAIAQRDLLASSHVAYVQSLRRVSMALVYYFAED  59



>ref|XP_007014353.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007014354.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31972.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31973.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=749

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKNFIRQAVEQRTRFASGHVAYIQSLKRVSAALRDYIEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_002266764.1| PREDICTED: uncharacterized protein LOC100245404 [Vitis vinifera]
 ref|XP_010656783.1| PREDICTED: uncharacterized protein LOC100245404 [Vitis vinifera]
Length=767

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK++D  A+ LC+DR  F+ +A+ QR   A  H+AY+QSLR + A+L  + + D
Sbjct  1    MGCSTSKLEDEEAIQLCKDRKRFIKQAVEQRARFASGHIAYIQSLRRVSAALRDYIEGD  59



>emb|CAN72045.1| hypothetical protein VITISV_004545 [Vitis vinifera]
Length=769

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK++D  A+ LC+DR  F+ +A+ QR   A  H+AY+QSLR + A+L  + + D
Sbjct  1    MGCSTSKLEDEEAIQLCKDRKRFIKQAVEQRARFASGHIAYIQSLRRVSAALRDYIEGD  59



>ref|XP_008223790.1| PREDICTED: uncharacterized protein LOC103323567 [Prunus mume]
Length=755

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK+DD+ A+ LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  + + D
Sbjct  1    MGCSTSKLDDVEAIQLCKDRKRFIKQALEQRTRFASGHIAYIQSLKRVSAALRDYVEGD  59



>ref|XP_008372262.1| PREDICTED: uncharacterized protein LOC103435647 [Malus domestica]
Length=766

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+  A+ QR   A  H+AY+QSL+ + A+L  + D D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKRFIKLALEQRTRFASGHMAYIQSLKRVSAALRDYIDGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_002527719.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34678.1| conserved hypothetical protein [Ricinus communis]
Length=765

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKRFIKQAVEQRTRFATGHLAYIQSLKRVSAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_009334574.1| PREDICTED: uncharacterized protein LOC103927383 [Pyrus x bretschneideri]
Length=767

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKRFIKQALEQRTRFASGHMAYIQSLKRVSAALRDYIEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_004297892.1| PREDICTED: uncharacterized protein LOC101298310 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462351.1| PREDICTED: uncharacterized protein LOC101298310 [Fragaria vesca 
subsp. vesca]
Length=771

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  + + D
Sbjct  1    MGCSTSKLDDAEAVQLCKDRKRFIKQALEQRARFASGHIAYIQSLKRVSAALRDYIEVD  59



>ref|XP_007138789.1| hypothetical protein PHAVU_009G237700g [Phaseolus vulgaris]
 ref|XP_007138790.1| hypothetical protein PHAVU_009G237700g [Phaseolus vulgaris]
 gb|ESW10783.1| hypothetical protein PHAVU_009G237700g [Phaseolus vulgaris]
 gb|ESW10784.1| hypothetical protein PHAVU_009G237700g [Phaseolus vulgaris]
Length=776

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ S++DD  AV LCRDR  F+ EA+ QR  LA  H+AY++SL+ + A+L  + + D
Sbjct  1    MGCSHSRLDDEEAVQLCRDRKKFIKEAVEQRTRLATGHIAYIESLKRVSAALRDYIEGD  59



>ref|XP_010539656.1| PREDICTED: uncharacterized protein LOC104813668 [Tarenaya hassleriana]
Length=953

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R  F+  A   R +LA AHLAY QSL  +G ++  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKDFIKAASNHRVALAAAHLAYFQSLHDVGEAIRRFVDEEL  60



>gb|KFK40285.1| hypothetical protein AALP_AA3G355000 [Arabis alpina]
Length=830

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+QSLR +  +LH F   D
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIQSLRKVSDALHDFIQGD  59



>gb|EYU38760.1| hypothetical protein MIMGU_mgv1a001690mg [Erythranthe guttata]
Length=772

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC++SK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+Q+++ + A+L  + D D 
Sbjct  1    MGCSSSKLDDEEAVQLCKDRKKFIRQAVEQRTKFASGHIAYIQAMKRVSAALREYIDVDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_010415018.1| PREDICTED: uncharacterized protein LOC104701085 [Camelina sativa]
Length=814

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+QSLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIQSLRKVSDALHDFIIQ  58



>emb|CDP15631.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+ QR   A  H AY+QS+R + A+L  + + D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKKFIKQAVEQRLKFASGHNAYIQSIRRVSAALRDYIEVDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_011019979.1| PREDICTED: uncharacterized protein LOC105122534 [Populus euphratica]
 ref|XP_011019980.1| PREDICTED: uncharacterized protein LOC105122534 [Populus euphratica]
 ref|XP_011019982.1| PREDICTED: uncharacterized protein LOC105122534 [Populus euphratica]
 ref|XP_011019983.1| PREDICTED: uncharacterized protein LOC105122534 [Populus euphratica]
 ref|XP_011015528.1| PREDICTED: uncharacterized protein LOC105119123 [Populus euphratica]
 ref|XP_011015529.1| PREDICTED: uncharacterized protein LOC105119123 [Populus euphratica]
 ref|XP_011015530.1| PREDICTED: uncharacterized protein LOC105119123 [Populus euphratica]
 ref|XP_011015531.1| PREDICTED: uncharacterized protein LOC105119123 [Populus euphratica]
Length=772

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGCTTSK+D+  AV LC+DR  ++ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCTTSKLDEEEAVQLCKDRKRYIKQAVEQRTRFASGHLAYIQSLKRVLAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFFLDSF  69



>ref|XP_010489454.1| PREDICTED: uncharacterized protein LOC104767122 [Camelina sativa]
Length=819

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+QSLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIQSLRKVSDALHDFIIQ  58



>ref|XP_002308122.1| hypothetical protein POPTR_0006s07660g [Populus trichocarpa]
 gb|EEE91645.1| hypothetical protein POPTR_0006s07660g [Populus trichocarpa]
Length=779

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGCTTSK+D+  AV LC+DR  ++ +A+ QR   A  HLAY+QSL+ + A+L  + + D 
Sbjct  1    MGCTTSKLDEEEAVQLCKDRKRYIKQAVEQRTRFASGHLAYIQSLKRVLAALRDYVEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>emb|CDX82615.1| BnaC07g02510D [Brassica napus]
Length=754

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  +V +C+DR  F+ +AI  R   A +H+AY+QSLR +  +LH F + D
Sbjct  1    MGCSHSKLDDEESVQICKDRKRFIKQAIEHRTKFASSHIAYIQSLRKVSDALHDFIEGD  59



>ref|XP_010688436.1| PREDICTED: uncharacterized protein LOC104902374 [Beta vulgaris 
subsp. vulgaris]
Length=811

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC TSK+DD  AV +C+DR  F+ +A+  R   A  H+AY+QSL+ + A+L  + ++D 
Sbjct  1    MGCNTSKLDDEEAVQICKDRKKFIKQALEHRTKFALGHIAYIQSLKRVSAALREYIEEDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>ref|XP_010063403.1| PREDICTED: uncharacterized protein LOC104450514 [Eucalyptus grandis]
 ref|XP_010063404.1| PREDICTED: uncharacterized protein LOC104450514 [Eucalyptus grandis]
Length=924

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SKIDDLP V LCR+R   +  A   R +LAEAH++Y QSL  +G +L  F ++++
Sbjct  1    MGCGGSKIDDLPLVTLCRERKELIRAAAYHRYALAEAHVSYFQSLATVGEALRKFVEEEI  60



>ref|XP_008680889.1| PREDICTED: uncharacterized protein LOC103656015 [Zea mays]
Length=651

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+D+  AV  C DR +F+ +AI QRD LA +H+AY+QSLR +   L ++F +D
Sbjct  1    MGCSSSKLDEEAAVKTCHDRKSFVRKAIAQRDLLASSHVAYVQSLRRVSMGLFYYFAED  59



>ref|XP_010467742.1| PREDICTED: uncharacterized protein LOC104747751 [Camelina sativa]
Length=832

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+QSLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIQSLRKVSDALHDFIIQ  58



>ref|XP_003610071.1| Transcription factor bZIP106 [Medicago truncatula]
Length=775

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ EA+  R   A  H+AY+QSL+ + A+L  +F+++
Sbjct  1    MGCSQSKLDDEEAVKICKDRKRFIKEAVEHRTQFANGHIAYIQSLKRVSAALLDYFEEN  59



>gb|KCW80885.1| hypothetical protein EUGRSUZ_C02248 [Eucalyptus grandis]
Length=570

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+DD  AV LC+DR  F+ EA+ +R   A  H AY+QSLR +  +L  + ++D
Sbjct  1    MGCSSSKLDDEEAVKLCKDRKRFIKEAVAERTRFATGHKAYIQSLRQVSKALWEYIEED  59



>gb|AES92268.2| DUF630 family protein [Medicago truncatula]
Length=738

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ EA+  R   A  H+AY+QSL+ + A+L  +F+++
Sbjct  1    MGCSQSKLDDEEAVKICKDRKRFIKEAVEHRTQFANGHIAYIQSLKRVSAALLDYFEEN  59



>ref|XP_004954692.1| PREDICTED: uncharacterized protein LOC101785694 [Setaria italica]
Length=592

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+D+  AV  C DR +F+ +AI QR  LA +H+AY+QSLR +  +L ++F +D
Sbjct  1    MGCSSSKLDEEAAVKTCHDRKSFVKKAIAQRGLLASSHVAYVQSLRRVSMALFYYFAED  59



>ref|XP_010929390.1| PREDICTED: uncharacterized protein LOC105050877 [Elaeis guineensis]
Length=731

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC TS+++D  AV LC+DR   + +A+ QR   A AH+AY+QSL+ +  +LH+F ++D
Sbjct  1    MGCYTSRLEDEEAVQLCKDRRNLIKQAVEQRIRFASAHVAYIQSLKQVSLALHNFVNRD  59



>ref|XP_010048589.1| PREDICTED: uncharacterized protein LOC104437347 [Eucalyptus grandis]
 ref|XP_010048590.1| PREDICTED: uncharacterized protein LOC104437347 [Eucalyptus grandis]
 ref|XP_010048591.1| PREDICTED: uncharacterized protein LOC104437347 [Eucalyptus grandis]
 gb|KCW80884.1| hypothetical protein EUGRSUZ_C02248 [Eucalyptus grandis]
Length=813

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+DD  AV LC+DR  F+ EA+ +R   A  H AY+QSLR +  +L  + ++D
Sbjct  1    MGCSSSKLDDEEAVKLCKDRKRFIKEAVAERTRFATGHKAYIQSLRQVSKALWEYIEED  59



>ref|XP_006409086.1| hypothetical protein EUTSA_v10022561mg [Eutrema salsugineum]
 gb|ESQ50539.1| hypothetical protein EUTSA_v10022561mg [Eutrema salsugineum]
Length=813

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ +A+  R   A  H+AY+QSLR +  +LH + + D
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAVEHRTKFATGHIAYIQSLRKVSDALHDYIEGD  59



>emb|CDY39136.1| BnaA07g01320D [Brassica napus]
Length=753

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  +V +C+DR  F+ +AI  R   A +H+AY+QSLR +  +LH F   D
Sbjct  1    MGCSHSKLDDEESVQICKDRKRFIKQAIEHRTKFASSHIAYIQSLRKVSDALHDFIQGD  59



>ref|XP_009102233.1| PREDICTED: uncharacterized protein LOC103828380 [Brassica rapa]
Length=786

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  +V +C+DR  F+ +AI  R   A +H+AY+QSLR +  +LH F   D
Sbjct  1    MGCSHSKLDDEESVQICKDRKRFIKQAIEHRTKFASSHIAYIQSLRKVSDALHDFIQGD  59



>ref|XP_009408068.1| PREDICTED: uncharacterized protein LOC103990598 [Musa acuminata 
subsp. malaccensis]
Length=661

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+TSK++D  AV LC DR  F+ +AI QRD  A+ H AY+QSL  +  +L ++ D D
Sbjct  1    MGCSTSKLEDEDAVRLCHDRKNFIRQAIEQRDRFADGHTAYIQSLMRVSLALRNYVDGD  59



>emb|CDY04672.1| BnaC05g17100D [Brassica napus]
Length=872

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASYHRSALAAAHLAYFQSLCDVGESIKRFVDEEL  60



>ref|XP_009149695.1| PREDICTED: uncharacterized protein LOC103873018 [Brassica rapa]
Length=917

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASYHRSALAAAHLAYFQSLCDVGESIKRFVDEEL  60



>ref|XP_006416268.1| hypothetical protein EUTSA_v10006728mg [Eutrema salsugineum]
 gb|ESQ34621.1| hypothetical protein EUTSA_v10006728mg [Eutrema salsugineum]
Length=928

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASHHRCALAAAHLAYFQSLYDVGESIKRFVDEEL  60



>ref|XP_008219621.1| PREDICTED: uncharacterized protein LOC103319804 [Prunus mume]
 ref|XP_008219622.1| PREDICTED: uncharacterized protein LOC103319804 [Prunus mume]
Length=879

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+D+LP V  CR+R  F+  A   R +LA AHL+Y  SL+ IG +L  F D+DL
Sbjct  1    MGCGGSKVDNLPLVTFCRERKDFIKTASDTRYALAAAHLSYFHSLKHIGDALCKFVDEDL  60



>ref|XP_007227662.1| hypothetical protein PRUPE_ppa001150mg [Prunus persica]
 gb|EMJ28861.1| hypothetical protein PRUPE_ppa001150mg [Prunus persica]
Length=895

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+D+LP V  CR+R  F+  A   R +LA AHL+Y  SL+ IG +L  F D+DL
Sbjct  1    MGCGGSKVDNLPLVTFCRERKDFIKTASDTRYALAAAHLSYFHSLKHIGDALCKFVDEDL  60



>gb|KJB15218.1| hypothetical protein B456_002G165300 [Gossypium raimondii]
Length=167

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSL------RAIGASLHH  30
            MGC++SK+DDLPAVALCR+RC+FLDEAI+QR    E       ++      RAI  ++++
Sbjct  1    MGCSSSKLDDLPAVALCRERCSFLDEAIQQRFPSWERSFGSKLNVCVNGRCRAISVTMYN  60

Query  29   F  27
            F
Sbjct  61   F  61



>ref|XP_009408191.1| PREDICTED: uncharacterized protein LOC103990689 [Musa acuminata 
subsp. malaccensis]
Length=788

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC  SK+D+  AVA CR+R   L +AIR R +LA+AH+AY  SLR++GA+L  F +
Sbjct  1    MGCGVSKLDEEAAVAHCRERSLLLADAIRHRYALADAHVAYTLSLRSVGAALEGFLN  57



>gb|AFW66328.1| hypothetical protein ZEAMMB73_916371 [Zea mays]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC++SK+D+  AV  C DR +F+ +AI QRD LA +H+AY+QSLR +   L ++F +D
Sbjct  1    MGCSSSKLDEEAAVKTCHDRKSFVRKAIAQRDLLASSHVAYVQSLRRVSMGLFYYFAED  59



>ref|XP_004507886.1| PREDICTED: uncharacterized protein LOC101505055 [Cicer arietinum]
Length=760

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ S++DD  AV LC+DR  F+ EA+  R   A  H+AY+QSL+ + A+L  +F+ D 
Sbjct  1    MGCSQSRLDDEEAVKLCKDRKRFIKEAVEFRTQFATGHIAYIQSLKRVSAALLDYFEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   ALEFSLDSF  69



>emb|CDY08177.1| BnaA06g15490D [Brassica napus]
Length=891

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASYHRSALAAAHLAYFQSLCDVGDSIKRFVDEEL  60



>emb|CCM72968.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
Length=169

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>ref|XP_006306696.1| hypothetical protein CARUB_v10008218mg [Capsella rubella]
 gb|EOA39594.1| hypothetical protein CARUB_v10008218mg [Capsella rubella]
Length=957

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGASKVDDQPLVILCRERKQLIKAASHHRCALAAAHLAYFQSLCDVGDSIKRFVDEEL  60



>ref|XP_011077703.1| PREDICTED: uncharacterized protein LOC105161647 [Sesamum indicum]
 ref|XP_011077704.1| PREDICTED: uncharacterized protein LOC105161647 [Sesamum indicum]
Length=757

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+TSK+DD  AV LC+DR  F+ +A+  R   A  H+AY+Q+++ + ++L  + D D 
Sbjct  1    MGCSTSKLDDEEAVQLCKDRKKFIRQAVEHRAKFASGHIAYIQAMKRVSSALREYIDGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>emb|CCM73006.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
gemmifera]
Length=172

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>emb|CCM72969.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72970.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72971.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72972.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72973.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72974.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72975.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72976.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72977.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72978.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72979.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72980.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72981.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72982.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72983.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72984.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72985.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72986.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72987.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72988.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72989.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72990.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72991.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72992.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72993.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72994.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72995.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72996.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72997.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72998.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM72999.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM73000.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM73001.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM73002.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM73004.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
 emb|CCM73005.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
Length=172

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>emb|CCM73007.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
gemmifera]
Length=174

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>ref|XP_003550653.1| PREDICTED: uncharacterized protein LOC100776480 isoform X1 [Glycine 
max]
 ref|XP_006600492.1| PREDICTED: uncharacterized protein LOC100776480 isoform X2 [Glycine 
max]
 ref|XP_006600493.1| PREDICTED: uncharacterized protein LOC100776480 isoform X3 [Glycine 
max]
Length=745

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  +F  + 
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKQFIKQAVEQRAQYATGHVAYIQSLKRVSAALLDYFKANE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   SRELSLDSF  69



>emb|CCM73008.1| protein of unknown function, partial [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>ref|XP_010498631.1| PREDICTED: uncharacterized protein LOC104776294 [Camelina sativa]
Length=963

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASHHRCALAAAHLAYFQSLCDVGESIKRFVDEEL  60



>ref|XP_010477421.1| PREDICTED: uncharacterized protein LOC104756514 [Camelina sativa]
Length=967

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHLAY QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASHHRCALAAAHLAYFQSLCDVGESIKRFVDEEL  60



>gb|KHN17621.1| hypothetical protein glysoja_005818 [Glycine soja]
Length=745

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LC+DR  F+ +A+ QR   A  H+AY+QSL+ + A+L  +F  + 
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKQFIKKAVEQRAQYATGHVAYIQSLKRVSAALLDYFKANE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   LRELSLDSF  69



>ref|XP_002300979.2| hypothetical protein POPTR_0002s08250g [Populus trichocarpa]
 gb|EEE80252.2| hypothetical protein POPTR_0002s08250g [Populus trichocarpa]
Length=881

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLP V LCR+R   +  A   R +LA AH+AY  SLR +G ++  F D+ L
Sbjct  1    MGCGGSKVDDLPLVVLCRERKEVIKAASDHRYALAAAHVAYFHSLRDVGDAIRRFVDEGL  60



>ref|XP_010259879.1| PREDICTED: uncharacterized protein LOC104599165 [Nelumbo nucifera]
Length=777

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+ SK+D+  AV LC+DR  F+ +A+ QR   A  H+AYLQSL+ +  +LH++ +
Sbjct  1    MGCSNSKLDNEKAVQLCKDRKRFIKQAVEQRIRFASVHVAYLQSLKRVSDALHNYVE  57



>ref|XP_007019109.1| Uncharacterized protein TCM_035147 [Theobroma cacao]
 gb|EOY16334.1| Uncharacterized protein TCM_035147 [Theobroma cacao]
Length=960

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLP V LC++R   +  A   R +LA AH+ Y  SLR +G ++  F D++L
Sbjct  49   MGCGPSKVDDLPLVTLCKERKELIKAASIHRSALAAAHVTYFHSLRDVGEAIRRFVDEEL  108



>emb|CBI19002.3| unnamed protein product [Vitis vinifera]
Length=832

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AH++Y +SL+ +G +L  F D++L
Sbjct  1    MGCGGSKVDDYPLVTLCRERKELIRAAAEHRYALASAHISYFRSLKDVGDALRRFVDEEL  60



>ref|XP_002284506.1| PREDICTED: uncharacterized protein LOC100254101 [Vitis vinifera]
Length=855

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AH++Y +SL+ +G +L  F D++L
Sbjct  1    MGCGGSKVDDYPLVTLCRERKELIRAAAEHRYALASAHISYFRSLKDVGDALRRFVDEEL  60



>emb|CAN81539.1| hypothetical protein VITISV_026340 [Vitis vinifera]
Length=869

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AH++Y +SL+ +G +L  F D++L
Sbjct  1    MGCGGSKVDDYPLVTLCRERKELIRAAAEHRYALASAHISYFRSLKDVGDALRRFVDEEL  60



>gb|KHN22673.1| hypothetical protein glysoja_027561 [Glycine soja]
Length=749

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LC+DR  F+ +A+ QR   A  H AY+QSL+ + A+L  + + D 
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKRFIKQAVEQRTQFATGHAAYIQSLKRVSAALLDYLEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   SRQLPLDSF  69



>gb|AAD12027.1| hypothetical protein [Arabidopsis thaliana]
Length=844

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRKVSDALHDFILQ  58



>ref|XP_010999400.1| PREDICTED: uncharacterized protein LOC105107244 [Populus euphratica]
Length=877

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DDLP V LCR+R   +  A   R +LA AH+AY  SLR +G ++  F D+ L
Sbjct  1    MGCGGSKVDDLPLVTLCRERKEEIKAAADHRYALAAAHVAYFHSLREVGVAISRFVDEGL  60



>ref|XP_003543739.1| PREDICTED: uncharacterized protein LOC100818631 isoform X1 [Glycine 
max]
 ref|XP_006593525.1| PREDICTED: uncharacterized protein LOC100818631 isoform X2 [Glycine 
max]
Length=749

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC+ SK+DD  AV LC+DR  F+ +A+ QR   A  H AY+QSL+ + A+L  + + D 
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKRFIKQAVEQRTQFATGHAAYIQSLKRVSAALLDYLEGDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   SRQLPLDSF  69



>ref|XP_009112579.1| PREDICTED: uncharacterized protein LOC103837937 isoform X2 [Brassica 
rapa]
Length=810

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ +AI+ R   A  H+AY+ SLR +  +LH F   D
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIQDRTKFASGHIAYINSLRQVSDALHDFIQGD  59



>ref|XP_009112577.1| PREDICTED: uncharacterized protein LOC103837937 isoform X1 [Brassica 
rapa]
 ref|XP_009112578.1| PREDICTED: uncharacterized protein LOC103837937 isoform X1 [Brassica 
rapa]
Length=811

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ +AI+ R   A  H+AY+ SLR +  +LH F   D
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIQDRTKFASGHIAYINSLRQVSDALHDFIQGD  59



>ref|XP_010541139.1| PREDICTED: uncharacterized protein LOC104814668 [Tarenaya hassleriana]
 ref|XP_010541140.1| PREDICTED: uncharacterized protein LOC104814668 [Tarenaya hassleriana]
 ref|XP_010541141.1| PREDICTED: uncharacterized protein LOC104814668 [Tarenaya hassleriana]
 ref|XP_010541142.1| PREDICTED: uncharacterized protein LOC104814668 [Tarenaya hassleriana]
 ref|XP_010541143.1| PREDICTED: uncharacterized protein LOC104814668 [Tarenaya hassleriana]
Length=789

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  AV +C+DR  F+ +A+ QR   A  H+AY+QS++ +  +L  + ++D
Sbjct  1    MGCSQSKLDDEEAVRICKDRKRFIKQAVEQRTKFASGHIAYIQSMKRVSDALREYIEED  59



>ref|XP_004148319.1| PREDICTED: uncharacterized protein LOC101219989 [Cucumis sativus]
Length=781

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+ SK++D  AV LC+DR +F+ +A+ QR   A  HLAY+QSL+ + A+L  + +
Sbjct  1    MGCSMSKLEDEEAVKLCKDRKSFIKQAVEQRRRFACGHLAYIQSLKRVSAALREYVN  57



>ref|XP_010095406.1| hypothetical protein L484_013362 [Morus notabilis]
 gb|EXB60098.1| hypothetical protein L484_013362 [Morus notabilis]
Length=878

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASL  36
            MGC +SK+DDLP V LCR+R  F+  A   R +LA AHL+Y QSL+ IG +L
Sbjct  1    MGCGSSKVDDLPLVTLCRERRDFIKAASDHRYALAAAHLSYFQSLKDIGDAL  52



>gb|KGN61160.1| hypothetical protein Csa_2G060410 [Cucumis sativus]
Length=841

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+ SK++D  AV LC+DR +F+ +A+ QR   A  HLAY+QSL+ + A+L  + +
Sbjct  1    MGCSMSKLEDEEAVKLCKDRKSFIKQAVEQRRRFACGHLAYIQSLKRVSAALREYVN  57



>ref|NP_179499.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06847.1| uncharacterized protein AT2G19090 [Arabidopsis thaliana]
Length=814

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRKVSDALHDFILQ  58



>ref|XP_004163025.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230811 
[Cucumis sativus]
Length=812

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+ SK++D  AV LC+DR +F+ +A+ QR   A  HLAY+QSL+ + A+L  + +
Sbjct  1    MGCSMSKLEDEEAVKLCKDRKSFIKQAVEQRRRFACGHLAYIQSLKRVSAALREYVN  57



>gb|KHN35792.1| hypothetical protein glysoja_013217 [Glycine soja]
Length=732

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ S++DD  AV LC+DR  F+ +A+ QR   A  H+AY++SL+ + A+L ++ + D
Sbjct  1    MGCSHSRLDDEEAVRLCKDRKKFIRQAVEQRTQFATGHIAYIESLKRVSAALRNYIEGD  59



>gb|KJB59267.1| hypothetical protein B456_009G246800 [Gossypium raimondii]
Length=941

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK DDLP V LC++R   +  A   R +LA AH+ Y  SLR +G ++  F D++L
Sbjct  38   MGCGPSKADDLPLVTLCKERKELIKAATIHRSALAAAHVTYFHSLRDVGEAIRRFVDEEL  97



>ref|XP_003534891.1| PREDICTED: uncharacterized protein LOC100775759 isoform X1 [Glycine 
max]
 ref|XP_006586988.1| PREDICTED: uncharacterized protein LOC100775759 isoform X2 [Glycine 
max]
Length=765

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ S++DD  AV LC+DR  F+ +A+ QR   A  H+AY++SL+ + A+L ++ + D
Sbjct  1    MGCSHSRLDDEEAVRLCKDRKKFIRQAVEQRTQFATGHIAYIESLKRVSAALRNYIEGD  59



>emb|CCM73003.1| protein of unknown function, partial [Arabidopsis halleri subsp. 
halleri]
Length=172

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ S++DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSRLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>ref|XP_002890461.1| hypothetical protein ARALYDRAFT_472413 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66720.1| hypothetical protein ARALYDRAFT_472413 [Arabidopsis lyrata subsp. 
lyrata]
Length=942

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHL+Y QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASHHRCALAAAHLSYFQSLCDVGESIKRFVDEEL  60



>ref|XP_010459896.1| PREDICTED: uncharacterized protein LOC104740870 [Camelina sativa]
Length=964

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHL+Y QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKELIKAASHHRCALAAAHLSYFQSLCDVGESIKRFVDEEL  60



>gb|EPS69223.1| hypothetical protein M569_05540 [Genlisea aurea]
Length=752

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD-  15
            MGC++SK+D+  AV LC+DR  F+ +A+  R   A  H+AYLQ+++ + A+L  + D+D 
Sbjct  1    MGCSSSKLDEEEAVRLCKDRKKFIRQAVEHRLKFAAGHVAYLQAMKRVSAALREYIDEDE  60

Query  14   -----LDAF  3
                 LD+F
Sbjct  61   PREFLLDSF  69



>gb|KJB59268.1| hypothetical protein B456_009G246800 [Gossypium raimondii]
Length=904

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK DDLP V LC++R   +  A   R +LA AH+ Y  SLR +G ++  F D++L
Sbjct  1    MGCGPSKADDLPLVTLCKERKELIKAATIHRSALAAAHVTYFHSLRDVGEAIRRFVDEEL  60



>emb|CDX87516.1| BnaA07g33570D [Brassica napus]
Length=450

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC  SKIDD   V LCR+R   +  A   R +LA AHL YLQSLR +G ++  F D++
Sbjct  1    MGCGGSKIDDQQLVILCRERKDLIKTASHHRTALAVAHLVYLQSLRDVGEAIQRFVDEE  59



>gb|ACC68166.1| unknown [Arabidopsis halleri subsp. halleri]
Length=814

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>ref|XP_002884177.1| hypothetical protein ARALYDRAFT_480823 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60436.1| hypothetical protein ARALYDRAFT_480823 [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQ  18
            MGC+ SK+DD  AV +C+DR  F+ +AI  R   A  H+AY+ SLR +  +LH F  Q
Sbjct  1    MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRNVSDALHDFIIQ  58



>emb|CDX88372.1| BnaC06g38160D [Brassica napus]
Length=826

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC  SKIDD   V LCR+R   +  A   R +LA AHL YLQSLR +G ++  F D++
Sbjct  1    MGCGGSKIDDQQLVILCRERKELIKTASHHRTALAVAHLVYLQSLRDVGEAIQRFVDEE  59



>ref|NP_173593.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41429.1|AC007727_18 EST gb|T20649 comes from this gene [Arabidopsis thaliana]
 dbj|BAH30311.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30150.1| uncharacterized protein AT1G21740 [Arabidopsis thaliana]
Length=953

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  SK+DD P V LCR+R   +  A   R +LA AHL+Y QSL  +G S+  F D++L
Sbjct  1    MGCGGSKVDDQPLVILCRERKQLIKAASHHRCALAAAHLSYFQSLCDVGDSIKRFVDEEL  60



>gb|EPS65905.1| hypothetical protein M569_08874, partial [Genlisea aurea]
Length=695

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQDL  12
            MGC  S++ D P V LCR RC FLDEAI  R + A AH AYL SL  +G SL  FF  DL
Sbjct  1    MGCAASRLQDSPPVVLCRHRCDFLDEAIHHRFAFAHAHAAYLNSLTVVGDSLQSFFQGDL  60



>ref|XP_008451443.1| PREDICTED: uncharacterized protein LOC103492734 [Cucumis melo]
 ref|XP_008451453.1| PREDICTED: uncharacterized protein LOC103492734 [Cucumis melo]
Length=804

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFD  21
            MGC+ SK++D  AV LC+DR +F+ +A+ QR   A  HLAY+QSL+ + A+L  + +
Sbjct  1    MGCSMSKLEDEEAVKLCKDRKSFIKQAVEQRRLFACGHLAYIQSLKRVSAALREYVN  57



>gb|KEH37419.1| DUF630 family protein [Medicago truncatula]
Length=927

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  +V LC+DR  F+ +A+ QR   A  H+AY++S++ + A+L  + + D
Sbjct  1    MGCSQSKLDDEESVQLCKDRKRFIKQAVEQRTRFATGHIAYIESMKRVSAALRDYIEGD  59



>gb|KHN15320.1| hypothetical protein glysoja_026615 [Glycine soja]
Length=773

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ S++DD  AV LC+DR  F+ +A+ QR   A  H+AY++SL+ + A+L  + + D
Sbjct  1    MGCSHSRLDDEEAVRLCKDRKKFIKQAVEQRTRFATGHIAYIESLKRVSAALRDYIEGD  59



>ref|XP_003547444.1| PREDICTED: uncharacterized protein LOC100780704 [Glycine max]
Length=773

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ S++DD  AV LC+DR  F+ +A+ QR   A  H+AY++SL+ + A+L  + + D
Sbjct  1    MGCSHSRLDDEEAVRLCKDRKKFIKQAVEQRTRFATGHIAYIESLKRVSAALRDYIEGD  59



>ref|XP_003594980.1| BZIP transcription factor bZIP82 [Medicago truncatula]
Length=956

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  191  MGCTTSKIDDLPAVALCRDRCAFLDEAIRQRDSLAEAHLAYLQSLRAIGASLHHFFDQD  15
            MGC+ SK+DD  +V LC+DR  F+ +A+ QR   A  H+AY++S++ + A+L  + + D
Sbjct  1    MGCSQSKLDDEESVQLCKDRKRFIKQAVEQRTRFATGHIAYIESMKRVSAALRDYIEGD  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569837304960