BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005E06 658 bp,

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  233   4e-71   Sesamum indicum [beniseed]
emb|CBI19558.3|  unnamed protein product                                231   3e-70   Vitis vinifera
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  231   4e-70   Vitis vinifera
emb|CAN68798.1|  hypothetical protein VITISV_008805                     230   4e-70   Vitis vinifera
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          229   2e-69   Amborella trichopoda
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  228   3e-69   Vitis vinifera
emb|CBI19560.3|  unnamed protein product                                230   4e-69   Vitis vinifera
emb|CBI19549.3|  unnamed protein product                                228   5e-69   Vitis vinifera
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  228   6e-69   Vitis vinifera
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  227   7e-69   Vitis vinifera
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  227   8e-69   Vitis vinifera
emb|CAN81920.1|  hypothetical protein VITISV_021802                     227   1e-68   Vitis vinifera
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  225   6e-68   Vitis vinifera
emb|CAN71271.1|  hypothetical protein VITISV_001907                     224   2e-67   Vitis vinifera
ref|XP_004979715.1|  PREDICTED: patatin-2-Kuras 1-like                  222   9e-67   Setaria italica
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  222   9e-67   Nicotiana sylvestris
gb|KCW66175.1|  hypothetical protein EUGRSUZ_F00011                     219   1e-66   Eucalyptus grandis [rose gum]
ref|XP_003603015.1|  Patatin-like protein                               221   2e-66   Medicago truncatula
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    231   2e-66   Vitis vinifera
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  221   2e-66   Glycine max [soybeans]
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       221   2e-66   Populus euphratica
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       221   3e-66   Populus euphratica
emb|CDP01337.1|  unnamed protein product                                221   3e-66   Coffea canephora [robusta coffee]
ref|XP_010059971.1|  PREDICTED: patatin-like protein 2 isoform X2       218   3e-66   Eucalyptus grandis [rose gum]
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       220   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_003589237.1|  Patatin-like protein                               216   7e-66   Medicago truncatula
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  219   9e-66   Eucalyptus grandis [rose gum]
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     219   9e-66   Eucalyptus grandis [rose gum]
gb|KCW66180.1|  hypothetical protein EUGRSUZ_F00017                     217   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010064190.1|  PREDICTED: patatin-like protein 2                  217   1e-65   Eucalyptus grandis [rose gum]
emb|CBI19557.3|  unnamed protein product                                227   1e-65   Vitis vinifera
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  219   1e-65   Eucalyptus grandis [rose gum]
ref|XP_009629882.1|  PREDICTED: patatin-like protein 2                  213   2e-65   Nicotiana tomentosiformis
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          218   2e-65   Sorghum bicolor [broomcorn]
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       218   3e-65   Eucalyptus grandis [rose gum]
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       218   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       218   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003603014.1|  Patatin-like protein                               218   4e-65   Medicago truncatula
emb|CDP04311.1|  unnamed protein product                                218   4e-65   Coffea canephora [robusta coffee]
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  218   5e-65   Setaria italica
emb|CDP11077.1|  unnamed protein product                                217   6e-65   Coffea canephora [robusta coffee]
gb|KJB29508.1|  hypothetical protein B456_005G104200                    216   1e-64   Gossypium raimondii
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             216   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1       216   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_006388384.1|  hypothetical protein POPTR_0202s00210g             214   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  216   2e-64   Eucalyptus grandis [rose gum]
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  216   2e-64   Populus euphratica
ref|XP_003589236.1|  Patatin-like protein                               216   2e-64   Medicago truncatula
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       216   2e-64   Populus euphratica
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       216   2e-64   Solanum lycopersicum
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             216   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_003589238.1|  Patatin-like protein                               216   3e-64   Medicago truncatula
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       215   3e-64   Populus euphratica
gb|EMT13605.1|  Patatin group A-3                                       215   3e-64   Aegilops tauschii
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       215   3e-64   Glycine max [soybeans]
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       215   3e-64   Nicotiana sylvestris
gb|KHN12765.1|  Patatin group A-3                                       215   3e-64   Glycine soja [wild soybean]
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             215   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       215   4e-64   Populus euphratica
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             215   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  215   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       215   4e-64   Populus euphratica
gb|EMT08201.1|  Patatin-T5                                              211   5e-64   Aegilops tauschii
ref|XP_002310732.1|  patatin family protein                             214   7e-64   Populus trichocarpa [western balsam poplar]
gb|AFK35290.1|  unknown                                                 214   8e-64   Medicago truncatula
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  214   9e-64   Solanum tuberosum [potatoes]
ref|XP_006374974.1|  hypothetical protein POPTR_0014s03260g             214   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  214   1e-63   Solanum lycopersicum
gb|EMT30617.1|  Patatin group A-3                                       214   1e-63   Aegilops tauschii
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       214   1e-63   
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       214   1e-63   Cicer arietinum [garbanzo]
gb|EMS52853.1|  Patatin group M-3                                       214   1e-63   Triticum urartu
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  213   2e-63   Eucalyptus grandis [rose gum]
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  213   3e-63   Solanum tuberosum [potatoes]
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 213   4e-63   Theobroma cacao [chocolate]
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  213   4e-63   Solanum tuberosum [potatoes]
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  213   4e-63   Nicotiana sylvestris
gb|KGN62540.1|  hypothetical protein Csa_2G360570                       210   4e-63   Cucumis sativus [cucumbers]
ref|XP_010098699.1|  Patatin group A-3                                  213   4e-63   Morus notabilis
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  213   4e-63   Eucalyptus grandis [rose gum]
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     212   5e-63   Eucalyptus grandis [rose gum]
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     212   5e-63   Eucalyptus grandis [rose gum]
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  212   5e-63   Eucalyptus grandis [rose gum]
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g             212   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  212   6e-63   Eucalyptus grandis [rose gum]
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       212   6e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  213   7e-63   Nicotiana tomentosiformis
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  212   8e-63   Populus euphratica
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  211   9e-63   Eucalyptus grandis [rose gum]
ref|XP_008670872.1|  PREDICTED: patatin-like protein 1                  209   9e-63   Zea mays [maize]
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  211   1e-62   Eucalyptus grandis [rose gum]
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             211   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  211   2e-62   Phoenix dactylifera
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  211   2e-62   Sesamum indicum [beniseed]
emb|CDP07844.1|  unnamed protein product                                211   2e-62   Coffea canephora [robusta coffee]
ref|XP_003527713.1|  PREDICTED: patatin-like                            211   2e-62   Glycine max [soybeans]
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             211   2e-62   Populus trichocarpa [western balsam poplar]
gb|AEF30538.1|  patatin-like phospholipase 1                            211   2e-62   Capsicum annuum
gb|KJB63808.1|  hypothetical protein B456_010G0176001                   205   3e-62   Gossypium raimondii
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  210   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      210   4e-62   Theobroma cacao [chocolate]
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  210   4e-62   Eucalyptus grandis [rose gum]
ref|XP_002510258.1|  Patatin T5 precursor, putative                     210   4e-62   
tpg|DAA42306.1|  TPA: patatin T5                                        209   5e-62   Zea mays [maize]
ref|XP_010320535.1|  PREDICTED: patatin-like protein 2                  209   5e-62   Solanum lycopersicum
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  209   6e-62   Eucalyptus grandis [rose gum]
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  209   6e-62   Cucumis sativus [cucumbers]
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   209   6e-62   Citrus sinensis [Valencia orange]
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       209   6e-62   Solanum lycopersicum
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   209   7e-62   Zea mays [maize]
ref|XP_008671927.1|  PREDICTED: patatin-like protein 3                  206   7e-62   Zea mays [maize]
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  209   8e-62   Vitis vinifera
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  209   8e-62   Brachypodium distachyon [annual false brome]
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  209   8e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45954.1|  Patatin group A-3                                       209   8e-62   Triticum urartu
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       208   9e-62   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  209   1e-61   Phoenix dactylifera
emb|CBI25858.3|  unnamed protein product                                208   1e-61   Vitis vinifera
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             209   1e-61   Phaseolus vulgaris [French bean]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             209   1e-61   Phaseolus vulgaris [French bean]
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       208   1e-61   Eucalyptus grandis [rose gum]
emb|CAN62059.1|  hypothetical protein VITISV_024099                     208   1e-61   Vitis vinifera
emb|CBI19544.3|  unnamed protein product                                210   1e-61   Vitis vinifera
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  208   2e-61   Solanum tuberosum [potatoes]
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  210   2e-61   
tpg|DAA42302.1|  TPA: hypothetical protein ZEAMMB73_996038              209   2e-61   Zea mays [maize]
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             208   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002262942.1|  PREDICTED: patatin-like protein 2                  208   2e-61   Vitis vinifera
gb|KHN12766.1|  Patatin-3-Kuras 1                                       206   2e-61   Glycine soja [wild soybean]
gb|KGN62064.1|  hypothetical protein Csa_2G294910                       205   2e-61   Cucumis sativus [cucumbers]
emb|CDP02475.1|  unnamed protein product                                208   2e-61   Coffea canephora [robusta coffee]
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  208   3e-61   Elaeis guineensis
ref|XP_006466736.1|  PREDICTED: patatin-11-like                         207   3e-61   Citrus sinensis [Valencia orange]
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          207   3e-61   Sorghum bicolor [broomcorn]
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        207   3e-61   Nicotiana tabacum [American tobacco]
gb|KHN04516.1|  Patatin group A-3                                       208   3e-61   Glycine soja [wild soybean]
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  207   3e-61   Eucalyptus grandis [rose gum]
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       208   3e-61   Cicer arietinum [garbanzo]
tpg|DAA42304.1|  TPA: hypothetical protein ZEAMMB73_137328              205   3e-61   Zea mays [maize]
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       207   4e-61   Malus domestica [apple tree]
gb|EPS59074.1|  hypothetical protein M569_15736                         206   4e-61   Genlisea aurea
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  207   4e-61   Nicotiana tomentosiformis
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  207   4e-61   Solanum lycopersicum
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  207   4e-61   Vitis vinifera
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  207   5e-61   Solanum tuberosum [potatoes]
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  207   5e-61   Solanum lycopersicum
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  207   5e-61   Phoenix dactylifera
emb|CDP02483.1|  unnamed protein product                                207   6e-61   Coffea canephora [robusta coffee]
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       207   6e-61   Eucalyptus grandis [rose gum]
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       207   7e-61   Vitis vinifera
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         206   7e-61   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  206   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  206   9e-61   Nicotiana sylvestris
gb|KHG27256.1|  Patatin group M-3                                       206   1e-60   Gossypium arboreum [tree cotton]
ref|NP_001151996.1|  patatin T5                                         206   1e-60   Zea mays [maize]
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       206   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_009617802.1|  PREDICTED: patatin-like protein 2 isoform X2       204   2e-60   Nicotiana tomentosiformis
ref|NP_001068268.1|  Os11g0614400                                       206   2e-60   
ref|XP_004980751.1|  PREDICTED: patatin group D-2-like                  203   2e-60   Setaria italica
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            206   2e-60   Theobroma cacao [chocolate]
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              209   2e-60   Zea mays [maize]
gb|EAY88437.1|  hypothetical protein OsI_09902                          206   2e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  206   2e-60   Nicotiana sylvestris
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          205   2e-60   Sorghum bicolor [broomcorn]
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  205   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  205   2e-60   Populus euphratica
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     205   2e-60   Eucalyptus grandis [rose gum]
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       205   3e-60   Malus domestica [apple tree]
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  205   3e-60   Cucumis melo [Oriental melon]
emb|CAA73328.1|  patatin-like protein                                   205   4e-60   Cucumis sativus [cucumbers]
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             204   5e-60   Phaseolus vulgaris [French bean]
gb|AAD22169.1|AF061282_23  patatin-like protein                         205   5e-60   Sorghum bicolor [broomcorn]
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       204   5e-60   Nicotiana sylvestris
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             204   6e-60   Phaseolus vulgaris [French bean]
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  204   6e-60   Cucumis melo [Oriental melon]
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  204   8e-60   Nicotiana tomentosiformis
gb|KJB58443.1|  hypothetical protein B456_009G210300                    201   8e-60   Gossypium raimondii
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  204   8e-60   Vitis vinifera
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  204   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  204   9e-60   Nicotiana sylvestris
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          204   1e-59   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  204   1e-59   Nicotiana tomentosiformis
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  205   1e-59   
ref|XP_008813725.1|  PREDICTED: patatin-like protein 2 isoform X2       201   1e-59   Phoenix dactylifera
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  204   1e-59   Vitis vinifera
ref|XP_010238243.1|  PREDICTED: patatin-like protein 2 isoform X3       201   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_004288058.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Fragaria vesca subsp. vesca
ref|XP_006660709.1|  PREDICTED: patatin-2-Kuras 2-like isoform X1       201   1e-59   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Phoenix dactylifera
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Nicotiana tomentosiformis
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       204   1e-59   Nicotiana tomentosiformis
emb|CBI21444.3|  unnamed protein product                                204   1e-59   Vitis vinifera
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  203   1e-59   Sesamum indicum [beniseed]
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  203   2e-59   Malus domestica [apple tree]
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    202   2e-59   
emb|CBI19552.3|  unnamed protein product                                204   2e-59   Vitis vinifera
ref|XP_002324124.2|  hypothetical protein POPTR_0017s02550g             201   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  202   2e-59   Solanum tuberosum [potatoes]
emb|CDP01332.1|  unnamed protein product                                202   3e-59   Coffea canephora [robusta coffee]
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         202   3e-59   Solanum tuberosum [potatoes]
tpg|DAA45677.1|  TPA: hypothetical protein ZEAMMB73_598493              202   3e-59   Zea mays [maize]
gb|KJB29505.1|  hypothetical protein B456_005G103900                    202   3e-59   Gossypium raimondii
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             202   3e-59   Prunus persica
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       202   3e-59   Solanum lycopersicum
gb|KJB71085.1|  hypothetical protein B456_011G105000                    201   3e-59   Gossypium raimondii
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  202   4e-59   Nicotiana sylvestris
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             202   4e-59   Prunus persica
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  202   4e-59   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002523555.1|  Patatin precursor, putative                        202   4e-59   Ricinus communis
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                  201   4e-59   Nelumbo nucifera [Indian lotus]
emb|CAN71554.1|  hypothetical protein VITISV_034739                     205   4e-59   Vitis vinifera
gb|KJB58445.1|  hypothetical protein B456_009G210500                    202   5e-59   Gossypium raimondii
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         202   5e-59   Solanum tuberosum [potatoes]
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      202   5e-59   Theobroma cacao [chocolate]
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             202   5e-59   Prunus persica
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  202   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  202   5e-59   Solanum tuberosum [potatoes]
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       202   5e-59   Phoenix dactylifera
ref|XP_008777592.1|  PREDICTED: patatin-like protein 2                  204   6e-59   Phoenix dactylifera
gb|AAD22149.1|AF061282_2  patatin-like protein                          202   6e-59   Sorghum bicolor [broomcorn]
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       201   6e-59   Brachypodium distachyon [annual false brome]
gb|ACN36732.1|  unknown                                                 199   7e-59   Zea mays [maize]
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                  202   8e-59   Zea mays [maize]
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  201   8e-59   Prunus mume [ume]
ref|XP_006663045.1|  PREDICTED: patatin-2-Kuras 1-like                  201   8e-59   Oryza brachyantha
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  201   8e-59   Nicotiana tomentosiformis
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  201   1e-58   Elaeis guineensis
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       201   1e-58   Vitis vinifera
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  201   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008457870.1|  PREDICTED: patatin-like protein 2 isoform X2       199   1e-58   Cucumis melo [Oriental melon]
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  201   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       201   1e-58   Eucalyptus grandis [rose gum]
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                  201   1e-58   Brachypodium distachyon [annual false brome]
emb|CBI19553.3|  unnamed protein product                                201   1e-58   Vitis vinifera
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       201   1e-58   Vitis vinifera
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  200   2e-58   Vitis vinifera
gb|KCW54997.1|  hypothetical protein EUGRSUZ_I00973                     197   2e-58   Eucalyptus grandis [rose gum]
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  201   2e-58   Eucalyptus grandis [rose gum]
gb|KCW66469.1|  hypothetical protein EUGRSUZ_F002673                    196   2e-58   Eucalyptus grandis [rose gum]
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  200   2e-58   Malus domestica [apple tree]
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       199   2e-58   Nicotiana sylvestris
ref|XP_009590385.1|  PREDICTED: patatin-like protein 2                  198   2e-58   Nicotiana tomentosiformis
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     200   2e-58   Eucalyptus grandis [rose gum]
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  199   2e-58   
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          200   2e-58   Amborella trichopoda
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  200   2e-58   Nicotiana sylvestris
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                  200   2e-58   Sesamum indicum [beniseed]
gb|EYU21992.1|  hypothetical protein MIMGU_mgv1a024079mg                193   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             200   3e-58   Prunus persica
ref|XP_002301194.1|  patatin-like family protein                        200   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                  200   3e-58   Fragaria vesca subsp. vesca
ref|XP_008777593.1|  PREDICTED: patatin-like protein 3                  194   3e-58   Phoenix dactylifera
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        200   3e-58   Nicotiana tabacum [American tobacco]
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       200   3e-58   
gb|KGN62058.1|  hypothetical protein Csa_2G293860                       196   3e-58   Cucumis sativus [cucumbers]
gb|KJB58442.1|  hypothetical protein B456_009G210300                    200   3e-58   Gossypium raimondii
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       199   3e-58   Nelumbo nucifera [Indian lotus]
gb|ACG31156.1|  patatin T5 precursor                                    199   4e-58   Zea mays [maize]
gb|AAX99411.1|  patatin-like protein                                    200   4e-58   Gossypium hirsutum [American cotton]
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      199   4e-58   Theobroma cacao [chocolate]
ref|NP_001151190.1|  LOC100284823                                       199   4e-58   Zea mays [maize]
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       200   4e-58   Prunus mume [ume]
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       199   4e-58   Prunus mume [ume]
gb|ACN25198.1|  unknown                                                 199   4e-58   Zea mays [maize]
ref|XP_009626816.1|  PREDICTED: patatin-like protein 3                  199   4e-58   Nicotiana tomentosiformis
ref|XP_004291130.1|  PREDICTED: patatin-like protein 2                  199   4e-58   Fragaria vesca subsp. vesca
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  199   5e-58   Populus euphratica
ref|NP_001140826.1|  uncharacterized protein LOC100272901               200   5e-58   Zea mays [maize]
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  200   6e-58   Fragaria vesca subsp. vesca
gb|KJB58444.1|  hypothetical protein B456_009G210400                    199   6e-58   Gossypium raimondii
ref|XP_002510257.1|  Patatin T5 precursor, putative                     199   6e-58   Ricinus communis
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    203   6e-58   
ref|XP_008457869.1|  PREDICTED: patatin-like protein 2 isoform X1       199   7e-58   Cucumis melo [Oriental melon]
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  199   9e-58   Prunus mume [ume]
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                  198   1e-57   Phoenix dactylifera
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         198   1e-57   Jatropha curcas
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  198   1e-57   Malus domestica [apple tree]
ref|XP_010028279.1|  PREDICTED: patatin-like protein 2 isoform X2       196   1e-57   
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    198   1e-57   
ref|XP_009409647.1|  PREDICTED: patatin-like protein 2                  196   1e-57   
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2       197   1e-57   
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  197   1e-57   
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       197   1e-57   
emb|CDP01331.1|  unnamed protein product                                198   2e-57   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     198   2e-57   
gb|KJB40252.1|  hypothetical protein B456_007G053800                    197   2e-57   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    199   2e-57   
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    198   2e-57   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             197   2e-57   
ref|XP_010109903.1|  Patatin group A-3                                  197   2e-57   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  198   2e-57   
ref|XP_008357456.1|  PREDICTED: patatin-like protein 2                  193   2e-57   
emb|CDX72620.1|  BnaC07g46420D                                          197   2e-57   
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  198   2e-57   
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         197   2e-57   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  197   2e-57   
ref|XP_004233945.1|  PREDICTED: patatin-like protein 2                  197   3e-57   
gb|AFJ92643.2|  phospholipase A2                                        197   3e-57   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  197   3e-57   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  197   4e-57   
dbj|BAK06341.1|  predicted protein                                      197   4e-57   
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       196   4e-57   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             196   4e-57   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             197   4e-57   
ref|XP_010101001.1|  Patatin group A-3                                  197   4e-57   
ref|XP_007047189.1|  Phospholipase A 2A, IIA,PLA2A                      196   4e-57   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    197   5e-57   
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  196   6e-57   
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  197   6e-57   
ref|XP_008790455.1|  PREDICTED: patatin-like protein 3                  192   6e-57   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  197   6e-57   
gb|AAM20447.1|  patatin-like protein                                    194   7e-57   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1       196   7e-57   
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             196   8e-57   
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  196   8e-57   
ref|XP_004288059.1|  PREDICTED: patatin-like protein 1                  195   1e-56   
ref|XP_009799007.1|  PREDICTED: patatin-like protein 3                  196   1e-56   
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          196   1e-56   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  196   1e-56   
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                  199   1e-56   
gb|KGN62539.1|  hypothetical protein Csa_2G360560                       193   2e-56   
ref|XP_003544453.1|  PREDICTED: patatin-05                              195   2e-56   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  195   2e-56   
ref|XP_010028281.1|  PREDICTED: patatin-like protein 2                  195   2e-56   
ref|XP_009139287.1|  PREDICTED: patatin-like protein 1                  195   2e-56   
gb|ABK94710.1|  unknown                                                 190   2e-56   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          196   2e-56   
emb|CDX69270.1|  BnaC01g01830D                                          195   2e-56   
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  201   2e-56   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            195   3e-56   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  194   3e-56   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  196   5e-56   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  193   5e-56   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       194   6e-56   
ref|XP_002510255.1|  Patatin precursor, putative                        194   6e-56   
ref|NP_195422.3|  PATATIN-like protein 4                                194   7e-56   
emb|CDX69269.1|  BnaC01g01840D                                          194   7e-56   
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  194   7e-56   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  194   7e-56   
ref|XP_006388386.1|  hypothetical protein POPTR_0202s00230g             191   8e-56   
ref|XP_006425840.1|  hypothetical protein CICLE_v10025791mg             193   8e-56   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             193   8e-56   
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         193   9e-56   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  193   1e-55   
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  193   1e-55   
ref|XP_004291132.1|  PREDICTED: patatin-like protein 2                  193   1e-55   
ref|XP_002869007.1|  PLA IVA/PLP1                                       193   1e-55   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  193   1e-55   
gb|AAK18751.1|  patatin-like protein                                    193   1e-55   
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  192   2e-55   
gb|KJB58441.1|  hypothetical protein B456_009G210000                    193   2e-55   
ref|XP_006285080.1|  hypothetical protein CARUB_v10006413mg             193   2e-55   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  192   2e-55   
ref|XP_009139453.1|  PREDICTED: patatin-like protein 1 isoform X3       192   2e-55   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             192   2e-55   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       192   2e-55   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1       192   2e-55   
ref|XP_010089434.1|  Patatin group A-3                                  192   2e-55   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             192   2e-55   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             191   2e-55   
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       192   2e-55   
ref|XP_009392030.1|  PREDICTED: patatin-like protein 2                  192   3e-55   
emb|CAA05628.1|  patatin-like protein                                   192   3e-55   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    192   3e-55   
ref|NP_849511.1|  patatin-related phospholipase A                       192   3e-55   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  192   3e-55   
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                  192   4e-55   
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             192   4e-55   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  192   4e-55   
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    197   4e-55   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  191   4e-55   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  192   5e-55   
gb|EMT07292.1|  Patatin-11                                              188   6e-55   
ref|XP_006411934.1|  hypothetical protein EUTSA_v10025319mg             191   6e-55   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       191   6e-55   
gb|EMS66123.1|  Patatin group A-3                                       191   6e-55   
gb|KGN62071.1|  hypothetical protein Csa_2G295960                       187   6e-55   
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  191   7e-55   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  190   7e-55   
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                  191   7e-55   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            192   7e-55   
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  191   7e-55   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       191   8e-55   
ref|XP_010102583.1|  Patatin group A-3                                  190   8e-55   
ref|XP_010103703.1|  hypothetical protein L484_011760                   187   9e-55   
ref|XP_003611772.1|  Patatin-like protein                               190   1e-54   
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  191   1e-54   
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         191   1e-54   
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                  191   1e-54   
gb|EMT31709.1|  Patatin group A-3                                       189   1e-54   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       190   1e-54   
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          191   1e-54   
ref|XP_004289234.1|  PREDICTED: patatin-like protein 2                  190   1e-54   
gb|KGN62054.1|  hypothetical protein Csa_2G292840                       189   1e-54   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          191   1e-54   
ref|XP_010446707.1|  PREDICTED: patatin-like protein 3                  191   1e-54   
gb|EMT15946.1|  Patatin-3-Kuras 1                                       188   1e-54   
ref|XP_006495361.1|  PREDICTED: patatin group M-3-like                  188   2e-54   
ref|XP_002310157.1|  hypothetical protein POPTR_0007s11360g             189   2e-54   
emb|CDX75619.1|  BnaA01g00830D                                          190   2e-54   
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  189   2e-54   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             189   2e-54   
ref|XP_003611771.1|  Patatin-like protein                               189   2e-54   
ref|XP_002510259.1|  Patatin T5 precursor, putative                     189   2e-54   
ref|XP_011039207.1|  PREDICTED: patatin-like protein 2                  189   2e-54   
emb|CDM80597.1|  unnamed protein product                                190   3e-54   
ref|XP_004148073.1|  PREDICTED: patatin group A-3-like                  189   3e-54   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  189   3e-54   
gb|EMS54202.1|  Patatin group A-3                                       193   3e-54   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg                191   3e-54   
ref|XP_002523558.1|  Patatin precursor, putative                        189   3e-54   
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  189   4e-54   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  188   4e-54   
ref|XP_008360670.1|  PREDICTED: patatin-like protein 3                  186   4e-54   
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             188   4e-54   
ref|NP_001062043.1|  Os08g0477100                                       189   4e-54   
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  189   4e-54   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       189   4e-54   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  189   4e-54   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  189   4e-54   
ref|XP_004167585.1|  PREDICTED: patatin group A-3-like                  188   5e-54   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             189   5e-54   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  188   5e-54   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       189   5e-54   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       189   6e-54   
emb|CDP11080.1|  unnamed protein product                                187   6e-54   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  188   6e-54   
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                  188   6e-54   
ref|XP_010101004.1|  Patatin group A-3                                  188   6e-54   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  189   6e-54   
ref|XP_006434812.1|  hypothetical protein CICLE_v10001337mg             186   6e-54   
ref|XP_002445641.1|  hypothetical protein SORBIDRAFT_07g023230          188   7e-54   
gb|EMT06740.1|  Patatin group A-3                                       188   7e-54   
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    188   7e-54   
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  188   8e-54   
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  188   9e-54   
gb|EMS63453.1|  Patatin-3-Kuras 1                                       186   1e-53   
emb|CDM80622.1|  unnamed protein product                                184   1e-53   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         187   1e-53   
ref|XP_004148466.1|  PREDICTED: patatin group A-3-like                  187   1e-53   
ref|XP_010942711.1|  PREDICTED: patatin-like protein 2                  181   1e-53   
gb|EAZ07346.1|  hypothetical protein OsI_29595                          188   1e-53   
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    187   2e-53   
ref|XP_010432095.1|  PREDICTED: patatin-like protein 3                  188   2e-53   
gb|EMT32376.1|  Patatin group A-3                                       187   2e-53   
ref|XP_009627385.1|  PREDICTED: patatin-like protein 2                  183   2e-53   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  187   2e-53   
emb|CDP07842.1|  unnamed protein product                                187   2e-53   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             187   2e-53   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  187   2e-53   
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         187   2e-53   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  187   3e-53   
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             187   3e-53   
ref|XP_010094388.1|  Patatin group A-3                                  186   3e-53   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             187   3e-53   
emb|CDX72619.1|  BnaC07g46410D                                          186   3e-53   
emb|CDX75621.1|  BnaA01g00810D                                          186   4e-53   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                  186   4e-53   
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  186   4e-53   
ref|NP_001050287.1|  Os03g0393900                                       187   5e-53   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  186   5e-53   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             186   5e-53   
ref|XP_002510260.1|  Patatin T5 precursor, putative                     186   5e-53   
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         185   6e-53   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         186   6e-53   
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  186   7e-53   
emb|CDX69271.1|  BnaC01g01820D                                          186   7e-53   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1            186   7e-53   
ref|XP_002463192.1|  hypothetical protein SORBIDRAFT_02g039470          186   7e-53   
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                  186   8e-53   
ref|XP_008360668.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    182   8e-53   
tpg|DAA48470.1|  TPA: hypothetical protein ZEAMMB73_976536              186   9e-53   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  185   1e-52   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     185   1e-52   
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             185   1e-52   
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  186   1e-52   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             185   1e-52   
gb|KGN62063.1|  hypothetical protein Csa_2G294900                       182   2e-52   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         185   2e-52   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          186   2e-52   
emb|CDP01333.1|  unnamed protein product                                184   2e-52   
ref|XP_010101003.1|  Patatin group A-3                                  184   2e-52   
ref|XP_003577354.1|  PREDICTED: patatin-like protein 1                  184   2e-52   
ref|NP_001062042.1|  Os08g0476900                                       185   2e-52   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  184   2e-52   
dbj|BAJ98020.1|  predicted protein                                      185   3e-52   
ref|XP_004165470.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    184   3e-52   
gb|EMS59852.1|  Patatin-3-Kuras 1                                       182   3e-52   
ref|XP_006387005.1|  hypothetical protein POPTR_2250s00200g             177   3e-52   
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             184   3e-52   
emb|CBI21441.3|  unnamed protein product                                189   3e-52   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  184   3e-52   
ref|XP_004288050.1|  PREDICTED: patatin-like protein 1                  184   3e-52   
dbj|BAJ99822.1|  predicted protein                                      183   4e-52   
gb|ABK24853.1|  unknown                                                 183   4e-52   
gb|EMT18762.1|  Patatin group A-3                                       184   4e-52   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             184   4e-52   
emb|CDY42720.1|  BnaA03g53730D                                          184   4e-52   



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   DA+G   ++NL+DGGVAANNPTLVA+S VT++++  DP F       QP+  +R L
Sbjct  198  FTNPDASGKSWDFNLIDGGVAANNPTLVAISEVTKQVLRNDPDFF----PIQPMDYNRLL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KYTA+ AA WG+ GWL QG+  P++DVF+ AS DMVDY L  IF++L
Sbjct  254  VISLGTGSAKQERKYTAEMAAKWGLFGWLIQGNNTPILDVFNQASKDMVDYFLCVIFQSL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D+L G+ +SVDVTT +NL+ L +IG+NLLK  +S++++LT   EPI   
Sbjct  314  HSEDNYLRIQDDSLTGANASVDVTTKQNLSELAKIGENLLKGPISRVNLLTGNSEPIPNG  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN+DALK+FAKLLSDE+K R + S
Sbjct  374  GTNEDALKKFAKLLSDERKLRRSKS  398



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA++ VT+++  K+P F       +P+   RFL
Sbjct  198  FKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDKNPDFF----PIKPMDFGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  314  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  374  GTNEEALKRFAKLLSDEKRLR  394



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA+S VT+++  K+P F       +P+   RFL
Sbjct  203  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFF----PIKPMDFGRFL  258

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  259  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  318

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDV T ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  319  HSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  378

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  379  GTNEEALKRFAKLLSDEKRLR  399



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA+S VT+++  K+P F       +P+   RFL
Sbjct  192  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFF----PIKPMDFGRFL  247

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  248  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  307

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDV T ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  308  HSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  367

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  368  GTNEEALKRFAKLLSDEKRLR  388



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 145/206 (70%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET  ++G    ++LVDGGVAANNPTLVA+  VT+ +  K+P F       +P+   RFL
Sbjct  200  FETMGSDGMVKNFHLVDGGVAANNPTLVAVGEVTREIFRKNPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    Y+AK AA WGVLGWL    G PLID F+ ASSDMVD+HL+ +FRAL
Sbjct  256  VISLGTGSPKSTDNYSAKDAAKWGVLGWLYHNGGTPLIDTFTHASSDMVDFHLSVVFRAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ D L G ASSVD+ T ENL  L  IG +LLKK VS+L++ T  +EP+EG 
Sbjct  316  HSERNYLRIQGDTLTGHASSVDIATKENLENLVMIGSDLLKKPVSRLNMETGLFEPVEGE  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN+ AL RFAKLLSDE++ R+  S 
Sbjct  376  GTNEQALTRFAKLLSDERRLRMQRSP  401



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E NL+DGGVAANNP LVA+S VT+++  K+P FL      +P+   RFL
Sbjct  199  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFL----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF+ AS+DMVD+H++ +F+AL
Sbjct  255  VISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ +SVDVTT ENL  L +IG+ LLKK VS++++ T    P+E  
Sbjct  315  HSEDNYLRIQDDTLHGTDASVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENC  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  375  GTNEEALKRFAKLLSDEKRLR  395



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA+S VT+++  K+P F       +P+   RFL
Sbjct  229  FKNQDKEGKTQEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFF----PIKPMDFGRFL  284

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  285  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  344

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDV T ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  345  HSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  404

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  405  GTNEEALKRFAKLLSDEKRLR  425



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E NL+DGGVAANNP LVA+S VT+++  K+P FL      +P+   RFL
Sbjct  198  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFL----PIKPMDYGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF+ AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ ++VDVTT ENL  L +IG+ LLKK VS++++ T    P+E  
Sbjct  314  HSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENC  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  374  GTNEEALKRFAKLLSDEKRLR  394



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F       +P+   RFL
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF----PIKPMDFGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  314  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++ALKRFA LLSDEK+ R A S 
Sbjct  374  GTNEEALKRFATLLSDEKRLRDARSP  399



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F       +P+   RFL
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF----PIKPMDFGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  314  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++ALKRFA LLSDEK+ R A S 
Sbjct  374  GTNEEALKRFATLLSDEKRLRDARSP  399



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E NL+DGGVAANNP LVA+S VT+++  K+P FL      +P+   RFL
Sbjct  199  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFL----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF+ AS+DMVD+H++ +F+AL
Sbjct  255  VISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ ++VDVTT ENL  L +IG+ LLKK VS++++ T    P+E  
Sbjct  315  HSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKIGERLLKKPVSRVNLETGLSVPVENC  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  375  GTNEEALKRFAKLLSDEKRLR  395



>emb|CAN81920.1| hypothetical protein VITISV_021802 [Vitis vinifera]
Length=407

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F       +P+   RFL
Sbjct  199  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF----PIKPMDFGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  255  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  315  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++ALKRFA LLSDEK+ R A S 
Sbjct  375  GTNEEALKRFATLLSDEKRLRDARSP  400



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 147/204 (72%), Gaps = 10/204 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCH---  171
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F        PI      
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF-------PIKYMDFG  250

Query  172  RFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIF  351
            RFL++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F
Sbjct  251  RFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVF  310

Query  352  RALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI  531
            +AL++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+
Sbjct  311  QALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPV  370

Query  532  EGAGTNQDALKRFAKLLSDEKKRR  603
            E  GTN++ALKRFAKLLSDEK+ R
Sbjct  371  ENGGTNEEALKRFAKLLSDEKRLR  394



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 147/204 (72%), Gaps = 10/204 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCH---  171
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F        PI      
Sbjct  238  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF-------PIKYMDFG  290

Query  172  RFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIF  351
            RFL++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F
Sbjct  291  RFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVF  350

Query  352  RALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI  531
            +AL++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+
Sbjct  351  QALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPV  410

Query  532  EGAGTNQDALKRFAKLLSDEKKRR  603
            E  GTN++ALKRFAKLLSDEK+ R
Sbjct  411  ENGGTNEEALKRFAKLLSDEKRLR  434



>ref|XP_004979715.1| PREDICTED: patatin-2-Kuras 1-like [Setaria italica]
Length=410

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T+D  G   EY+LV+GGVAANNPT+ A+S +T+ ++  +P F    +  +P     +L
Sbjct  207  FTTSDGKGGSREYHLVNGGVAANNPTMAAMSMLTKEVLRHNPDF----NPGKPSDYRHYL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTG+AK   KYTA Q A WG+L WL  G   P+ID+FS ASSDMVD H A +F AL
Sbjct  263  IISIGTGSAKQEEKYTAPQCAKWGLLQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFEAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D+L G  SSVD+TT EN+ AL +IG  LLKK VS+++I T  YEP+ G 
Sbjct  323  HCEKNYLRIQDDSLTGDTSSVDITTKENMEALIRIGHELLKKPVSRVNIDTGMYEPVNGE  382

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAK+LSDE++ R
Sbjct  383  GTNEEALARFAKILSDERRLR  403



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NLVDGGVAANNP LVA S VTQ+++T +P F       +PI   RFL
Sbjct  204  FQTQDKDGNFHEFNLVDGGVAANNPALVATSQVTQQIMTGNPDFF----PIKPIDYGRFL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+LGWL  G   P++DVF+ AS DMVD H++ +F+AL
Sbjct  260  VISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVD+ T EN+N L +IGK LLKK VS++++ T   E  +  
Sbjct  320  HSEENYLRIQDDTLTGTNSSVDIATKENMNKLVEIGKTLLKKPVSRVNLQTGLSEQCKNG  379

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ LKRF KLLS+EK+ R
Sbjct  380  GTNEETLKRFVKLLSEEKRLR  400



>gb|KCW66175.1| hypothetical protein EUGRSUZ_F00011 [Eucalyptus grandis]
Length=334

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 148/205 (72%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++     F     + +P+   RFL
Sbjct  126  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF----AIKPMDYRRFL  181

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT+K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+HL+ +F+AL
Sbjct  182  VISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQAL  240

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ +   +P    
Sbjct  241  NLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQ  300

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS E++ R+A S
Sbjct  301  ETNEEALKRFAKLLSQERQLRLARS  325



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGV ANNPTLVA++ VT +++ ++  F     + +P+   RFL
Sbjct  200  FKNQDTEGNTHEFNLIDGGVCANNPTLVAMNEVTNQIINQNNDFY----AIKPMEYSRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ AK AA WG+L WL+ G   PLID+FS +S+DMVD+HLA + RAL
Sbjct  256  IISLGTGTPKNEQKFNAKMAAKWGLLDWLTHGGSTPLIDMFSQSSADMVDFHLAAVTRAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+  NYLRIQ+D L G+ SSVD++TTENL  L QIG  LLKK VSK+++    +EP+E  
Sbjct  316  NSQHNYLRIQDDTLTGTDSSVDISTTENLEKLCQIGDKLLKKPVSKVNLENGMFEPMEKG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DALKRFAK+LS E++ R
Sbjct  376  ETNEDALKRFAKILSQERRLR  396



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA++ VT+++  K+P F       +P+   RFL
Sbjct  198  FKNQDKEGKTQEFNLIDGGVAANNPALVAITQVTKQVFDKNPDFF----PIKPMDFGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  314  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  374  GTNEEALKRFAKLLSDEKRLR  394



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+ G   E+NL+DGGV ANNPTLVA++ VT++++ ++P F       +P+   RFL
Sbjct  201  FNNQDSKGNVHEFNLIDGGVCANNPTLVAMNEVTKQIIMQNPDFF----PIKPMEYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTGTAK   K+ A+ AA WG+L WL+Q   NPLIDVFS +SSDMVD+HL+ + +AL
Sbjct  257  IISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSNPLIDVFSQSSSDMVDFHLSAVTQAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD+ T ENL  L  +G+ LLKK VS++++    +EP++  
Sbjct  317  HSEDNYLRIQDDTLTGTDSSVDIATKENLEKLCHVGEKLLKKPVSRINLENGLFEPLKNR  376

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DALKRFAK+LS E++ R
Sbjct  377  ETNEDALKRFAKILSQERRLR  397



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 149/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V+Q +  + P    D+    P+   RFL
Sbjct  200  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINREGP----DSYHMNPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WGVLGWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  256  VLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++++ T  +EPI   
Sbjct  316  NSEENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPINKM  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  376  -TNEEALRKLAKLLSREKHLREAKSA  400



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 149/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V+Q +  + P    D+    P+   RFL
Sbjct  201  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSQAINREGP----DSYHMNPMEYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WGVLGWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  257  VLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++++ T  +EPI   
Sbjct  317  NSEENYLRIQDDTLTGTLSSVDVATNENLENLGKVGEELLKKPVSRVNLATGIFEPINKM  376

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  377  -TNEEALRKLAKLLSREKHLREAKSA  401



>emb|CDP01337.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D++G+  E+NL+DGGVAANNP LVA++ VT+ +   +P F    S +      RFL
Sbjct  198  FETEDSDGSVKEFNLIDGGVAANNPALVAMNHVTKEVSQGNPDFFSIRSQE----YSRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A+QAA WG+LGWL+ G   PL+DVFS ASSDMVD+HL+T+F+ L
Sbjct  254  VLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDVFSQASSDMVDFHLSTVFQTL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + +NYLRIQ+D L G  +SVDV T ENL  L ++G+NLLKK VS++++ T  +EP+   
Sbjct  314  QSEENYLRIQDDTLTGDLASVDVATEENLQNLVKVGENLLKKPVSRINLETGVFEPL-NK  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKR A+ LS EK+ R
Sbjct  373  GTNEEALKRLAETLSKEKRLR  393



>ref|XP_010059971.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
 gb|KCW66465.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=334

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 147/205 (72%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++     F     + +P+   RFL
Sbjct  126  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF----AIKPMDYRRFL  181

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT+K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+HL+ +F+AL
Sbjct  182  VISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQAL  240

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ +   +P    
Sbjct  241  NLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQ  300

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS E+  R+A S
Sbjct  301  ETNEEALKRFAKLLSQERLLRLAKS  325



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 144/205 (70%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DGGVAANNPTLVA+  VT+ +    P F       +P+   RFL
Sbjct  197  FQTQDPDGKVREFNLIDGGVAANNPTLVAMREVTKEITKGSPDFF----PIKPMDYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG  K   KY+A QAA WGV+GWL +G   PL+DVF+ AS DMVD H++ +F+AL
Sbjct  253  VISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVFTHASGDMVDLHISVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + DNYLRIQ+D L  + SSVDV T ENL+ L ++G+ LLK  VS++++ T  YEP +  
Sbjct  313  RSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKVGEALLKNPVSRVNLDTGIYEPSKTK  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN++ L+RFAKLLSDEK+ R A S
Sbjct  373  GTNEEELRRFAKLLSDEKRLRDATS  397



>ref|XP_003589237.1| Patatin-like protein [Medicago truncatula]
 gb|AES59488.1| patatin-like phospholipase [Medicago truncatula]
Length=298

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  13   DANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSI  192
            D  G + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFLI+SI
Sbjct  88   DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFLIISI  143

Query  193  GTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGD  372
            GTGTAK   K+TA+ AA WG+L WL+Q   NPLIDVF+ +S DMVD+HL+ + +AL++ D
Sbjct  144  GTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSAD  203

Query  373  NYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQ  552
            NYLRIQ+D L G  SSVD+ T ENL  L QIG+NLLKK VS++++    +EP+    TN+
Sbjct  204  NYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETNE  263

Query  553  DALKRFAKLLSDEKKRR  603
            +ALKR AK+LS E++ R
Sbjct  264  EALKRLAKILSQERRLR  280



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 145/206 (70%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPTLVA+  VT+ +V     F       +P+   RFL
Sbjct  198  FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVL WL+ G G+PLIDVFS AS+DMVDYHL+ +F+AL
Sbjct  254  MISLGTGTTKAEGKYTAPEAAKWGVLRWLTSG-GSPLIDVFSHASADMVDYHLSAVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQ+D L G  SSVDV T +NLN L +IG+ LLKK VS++++ T   EP    
Sbjct  313  QLHDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQ  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL+RFAKLLS E++ R A S 
Sbjct  373  ETNEEALRRFAKLLSQERQLRHARSP  398



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 145/206 (70%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPTLVA+  VT+ +V     F       +P+   RFL
Sbjct  195  FETEDSTGKVREFNLIDGGVAANNPTLVAMGEVTKAIVGGSSDFF----PIKPMDYRRFL  250

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVL WL+ G G+PLIDVFS AS+DMVDYHL+ +F+AL
Sbjct  251  MISLGTGTTKAEGKYTAPEAAKWGVLRWLTSG-GSPLIDVFSHASADMVDYHLSAVFQAL  309

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQ+D L G  SSVDV T +NLN L +IG+ LLKK VS++++ T   EP    
Sbjct  310  QLHDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQ  369

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL+RFAKLLS E++ R A S 
Sbjct  370  ETNEEALRRFAKLLSQERQLRHARSP  395



>gb|KCW66180.1| hypothetical protein EUGRSUZ_F00017 [Eucalyptus grandis]
Length=334

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D      E+NL+DGGVAANNPTLVA+  VT+ ++  +  F       +P+   RFL
Sbjct  126  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF----PIKPMDYRRFL  181

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+H++ +F+AL
Sbjct  182  VISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQAL  240

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ T   EP    
Sbjct  241  HLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPNQ  300

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS E++ R+A S
Sbjct  301  ETNEEALRRFAKLLSQERQLRLARS  325



>ref|XP_010064190.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=328

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D      E+NL+DGGVAANNPTLVA+  VT+ ++  +  F       +P+   RFL
Sbjct  120  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF----PIKPMDYRRFL  175

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+H++ +F+AL
Sbjct  176  VISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQAL  234

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ T   EP    
Sbjct  235  HLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPNQ  294

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS E++ R+A S
Sbjct  295  ETNEEALRRFAKLLSQERQLRLARS  319



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 149/205 (73%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP LVA++ VT+++  ++P F       +P+   RFL
Sbjct  198  FKNQDKEGKTQEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFF----PIKPMDFGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WGVLGWL  G   PL+DVF  AS+DMVD+H++ +F+AL
Sbjct  254  VISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D LRG  +SVDVTT ENL+ L +IG+ LLKK VS++++ T   EP+E  
Sbjct  314  HSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENG  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN++ALKRFA LLSDEK+ R A S
Sbjct  374  GTNEEALKRFATLLSDEKRLRDARS  398



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 148/205 (72%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++     F     + +P+   RFL
Sbjct  220  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF----AIKPMDYRRFL  275

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT+K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+HL+ +F+AL
Sbjct  276  VISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQAL  334

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ +   +P    
Sbjct  335  NLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQ  394

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS E++ R+A S
Sbjct  395  ETNEEALKRFAKLLSQERQLRLARS  419



>ref|XP_009629882.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=232

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NLVDGGVAANNP LVA S VT +++T +P F       +PI   RFL
Sbjct  24   FQTQDKDGNFHEFNLVDGGVAANNPALVATSEVTHQIMTGNPDFF----PIKPINYERFL  79

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+LGWL  G   P++DVF+ AS D+VD H++ +F+AL
Sbjct  80   VISIGTGSAKVEQKYNAKIASNWGILGWLLNGGSTPIVDVFTQASGDLVDLHISVVFQAL  139

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + +NYLRIQ D L G+ SSVD+ T EN++ L +IGK LLKK VS++++ T   E  E  
Sbjct  140  QSEENYLRIQNDTLIGTDSSVDIATKENMDKLVKIGKTLLKKPVSRVNLQTGLSEQCENG  199

Query  541  GTNQDALKRFAKLLSDEKK  597
            GTN++ LKRFAK+L +EK+
Sbjct  200  GTNEETLKRFAKVLLEEKR  218



>ref|XP_002449853.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
 gb|EES08841.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
Length=413

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 141/192 (73%), Gaps = 4/192 (2%)
 Frame = +1

Query  34   EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKY  213
            EY+LVDGGVAANNPT++A+S +T+ ++ ++P F    +  +P     +L++S+GTG+AK 
Sbjct  221  EYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDF----NPGKPTEYRNYLVISVGTGSAKL  276

Query  214  GSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQE  393
              KYTA Q A WG++ WL +G   P+ID+FS AS+DMVD H A +F AL+   NYLRIQ+
Sbjct  277  AEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFEALHCEKNYLRIQD  336

Query  394  DNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFA  573
            D+L G ASSVD+ T EN+ AL  IGK LLKK V++++I T  YEP+ G GTN+DAL RFA
Sbjct  337  DSLTGHASSVDIATKENMEALIGIGKKLLKKPVARVNIDTGMYEPVAGEGTNEDALARFA  396

Query  574  KLLSDEKKRRIA  609
            K+LSDE++ R A
Sbjct  397  KMLSDERRLRQA  408



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++     F     + +P+   RFL
Sbjct  198  FETKDFTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF----AIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT+K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGTSKVEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHLSAVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ +   +P    
Sbjct  313  NLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQ  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++ALKRFAKLLS E+  R+A S 
Sbjct  373  ETNEEALKRFAKLLSQERLLRLAKSP  398



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D NG K  +NLVDGGVAANNPTL A++ V++ ++  +P F     S QP+   RFL
Sbjct  207  FETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFF----SYQPVEYDRFL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG  K   K+TA+++A WGVLGWL      PLID+F+ AS+DMVD H + +F+AL
Sbjct  263  VISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVLFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N G NYLRI++D L G  SSVDV+T +NL  L  IG +LLKK VS+++I T   E ++G 
Sbjct  323  NKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEAVDGE  382

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+ AL  FAK LSDEK+RR
Sbjct  383  GTNEAALTGFAKKLSDEKRRR  403



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D NG K  +NLVDGGVAANNPTL A++ V++ ++  +P F     S QP+   RFL
Sbjct  211  FETKDDNGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFF----SYQPVEYDRFL  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG  K   K+TA+++A WGVLGWL      PLID+F+ AS+DMVD H + +F+AL
Sbjct  267  VISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHASVLFQAL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N G NYLRI++D L G  SSVDV+T +NL  L  IG +LLKK VS+++I T   E ++G 
Sbjct  327  NKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDIGNSLLKKPVSRVNIETGHSEAVDGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+ AL  FAK LSDEK+RR
Sbjct  387  GTNEAALTGFAKKLSDEKRRR  407



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGV ANNP LVA++ VT +++ ++  F     + +P+   RFL
Sbjct  200  FKNQDTEGNVREFNLIDGGVCANNPALVAVNEVTTQIINENNDFY----AIKPMEYSRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ +K AA WG+L WL+ G   PLID+FS +S DMVD+HLAT+ +AL
Sbjct  256  IISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDIFSQSSGDMVDFHLATVTQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+D L G+ SSVD++T ENL  L QIG  LLKK VSK+++    +EPIE  
Sbjct  316  NCQDNYLRIQDDTLTGTDSSVDISTKENLEKLCQIGDRLLKKPVSKVNLENGMFEPIENG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TNQ+ALKRFAK+LS E+K R
Sbjct  376  ETNQEALKRFAKILSQERKLR  396



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET +++G+K E+NLVDGGVAANNPTLVA++ VT+ +   +  F    S  +P+   RFL
Sbjct  198  FETKNSDGSKREFNLVDGGVAANNPTLVAMNQVTREISKGNSDF----SPMKPLEFDRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A  AA WG+L WL  G  +PL+DVF++ASSDMVD+HLATIF+ L
Sbjct  254  VLSLGTGTAKIEQKYDADNAAKWGILAWLVNGGSSPLVDVFTEASSDMVDFHLATIFQTL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D L G  SSVD+ T  NL  L Q+G+ LLKK VS++++ +  +EP+   
Sbjct  314  QCEANYLRIQDDTLTGDLSSVDIATKTNLENLVQVGEKLLKKPVSRVNLQSGVFEPL-NQ  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+DALK+FA+ LS EK+ R
Sbjct  373  GTNEDALKKFAETLSKEKRLR  393



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T D  G   EY+LVDGGVAANNPT++A+S +T+ ++ ++P F    +  +P     +L
Sbjct  205  FTTDDGKGGSREYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDF----NPGKPTEYRNYL  260

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG++ WL +G   P+ID+FS AS+DMVD H A +F +L
Sbjct  261  IISVGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFESL  320

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D+L G ASSVD+ T EN+ AL  IGK LL+K V++++I T  YE + G 
Sbjct  321  HCQKNYLRIQDDSLTGDASSVDIATKENMEALIGIGKELLRKPVARVNIDTGMYEAVAGE  380

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+DAL RFA++LS+E+K R
Sbjct  381  GTNEDALARFARMLSEERKLR  401



>emb|CDP11077.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D++G+  E+NL+DGGVAANNP LVA++ VT+ +   +  F    S +      RF+
Sbjct  185  FETEDSDGSVKEFNLIDGGVAANNPALVAMNHVTKEVSQGNSDFFSIRSQE----YSRFI  240

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A+QAA WG+LGWL+ G   PL+DVFS ASSDMVD+HL+TIF+ L
Sbjct  241  VLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDVFSQASSDMVDFHLSTIFQTL  300

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + +NYLRIQ+D L G  +SVDV T ENL  L ++G+NLLKK VS++++ T  +EP+   
Sbjct  301  QSEENYLRIQDDTLTGDLASVDVATEENLQNLVKVGENLLKKPVSRINLQTGVFEPL-NK  359

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKR A+ LS EK+ R
Sbjct  360  GTNEEALKRLAETLSKEKRLR  380



>gb|KJB29508.1| hypothetical protein B456_005G104200 [Gossypium raimondii]
Length=401

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 144/205 (70%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   ++NL+DGGVAANNP L+A+  VT+++      F    ++      +RFL
Sbjct  198  FETEDTDGKVKKFNLIDGGVAANNPALIAMGEVTKQIHKGHSDFSCIKAANH---YNRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+ K   KYTAKQAA WGVLGWL+ G+  PLI+ FS+ S+DMVD+H++ IF++L
Sbjct  255  VLSVGTGSEKLAEKYTAKQAAQWGVLGWLTSGNSTPLINAFSEGSADMVDFHISVIFKSL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+  NYLRIQ+D L+G  SSVDV+T EN+  L ++ +NLL K VS+++  T  YEP    
Sbjct  315  NSEQNYLRIQDDKLKGEVSSVDVSTEENMKILAKVAENLLNKPVSRVNFETGNYEPSGDL  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN  AL R+AKLLS+EK+RR+  S
Sbjct  375  ETNAQALIRYAKLLSEEKRRRLKTS  399



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   ++NL+DGGVAANNPTLVA+S V++ +  + P    D+    P+   RFL
Sbjct  200  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP----DSYRMNPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WG+LGWL+     PL+DVF+ AS+DMVD+H++T+F+AL
Sbjct  256  VLSLGTGTAKSEEKYDAEEAAKWGLLGWLTSDHSTPLVDVFTQASADMVDFHISTVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++++ T  +EPI   
Sbjct  316  NSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINKM  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  376  -TNEEALRKLAKLLSREKHLRQAKSA  400



>ref|XP_010269013.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=404

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNP LVA+  V++ ++ K+P    D+ S +P+   RFL
Sbjct  197  FETKDEEGKVREFNLIDGGVAANNPALVAIGEVSKDII-KNP----DSFSIKPMEFGRFL  251

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY AKQA+ WGVLGWL     +PL+DVF+ AS DMVDYH++ +F+AL
Sbjct  252  VLSLGTGAPKSEHKYGAKQASKWGVLGWLHSDGSSPLVDVFTQASGDMVDYHVSAVFQAL  311

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD  + ENL+ L ++G+ LLKK VS++++ T  YEP +  
Sbjct  312  SSKDNYLRIQDDTLGGTVSSVDFASKENLDNLVKVGEALLKKPVSRVNLDTGIYEPCKEQ  371

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS+EKK R + S
Sbjct  372  ITNEEALRRFAKLLSEEKKLRDSKS  396



>ref|XP_006388384.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
 gb|ERP47298.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
Length=332

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  + P    D+    P+   RFL
Sbjct  122  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINRESP----DSFRMNPMEYGRFL  177

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+ GWL+    +PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  178  VLSLGTGTAKSEGKYDADEAAKWGIFGWLTGDHSSPLVDVFTQASGDMVDFHISTVFQAL  237

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LL+K VS++++ T  +EPI   
Sbjct  238  NSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLQKPVSRVNLATGVFEPINKM  297

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL +FAKLLS EK+ R
Sbjct  298  -TNEEALTKFAKLLSREKQLR  317



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D      E+NL+DGGVAANNPTLVA+  VT+ ++  +  F       +P+   RFL
Sbjct  212  FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF----PIKPMDYRRFL  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+H++ +F+AL
Sbjct  268  VISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQAL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ T   EP    
Sbjct  327  HLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPNQ  386

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS E++ R+A S
Sbjct  387  ETNEEALRRFAKLLSQERQLRLARS  411



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  + P    D+    P+   RFL
Sbjct  200  FETKDPSGKVREFNLIDGGVAANNPTLVAISEVSKAINREGP----DSYHMNPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WGVLGWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  256  VLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  SSVDV T ENL  L ++G  LLKK VS++++ T  +EPI   
Sbjct  316  SSEENYLRIQDDTLTGKLSSVDVATKENLENLVKVGVELLKKPVSRVNLATGVFEPINKM  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  376  -TNEEALRKLAKLLSREKHLREAKSA  400



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  13   DANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSI  192
            D  G + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFLI+SI
Sbjct  207  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFLIISI  262

Query  193  GTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGD  372
            GTGTAK   K+TA+ AA WG+L WL+Q   NPLIDVF+ +S DMVD+HL+ + +AL++ D
Sbjct  263  GTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSAD  322

Query  373  NYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQ  552
            NYLRIQ+D L G  SSVD+ T ENL  L QIG+NLLKK VS++++    +EP+    TN+
Sbjct  323  NYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETNE  382

Query  553  DALKRFAKLLSDEKKRR  603
            +ALKR AK+LS E++ R
Sbjct  383  EALKRLAKILSQERRLR  399



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 149/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   ++NL+DGGVAANNPTLVA+S V++ +  + P    D+    P+   RFL
Sbjct  201  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP----DSYHMNPMEYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WGVLGWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  257  VLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++++ T  +EPI   
Sbjct  317  SSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINKM  376

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  377  -TNEEALRKLAKLLSREKHLREAKSA  401



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 148/206 (72%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +    E+NLVDGGVAANNP LVA S VT++++  +P F       +PI   RFL
Sbjct  204  FKTQDRDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDFF----PIKPIDYGRFL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY AK A+ WG+LGWL  G   P++DVF+ AS DMVD+H++ +F+AL
Sbjct  260  VISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDFHISVVFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLR+Q+D L G+ SSVD++T EN+N L +IG NLLKK VS++++ T  +E  +  
Sbjct  320  HSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEECKKD  379

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++ LKRFAKLLS+EK+ R + S 
Sbjct  380  DTNEETLKRFAKLLSEEKRLRDSKSP  405



>ref|XP_006374978.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
 gb|ERP52775.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
Length=417

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PTAPMDYGRFL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WGVLGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  263  VLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  323  HSEENYLRIQDDTLSGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDKM  382

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  383  -TNEEALIKMAKLLSREKHLR  402



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  13   DANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSI  192
            D  G + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFLI+SI
Sbjct  205  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFLIISI  260

Query  193  GTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGD  372
            GTGTAK   K+TA+ AA WG+L WL+Q   NPLIDVF+ +S DMVD+HL+ + +AL++ D
Sbjct  261  GTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSAD  320

Query  373  NYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQ  552
            NYLRIQ+D L G  SSVD+ T ENL  L QIG+NLLKK VS++++    +EP+    TN+
Sbjct  321  NYLRIQDDTLTGIDSSVDIATEENLKKLCQIGENLLKKPVSRVNLENGHFEPLTNGETNE  380

Query  553  DALKRFAKLLSDEKKRR  603
            +ALKR AK+LS E++ R
Sbjct  381  EALKRLAKILSQERRLR  397



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 149/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   ++NL+DGGVAANNPTLVA+S V++ +  + P    D+    P+   RFL
Sbjct  200  FETKDPSGKVRDFNLIDGGVAANNPTLVAISEVSKAINREGP----DSYHMNPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A++AA WGVLGWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  256  VLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++++ T  +EPI   
Sbjct  316  SSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEELLKKPVSRVNLATGVFEPINKM  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL++ AKLLS EK  R A SA
Sbjct  376  -TNEEALRKLAKLLSREKHLREAKSA  400



>gb|EMT13605.1| Patatin group A-3 [Aegilops tauschii]
Length=397

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (70%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    FETTDANG--AKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHR  174
            F T D  G     EY+LVDGGVAANNPT+VA+S +TQ ++ ++P F    +  +P     
Sbjct  193  FTTHDPLGKLPDREYHLVDGGVAANNPTMVAMSMITQEVMRRNPDF----THGKPAEYSN  248

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            +LI+SIGTGTAK   KYTA   A WGVL WL  G   PL+D+FS AS+DMVD H A +F+
Sbjct  249  YLIISIGTGTAKQAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHAAVLFQ  308

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            +L    NYLRIQ+D+L G  SSVD++T EN+ AL +IG  LLK +V++++I T  YEP++
Sbjct  309  SLRVEKNYLRIQDDSLTGHTSSVDISTKENMQALIEIGNKLLKMSVARVNIDTGMYEPVD  368

Query  535  GAGTNQDALKRFAKLLSDEKKRR  603
            G GTN++AL RFAK LSDE+K R
Sbjct  369  GEGTNEEALARFAKKLSDERKLR  391



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+NG   E+NL+DGGV ANNPTLVA++ VT++++ ++          +P+   RFL
Sbjct  202  FNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNSDLF----PIKPLEYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTGTAK   K+ A+ AA WG+L WL+Q    PLIDVF+ +S+DMVD+HL+ + +AL
Sbjct  258  IISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSSADMVDFHLSAVTQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD+ T ENL  L QIG+ LLKK VS++++    +EP++  
Sbjct  318  HSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKNR  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DALKRFAK+LS E++ R
Sbjct  378  ETNEDALKRFAKILSQERRLR  398



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 147/206 (71%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T D +G   E+NLVDGGVAANNP LVA S VT++++T +P F       +PI   RFL
Sbjct  202  FRTQDKDGNFHEFNLVDGGVAANNPALVATSQVTRQIMTGNPDFF----PIKPIDYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+LGWL  G   P++DVF+ AS DMVD H++ +F+AL
Sbjct  258  VISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVD++T EN++ L +IGK LLKK VS++++ T   E  +  
Sbjct  318  HSEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKND  377

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++ LKRFA LLS+EK+ R + S 
Sbjct  378  GTNEETLKRFAMLLSEEKRLRDSKSP  403



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+NG   E+NL+DGGV ANNPTLVA++ VT++++ ++          +P+   RFL
Sbjct  202  FNNQDSNGKVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNSDLF----PIKPLEYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTGTAK   K+ A+ AA WG+L WL+Q    PLIDVF+ +S+DMVD+HL+ + +AL
Sbjct  258  IISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTPLIDVFTQSSADMVDFHLSAVTQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD+ T ENL  L QIG+ LLKK VS++++    +EP++  
Sbjct  318  HSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKNR  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DALKRFAK+LS E++ R
Sbjct  378  ETNEDALKRFAKILSQERRLR  398



>ref|XP_006374977.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52774.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PAAPMDYGRFL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WGVLGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  263  VLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  +NY+RIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  323  HCEENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDKM  382

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL + AKLLS EK  R + S
Sbjct  383  -TNEEALIKMAKLLSREKHLRYSRS  406



>ref|XP_011030324.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=417

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  209  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PTAPMDYGRFL  264

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+LGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  265  VLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQAL  324

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  325  HSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDKM  384

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  385  -TNEEALIKMAKLLSREKHLR  404



>ref|XP_006374976.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52773.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PAAPMDYGRFL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WGVLGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  263  VLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  +NY+RIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  323  HCEENYIRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDKM  382

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL + AKLLS EK  R + S
Sbjct  383  -TNEEALIKMAKLLSREKHLRYSRS  406



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 145/203 (71%), Gaps = 8/203 (4%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLL--DNSSKQPIGCHR  174
            FET D+NG    YNL+DGGVAANNPTLVA+S + + M      FL+  D  S +PI  H 
Sbjct  210  FETQDSNGNTRSYNLIDGGVAANNPTLVAMSQIKKEM------FLMNQDFHSYKPIDYHN  263

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            F+I+SIGTG AK   K++A  A+ WG+L WL  G   PLID FS AS+D+VD H++++F+
Sbjct  264  FIIISIGTGAAKVEKKFSAHLASKWGILQWLYHGGSTPLIDSFSHASADIVDVHMSSVFQ  323

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            +L+   NYLRIQ++ L G ASSVDV+T ENL  L +IG++LLKK VS++++ T  +E ++
Sbjct  324  SLHCEQNYLRIQDETLMGQASSVDVSTKENLLELVKIGESLLKKPVSRVNLETGDFEEVK  383

Query  535  GAGTNQDALKRFAKLLSDEKKRR  603
            G GTN +AL R AK+LS+E+ RR
Sbjct  384  GEGTNAEALTRLAKILSEERHRR  406



>ref|XP_011030334.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=415

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  207  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PTAPMDYGRFL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+LGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  263  VLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHISTVFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  323  HSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGVFTPVDKM  382

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  383  -TNEEALIKMAKLLSREKHLR  402



>gb|EMT08201.1| Patatin-T5 [Aegilops tauschii]
Length=292

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    FETTDANG--AKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHR  174
            F T D  G     EY+L+DGGVAANNPT+ A+S +T+ ++ ++P F    +  +P     
Sbjct  87   FTTRDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPAEYGN  142

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            +LI+SIGTG+AK   KYTA   A WGVL WL  G   PLID+FS AS+DMVD H A +F+
Sbjct  143  YLIISIGTGSAKMAEKYTAPDCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAVLFQ  202

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            AL    NYLRIQ+D+L G  SSVD+ T EN+ AL  IGKNLLKK VS+++I T  YE +E
Sbjct  203  ALRIEKNYLRIQDDSLTGHTSSVDIATKENMEALIGIGKNLLKKNVSRVNIDTGMYESVE  262

Query  535  GAGTNQDALKRFAKLLSDEKKRR  603
            G GTN++AL RFA+ LS+E+K R
Sbjct  263  GEGTNEEALTRFARKLSEERKLR  285



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 147/206 (71%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  DA G   E+NL+DGG+AANNPTLVA+S V ++M  K+P F       +P+   R+L
Sbjct  199  FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVAKQMSKKNPDFF----PIKPMNYERYL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG  K G+ Y+AK A+ WGV+GWL      PLI  +++ASSDMVDYH + +F+A 
Sbjct  255  VISIGTGANKNGTTYSAKAASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAF  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ + YLRI ED L+G  SSVD+ TTENL  L ++G++LLK  VS++++ T  YEP+E  
Sbjct  315  HSENYYLRIDEDKLQGDLSSVDIATTENLENLVKVGEDLLKSPVSRINLDTGAYEPLEDG  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GT ++AL+RFAKLLS+E+K R + SA
Sbjct  375  GTYEEALQRFAKLLSEERKLRQSNSA  400



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 141/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  13   DANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSI  192
            D  G + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFLI+SI
Sbjct  207  DEAGKEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFLIISI  262

Query  193  GTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGD  372
            GTG AK   K+TA+ AA WG+L WL+Q   NPLIDVF+ +S DMVD+HL+ + +AL++ D
Sbjct  263  GTGAAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQSSGDMVDFHLSAVTQALHSAD  322

Query  373  NYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQ  552
            NYLRIQ+D L G  SSVD+ T ENL  L QIG+NLLKK VS++++    +EP+    TN+
Sbjct  323  NYLRIQDDTLTGIDSSVDIATEENLKKLYQIGENLLKKPVSRVNLENGHFEPLTNGETNE  382

Query  553  DALKRFAKLLSDEKKRR  603
            +ALKR AK+LS E++ R
Sbjct  383  EALKRLAKILSQERRLR  399



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 148/201 (74%), Gaps = 1/201 (0%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T + +G   E+NL+DG +AANNPT +A+S VT+++  ++P F  +     P    +FL
Sbjct  199  FQTQNEDGKFHEFNLIDGAIAANNPTFIAISEVTKQICEQNPYFK-NFDEMTPTNYGKFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+ GWL+ G  NP+ID F+DAS DMVDYH++ +F+++
Sbjct  258  VISIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVDYHISVVFQSI  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++   YLRIQ+D L G+ SSVD++T EN++ L +IG NLLKK VS++++ T  +E ++  
Sbjct  318  SSQKQYLRIQDDTLSGADSSVDISTKENMDKLVEIGTNLLKKPVSRVNLKTGLFEQLDTG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLS+EK+ R
Sbjct  378  GTNEEALKRFAKLLSEEKRIR  398



>ref|XP_006374974.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
 gb|ERP52771.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
Length=392

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  182  FETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFF----PTAPMDYGRFL  237

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WGVLGWL+  +  PL+DVF++AS DM+D H++T+F+AL
Sbjct  238  VLSLGTGTAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQAL  297

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  298  HCEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVDKM  357

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  358  -TNEEALIKMAKLLSREKHLR  377



>ref|XP_004233432.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=420

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G    ++LVDGGVAANNPTLVA++  ++ M+       L N+  +P+ C + L
Sbjct  211  FETRDSQGKTRTFDLVDGGVAANNPTLVAITQTSKEMMLGK----LQNAGLKPMDCKKML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG AK   KY+A  A+ WGVLGWL     +PL+DV+ DASSD+VD HL+TIF++L
Sbjct  267  VLSLGTGIAKDEKKYSAAAASTWGVLGWLYNNGASPLLDVYGDASSDIVDVHLSTIFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D+L G A+S+DV T +N+ AL QIG + LKK VS++++ T +YE + G 
Sbjct  327  DSQNNYLRIQDDSLSGEAASMDVATKKNMEALVQIGNDRLKKGVSRVNLDTGRYEEVSGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAKLLS+++K R
Sbjct  387  GTNEEALIRFAKLLSEQRKIR  407



>gb|EMT30617.1| Patatin group A-3 [Aegilops tauschii]
Length=408

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 143/207 (69%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANG--AKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHR  174
            F T D  G     EY+L+DGGVAANNPT+ A+S +T+ ++ ++P F    +  +P   HR
Sbjct  201  FTTRDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPAEYHR  256

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            +LI+SIGTGTAK   KYTA   A WGVL WL  G   PLID+FS AS+DMVD H A +F+
Sbjct  257  YLIISIGTGTAKQAEKYTAPNCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAILFQ  316

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            ALN   NYLRIQ+D+L G  SSVD++T  N+ AL  IG  LLKK V++++I T  YEP++
Sbjct  317  ALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGIGNMLLKKKVARVNIDTGVYEPVD  376

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAAS  615
              GTN++AL  FAK LSDE+K R++ +
Sbjct  377  DEGTNEEALAHFAKKLSDERKLRLSQT  403



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E+NL+DGGV ANNPTLVA++ VT++++ ++  F     S +P+   RFL
Sbjct  195  FKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNNDF----DSIKPMEYSRFL  250

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ +K AA WG+L WL+ G   PLID+FS +S DMVDY+LAT+ +AL
Sbjct  251  IISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGDMVDYNLATVTQAL  310

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ DNYLRIQ+D L G  SSVD+ T ENL+ L QIG+ LLKK +S +++ T  +EP +  
Sbjct  311  NSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNVNLETGVFEPTQNR  370

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TNQDALKRFAK+LS E++ R
Sbjct  371  ETNQDALKRFAKILSQERRLR  391



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E+NL+DGGV ANNPTLVA++ VT++++ ++  F     S +P+   RFL
Sbjct  202  FKNQDEDGNTHEFNLIDGGVCANNPTLVAVNEVTKQIINQNNDF----DSIKPMEYSRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ +K AA WG+L WL+ G   PLID+FS +S DMVDY+LAT+ +AL
Sbjct  258  IISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLIDMFSQSSGDMVDYNLATVTQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ DNYLRIQ+D L G  SSVD+ T ENL+ L QIG+ LLKK +S +++ T  +EP +  
Sbjct  318  NSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQIGERLLKKPLSNVNLETGVFEPTQNR  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TNQDALKRFAK+LS E++ R
Sbjct  378  ETNQDALKRFAKILSQERRLR  398



>gb|EMS52853.1| Patatin group M-3 [Triticum urartu]
Length=411

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 143/207 (69%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANG--AKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHR  174
            F T D  G     EY+L+DGGVAANNPT+ A+S +T+ ++ ++P F    +  +P   HR
Sbjct  204  FTTHDPAGKLPDREYHLIDGGVAANNPTMAAMSMITKEVLRRNPDF----THGKPAEYHR  259

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            +LI+SIGTGTAK   KYTA   A WGVL WL  G   PLID+FS AS+DMVD H A +F+
Sbjct  260  YLIISIGTGTAKQAEKYTAPDCAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAILFQ  319

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            ALN   NYLRIQ+D+L G  SSVD++T  N+ AL  IG  LLKK V++++I T  YEP++
Sbjct  320  ALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGIGNMLLKKKVARVNIDTGVYEPVD  379

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAAS  615
              GTN++AL  FAK LSDE+K R++ +
Sbjct  380  NEGTNEEALAHFAKKLSDERKLRLSQT  406



>ref|XP_010068174.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88861.1| hypothetical protein EUGRSUZ_A01188 [Eucalyptus grandis]
Length=412

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +GA  E+NL+DGGVAANNPTLVA+S VTQ ++   P F       +P+   RFL
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTQEIIKGRPDFF----PIKPMDYERFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +Y A +AA WG++GWL+ G   PL++V   A++DMVD HL+ +F+AL
Sbjct  253  VISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVFQATADMVDLHLSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++G +YLRIQ+D L G  SS+DV T +N+N L ++G+ LLKK VS++++ T  +EP+   
Sbjct  313  HSGKSYLRIQDDKLSGLTSSMDVATKKNMNDLVKVGEGLLKKPVSRVNLDTGIFEPLNQE  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS+EK+ R A S
Sbjct  373  -TNEEALKRFAKLLSEEKRLRHARS  396



>ref|XP_006365363.1| PREDICTED: patatin group M-2-like [Solanum tuberosum]
Length=409

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ +++ ++       L +   + +   + L
Sbjct  212  FETRDAAGRIHTFDLIDGGVAANNPTLMAITHISKEIMMGS----LKDEEMETMDSKKML  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY A  A+ WG+LGW+     +P+IDV+SDAS+DMVD H++T+F+ L
Sbjct  268  VLSLGTGIGKHQGKYNAASASKWGLLGWVYNNGDSPIIDVYSDASADMVDIHVSTMFQTL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            + G NYLRIQ+DNL G A+S+D+ TTEN+  L QIG NLLKK VS++++ T QYEP+ G 
Sbjct  328  HNGKNYLRIQDDNLIGDAASMDIATTENMETLVQIGNNLLKKPVSRVNLETGQYEPVHGE  387

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA LLS EKK R
Sbjct  388  GTNEEALIRFAYLLSHEKKLR  408



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = +1

Query  34   EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKY  213
            E+NL+DGG+AANNPTLVA+  VT++++ ++P F    S   P+   RFL++S+G G+ + 
Sbjct  205  EFNLIDGGIAANNPTLVAIREVTKQIMKENPNF----SDMDPLDYTRFLVISLGGGSNRL  260

Query  214  GSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQE  393
              KY AK+A+ WGV+ WL + +  P+ID +S+AS DMVDYH + +F AL++ D YLRI +
Sbjct  261  EKKYNAKEASKWGVICWLFENNHTPIIDCYSEASKDMVDYHNSVVFEALHSEDKYLRIDD  320

Query  394  DNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFA  573
            D LRG  +SVDV T EN++ L ++G++LLKK V+++++ T  YEPIE  GTN++AL+RFA
Sbjct  321  DTLRGELASVDVATKENMDNLVKVGEDLLKKTVTRINLDTGLYEPIENGGTNEEALRRFA  380

Query  574  KLLSDEKKRRIAASA  618
            KLLSDEKK R + S 
Sbjct  381  KLLSDEKKVRESKSP  395



>ref|XP_006360228.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=420

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G    ++LVDGGVAANNPTLVA++  ++ ++       L N++ +P+ C + L
Sbjct  211  FETKDSQGKTRTFDLVDGGVAANNPTLVAITQTSKEIMLGK----LRNANLKPMDCKKML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG AK   KY+A  A+ WGVLGWL     +PL+DV+ DAS+D+VD HL+TIF++L
Sbjct  267  VLSLGTGIAKDEKKYSAAAASTWGVLGWLYSNGASPLLDVYGDASADIVDVHLSTIFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQ+D+L G ASS+DV T +N+ AL QIG + LKKAVS++++ T +YE + G 
Sbjct  327  ESEKNYLRIQDDSLSGEASSMDVATRKNMEALVQIGNDRLKKAVSRVNLDTGRYEEVSGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAKLLS+++K R
Sbjct  387  GTNEEALIRFAKLLSEQRKIR  407



>ref|XP_009780403.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=427

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTLVA+S +++ ++    ++       +P+ C + L
Sbjct  211  FETKDAEGKIRTFDLIDGGVAANNPTLVAISHISKEIMLGKSQY----EGMEPMDCKKML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY+A  A++WGVLGWL     +PL+DVF DAS+D+VD HL+T+F++L
Sbjct  267  VLSLGTGIGKEEKKYSAAVASSWGVLGWLYNNGASPLLDVFGDASADIVDIHLSTMFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D+L G A+S+DV+TTEN+  L QIG +LLKK VS++++ T +YE + G 
Sbjct  327  QNEKNYLRIQDDSLTGEAASMDVSTTENMKTLVQIGNDLLKKPVSRVNLDTGRYEEVSGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++A  RFAKLLS+++K R
Sbjct  387  GTNEEAFIRFAKLLSEQRKLR  407



>gb|KGN62540.1| hypothetical protein Csa_2G360570 [Cucumis sativus]
Length=321

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+T D A     E+NL+DGGVAANNPTLVA+  VT+ ++ ++P F     + +P+   RF
Sbjct  100  FKTEDTAAKTTREFNLIDGGVAANNPTLVAIGEVTKEVIKQNPDFF----AIKPMDYRRF  155

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG  K   +YTA+ AA WG+L WL+ G   P+IDVFS ASSDMVD+HL+ IF+A
Sbjct  156  LVISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDFHLSVIFQA  215

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L+  DNYLRIQ+D L G  SSVDV T +NLN L ++G++LLKK VS++++ T  +E    
Sbjct  216  LHCEDNYLRIQDDTLSGDLSSVDVATQKNLNDLVKVGESLLKKPVSRVNLQTGVFEDCPS  275

Query  538  -AGTNQDALKRFAKLLSDEKKRRIAAS  615
             + TN  AL RFAKLLSDE++ R A S
Sbjct  276  NSETNDQALTRFAKLLSDERRLRHARS  302



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 144/203 (71%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   DANG   E++LVDGGVAANNPTL+A+S VT+++  ++  F    S  +P+   RFL
Sbjct  229  FTNQDANGNVREFDLVDGGVAANNPTLIAISEVTKQIYKQNRDF----SPLKPMDYSRFL  284

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KYTA  AA WG++ WL      P++DV+S ASSDMVD H++ IF+AL
Sbjct  285  VISIGTGSAKIEQKYTASMAAEWGIIKWLFNNGDVPIVDVYSQASSDMVDLHMSVIFQAL  344

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G  S VD+ T ENL+ L QIG+ LLKK ++++++ T   EP+E  
Sbjct  345  HSQDRYLRIQDDELAGEESLVDIATKENLDKLVQIGEQLLKKPLARVNLETGLSEPLENG  404

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
             TN+DALKRFAKLLS EK+ R A
Sbjct  405  VTNKDALKRFAKLLSSEKRLREA  427



>ref|XP_010068219.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 150/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +GA  E+NL+DGGVAANNPTLVA+S VT+ ++   P F       +P+   RFL
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEIIKGSPDFF----PIKPMDYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +Y A +AA WG++GWL+ G   PL++V + A++DMVD HL+ +F+AL
Sbjct  253  VISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++G +YLRIQ+D L G  SSVDV T +N+N L ++G+ LLKK VS++++ T  +EP+   
Sbjct  313  HSGKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLNQE  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS+EK+ R A S
Sbjct  373  -TNEEALKRFAKLLSEEKRLRHARS  396



>gb|KCW88897.1| hypothetical protein EUGRSUZ_A01223, partial [Eucalyptus grandis]
Length=404

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 150/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +GA  E+NL+DGGVAANNPTLVA+S VT+ ++   P F       +P+   RFL
Sbjct  197  FKTEDHSGAVREFNLIDGGVAANNPTLVAISEVTKEIIKGSPDFF----PIKPMDYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +Y A +AA WG++GWL+ G   PL++V + A++DMVD HL+ +F+AL
Sbjct  253  VISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVNQATADMVDLHLSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++G +YLRIQ+D L G  SSVDV T +N+N L ++G+ LLKK VS++++ T  +EP+   
Sbjct  313  HSGKSYLRIQDDKLSGLTSSVDVATKKNMNDLVKVGEGLLKKLVSRVNLDTGIFEPLNQE  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++ALKRFAKLLS+EK+ R A S
Sbjct  373  -TNEEALKRFAKLLSEEKRLRHARS  396



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 148/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +GA  E+NL+DGGVAANNPTLVA+S VT+ +  + P F       +P+   RFL
Sbjct  197  FKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFF----PIKPMDYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    YTA +AA WG++GWL  G   PL++VF+ AS+DMVD HL+ +F+AL
Sbjct  253  VISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLHLSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ ++YLRIQ+D L G  SSVD+ T +N+N L ++G+ LLKK VS +++ T   EP+   
Sbjct  313  HSRNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSSVNLDTGTLEPL-NR  371

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++ALKRFAKLLS+EKK R+A S 
Sbjct  372  DTNEEALKRFAKLLSEEKKLRLAQSP  397



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPT VA+  VT+ ++     F       +P+   RFL
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   KY A++AA WGVLGWLS   G+PL+DVF  AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGSQKVEGKYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L GS +SVD+ T +NLN L + G+ LLKK VSK+D+ T QY+  +  
Sbjct  314  HLEANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQYDACK-L  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS+E++ R A S
Sbjct  373  ETNEEALRRFAKLLSNERQLRHARS  397



>ref|XP_006374973.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
 gb|ERP52770.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
Length=414

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  206  FETKDPSGKVREFNLIDGGVAANNPTLVAMSEVSKEITRKNPDFF----PTAPMDYGRFL  261

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+AK   KY A +AA WGVLGWL+  +  PL+DVF++AS DM+D H++T+F+AL
Sbjct  262  VLSLGTGSAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTVFQAL  321

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  +NY+RIQ+D L G+ SSVD+ T ENL  L ++G+ LLKK VS++D+ T  + P++  
Sbjct  322  HCEENYIRIQDDTLTGTLSSVDIATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPVDKM  381

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  382  -TNEEALIKMAKLLSREKHLR  401



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 148/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +GA  E+NL+DGGVAANNPTLVA+S VT+ +  + P F       +P+   RFL
Sbjct  197  FKTIDHSGAVREFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFF----PIKPMDYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    YTA +AA WG++GWL  G   PL++VF+ AS+DMVD HL+ +F+AL
Sbjct  253  VISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLHLSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ ++YLRIQ+D L G  SSVD+ T +N+N L ++G+ LLKK VS +++ T   EP+   
Sbjct  313  HSRNSYLRIQDDRLSGLVSSVDIATKKNMNDLIKVGERLLKKPVSSVNLDTGTLEPL-NR  371

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++ALKRFAKLLS+EKK R+A S 
Sbjct  372  DTNEEALKRFAKLLSEEKKLRLAQSP  397



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 142/205 (69%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G + E+NL+DGGV ANNP LVA+S VT+++  ++P F       +P+   RFL
Sbjct  199  FKTQDQDGNEREFNLIDGGVTANNPALVAISEVTKQITKENPDFF----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTGTAK   KY A  A  WG++ WL  G   PL+DVF+ AS DMVDYH A +F+AL
Sbjct  255  VISIGTGTAKMEQKYNANMATKWGIIQWLVNGGSTPLVDVFTQASGDMVDYHNAVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +G +YLRIQ+D L G  SSVD+ T ENL+ L + G+ LLKK VS +++ T  +EPI   
Sbjct  315  KSGSSYLRIQDDTLVGEISSVDIATKENLDNLVKAGEALLKKPVSGVNLQTGIFEPITNG  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN++ALK+FAK LS E++ R A S
Sbjct  375  GTNEEALKKFAKQLSVERRLREARS  399



>ref|XP_009589750.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=427

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 148/204 (73%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTLVA+S +++ ++    ++       +P+ C + +
Sbjct  211  FETKDAQGKTRTFDLIDGGVAANNPTLVAISHISKEIMLGKSQY----EGMEPMDCKKMM  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY+A  A++WGVLGWL     +PL+DVF DAS+D+VD HL+T+F++L
Sbjct  267  VLSLGTGIGKEEKKYSAAVASSWGVLGWLYNNGASPLLDVFGDASADIVDIHLSTMFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D+L G A+S+D++TT+N+  L QIG +LLKK VS++++ T +YE + G 
Sbjct  327  QNEKNYLRIQDDSLTGEAASMDISTTKNMKTLVQIGNDLLKKPVSRVNLDTGRYEQVSGE  386

Query  541  GTNQDALKRFAKLLSDEKKRRIAA  612
            GTN++AL RFAKLLS+++K R  A
Sbjct  387  GTNEEALIRFAKLLSEQRKLRQPA  410



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 146/206 (71%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  DA G   E+NL+DGG+AANNPTLVA+S V+++M  K+P F       +P    R+L
Sbjct  199  FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVSKQMSKKNPDFF----PIKPTNYERYL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG  + G+ Y+AK A+ WGV+GWL      PLI  +++ASSDMVDYH + +F+A 
Sbjct  255  VISIGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAF  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ + YLRI ED L+G   SVD+ T ENL  L ++G++LLK  VS++++ T  YEP+E  
Sbjct  315  HSENYYLRIDEDKLQGDLYSVDIATKENLENLVKVGEDLLKSPVSRINLDTGGYEPVEDG  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++AL+RFAKLLS+E+K R + SA
Sbjct  375  GTNEEALQRFAKLLSEERKLRQSNSA  400



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ +V     F       +P    RFL
Sbjct  198  FETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFF----PIKPTDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G PLIDVF+ AS+DMVDYHL  +F+AL
Sbjct  254  VISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLFAVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQ+D L G  SSVDV T +NL  L + G+ LLKK VS++++ T   EP    
Sbjct  313  QLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVCEPTPNQ  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL RFAKLLS E++ R   S 
Sbjct  373  ETNEEALMRFAKLLSQERQLRHVKSP  398



>ref|XP_008670872.1| PREDICTED: patatin-like protein 1 [Zea mays]
Length=330

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  127  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  182

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  183  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  242

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  243  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  302

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  303  GTNAEALAHFAKKLSDERKLR  323



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 139/203 (68%), Gaps = 5/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++     F       +P+   RFL
Sbjct  198  FETKDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G PLIDVF+ AS+DMVDYHL  +F+AL
Sbjct  254  VISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLCAVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQ+D L G  SSVDV T +NL  L + G+ LLKK VS++++ T   EP    
Sbjct  313  QLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPVSRVNLETGVGEPTTNQ  372

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
             TN++AL RFAKLLS E++ R A
Sbjct  373  ETNEEALIRFAKLLSQERQLRHA  395



>ref|XP_002305891.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
 gb|EEE86402.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
Length=409

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 6/206 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DGGVAANNPTLVA+S V++ +   +P F       +P+   RFL
Sbjct  205  FQTKDPSGNVREFNLIDGGVAANNPTLVAISEVSKEINRDNPDFF----PIKPMEYDRFL  260

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+LGWL+ G   PL+DVF+ AS DMVD+HL T+F+AL
Sbjct  261  VLSLGTGTAKSEGKYDADEAAKWGILGWLTSGHSTPLVDVFTKASGDMVDFHLCTVFQAL  320

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDIL-TRQYEPIEG  537
             + DNYLRIQ++ L G+ SSVDV T ENL  L ++G+ LLKK+VS+++ L T  +EPI  
Sbjct  321  KSEDNYLRIQDNTLTGTLSSVDVATKENLQNLVKVGEELLKKSVSRVNYLGTGVFEPINK  380

Query  538  AGTNQDALKRFAKLLSDEKKRRIAAS  615
              TN++AL   AKLLS EK  R A S
Sbjct  381  M-TNEEALIELAKLLSREKHLREARS  405



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 143/202 (71%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G K  +NLVDGGVAANNPTL A+S + + +  ++  F     S +P+   +FL
Sbjct  199  FETKDAQGNKQSFNLVDGGVAANNPTLAAMSQIAKEVCVENKDF----HSIKPVDYSKFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K+TA++A+ WGVLGWL      PLI+ F+ AS+DMVD HL  +F+AL
Sbjct  255  VISLGTGSAKLEEKFTAQEASKWGVLGWLYDSGDTPLINAFTQASADMVDIHLCAMFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               +NYLRIQ+DNL GS SSVDV+T ENL  L QIG +LLKK VS++++ T  +E ++G 
Sbjct  315  ACRENYLRIQDDNLIGSTSSVDVSTKENLLKLVQIGSDLLKKHVSRVNLETGLFEEVKGD  374

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
             TN++AL R AK LSDE++ R 
Sbjct  375  VTNEEALTRLAKRLSDERRLRF  396



>ref|XP_011099197.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=433

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 148/204 (73%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D++G +  ++LVDGGVAANNPTL+A++ +++ ++    KF L +   QP+  +R L
Sbjct  213  FETQDSDGKRRSFDLVDGGVAANNPTLMAITHISKEILLG--KFELVD--MQPMDSNRML  268

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG A+   KY A  AA WG+LGW+      PL+D++ DASSDMVD H++T+F++L
Sbjct  269  VLSLGTGLAQLEEKYNAGDAAKWGLLGWVYNNGATPLLDIYGDASSDMVDIHVSTLFQSL  328

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQED L G ASS+D++T +N+  L QIG++LLKK VS++++ T + EP+ G 
Sbjct  329  RNEQNYLRIQEDRLAGDASSLDISTIKNMQTLVQIGESLLKKPVSRVNLETGRPEPVHGE  388

Query  541  GTNQDALKRFAKLLSDEKKRRIAA  612
            GTN+ AL RFAKLLSDE+K R  A
Sbjct  389  GTNEQALARFAKLLSDERKLRSPA  412



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 143/205 (70%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D  G   ++NL DGGVAANNPT++A+S VT++M+  DP F    S  +P    RFL
Sbjct  200  FTNQDDKGNVWDFNLTDGGVAANNPTILAMSQVTKQMIKNDPDF----SQMKPTDYARFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   K++A+    W  LGW+  G   PL+++F+ AS DMVDY ++ IF+AL
Sbjct  256  VISIGTGSAKIEKKFSAEMVNKWNPLGWVLNGTVPPLVEMFAQASGDMVDYQISVIFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D L G ++SVDV T EN+  L +IG NLLKK VS++++LT   E +E  
Sbjct  316  HSEANYLRIQDDTLTGQSASVDVATKENMEKLGEIGSNLLKKPVSRVNLLTGAVEQVENG  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN++ALKRFAKLLSDE++ R + S
Sbjct  376  GTNEEALKRFAKLLSDERRLRRSKS  400



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 147/206 (71%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D+ G   E+NL+DGGV ANNPTLVA++ VT++++ ++P F     S +P+   RFL
Sbjct  200  FKNQDSQGNTHEFNLIDGGVCANNPTLVAMNQVTKQIINENPDFF----SIKPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ A+ AA WG+L WL+     PLIDVF+ +S+DMVD+HLAT+ +AL
Sbjct  256  IISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVD+ T ENL  L QIG+ LLKK VS++++    +E +   
Sbjct  316  HSENNYLRIQDDTLTGTDSSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFESVGNG  375

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++ALKRFAK+LS E++ R + S 
Sbjct  376  ETNENALKRFAKILSQERRLRESKSP  401



>ref|XP_006374981.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
 gb|ERP52778.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
Length=417

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  209  FETKDPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFF----PTAPMDYGRFL  264

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WGVLGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  265  VLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQAL  324

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LLKK V+++D+ T  + P++  
Sbjct  325  HSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLKKPVARVDLGTGIFTPVDKM  384

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AK LS EK  R
Sbjct  385  -TNEEALIKMAKSLSREKHLR  404



>gb|AEF30538.1| patatin-like phospholipase 1 [Capsicum annuum]
Length=413

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 144/203 (71%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    +NLVDGGVAANNPTL+A++ V+++++  + ++       + + C + L
Sbjct  214  FETKDAQGKTRTFNLVDGGVAANNPTLMAITHVSKQIMRGNFQY----EDMENVDCKKML  269

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY A  A+ WG+LGW+      PLID+F DAS+DMVD H++T+F+  
Sbjct  270  VLSLGTGIGKHEEKYNATVASRWGMLGWVFNNGATPLIDIFGDASADMVDIHVSTMFQTF  329

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ T EN+  L QIG  LLKK +S++++ T +YEP+ G 
Sbjct  330  GSEKNYVRIQDDNLVGEAASMDIATRENMETLVQIGNGLLKKPISRVNLETGRYEPVVGE  389

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
            GTN+ A+ RFA+LLS+E+K RIA
Sbjct  390  GTNEAAMVRFAQLLSEERKLRIA  412



>gb|KJB63808.1| hypothetical protein B456_010G0176001, partial [Gossypium raimondii]
Length=242

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+    +G   EYNL+DGGVAANNPTLVA+  V++ ++  +P F       +P+   +FL
Sbjct  30   FKIQTDDGDVREYNLIDGGVAANNPTLVAMGEVSKEIIKGNPDFF----PTKPMDYGKFL  85

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   +Y AKQ+A WG+LGWL+ G   PL+DVF+ AS DMVD HL+ +F AL
Sbjct  86   VISLGTGSRKDEKRYNAKQSAKWGILGWLTSGGSTPLVDVFTQASGDMVDLHLSVVFEAL  145

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G  SSVD+ T  NLN L +IG+ LLKK VS++++ T  +EP +  
Sbjct  146  HS-DKYLRIQDDGLIGDVSSVDIATENNLNELVKIGEGLLKKKVSRVNLETGIFEPFK-E  203

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++ALKRFAKLLS E+ RR
Sbjct  204  ETNEEALKRFAKLLSQERHRR  224



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+    +G   E+NL+DGGVAANNP L+A+  +T+R+  ++P F       +P+   RFL
Sbjct  202  FKNEGEDGDVREFNLIDGGVAANNPALIAIRELTKRVFGENPDFF----PIKPMDYCRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   KY+AK AA WGV+GWL  G   PL+DVF+ A +DMVD+H+A +F+AL
Sbjct  258  VISLGTGSPKKEMKYSAKMAAKWGVMGWLLNGSSTPLVDVFTQAGADMVDFHIAVVFQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQ+D L G+ +SVD+ T +NL  L ++G+ LLKK VS++++ T   EP+   
Sbjct  318  KSESNYLRIQDDTLTGAVASVDIATKKNLENLVKVGEELLKKPVSRINLETGLSEPVANG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            G N++ALK+FAKLLSDE+K R
Sbjct  378  GINEEALKKFAKLLSDERKLR  398



>ref|XP_007017305.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14530.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 10/204 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCH---  171
            FET D+ G   E++L+DGGVAANNPTLVA++ VT+ +  K+  F        PI  +   
Sbjct  210  FETKDSTGNVKEFHLIDGGVAANNPTLVAMNEVTKEITRKNSDFF-------PIEANDFS  262

Query  172  RFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIF  351
             FL+LS+GTG+ K   KY A  AA WG+LGWL+     PL+DVF  ASSDMVD+H+AT+F
Sbjct  263  HFLVLSLGTGSQKCEEKYPAHMAAKWGLLGWLTSEHSTPLMDVFMQASSDMVDFHIATVF  322

Query  352  RALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI  531
            +AL + D YLRIQ+D L G+ SSVD+ T ENL  L Q+G+ LLKK VS++++   ++EPI
Sbjct  323  QALQSEDRYLRIQDDTLCGTISSVDIATKENLENLVQVGEELLKKPVSRVNLDNGKFEPI  382

Query  532  EGAGTNQDALKRFAKLLSDEKKRR  603
            +   TN+DAL R AK+LS EK+ R
Sbjct  383  KNQDTNEDALIRLAKVLSQEKRLR  406



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DGG+AANNPTL+A+S VT++++ +DP F      K PI   R L
Sbjct  199  FKTEDKDGRVHEFNLIDGGLAANNPTLIAISEVTRQILKEDPDFF---DIKSPIDYTRLL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+     K+ AK+A+ WG+  WL +   +PLID ++  S+D+VDYH +  F+  
Sbjct  256  VISLGTGSDTSELKFDAKKASKWGLFSWLYEDGSSPLIDAYTQGSADLVDYHNSVAFKTY  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + DNYLRI +D L+G+ SSVD +T +NL  L ++G++LL+KAVS++++ T  YEPI  A
Sbjct  316  QSEDNYLRINDDTLKGTLSSVDTSTKKNLEDLVKVGEDLLRKAVSRVNLDTGHYEPIPNA  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEKK R
Sbjct  376  GTNEEALKRFAKLLSDEKKLR  396



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 146/202 (72%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            FET +    KV E+NL+DGGVAANNP LVA+  VT+ ++  +  F       +P+   RF
Sbjct  201  FETKEKQTGKVREFNLIDGGVAANNPALVAIGEVTKEILGGNSDFF----PIKPMDYGRF  256

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++SIGTG+ K   KY A +A+ WGVLGWL+ G   PL+DVF+ ASSDMVDYHL+ +F+A
Sbjct  257  LVISIGTGSPKAARKYNAIKASKWGVLGWLNSGGSTPLVDVFTQASSDMVDYHLSAVFQA  316

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L++  +YLRIQ+D L G  SSVD+ T  NL  L +IG+ LLKK VS++++ T ++EPI+ 
Sbjct  317  LHSEQHYLRIQDDTLNGKESSVDIATKSNLKNLVKIGERLLKKPVSRVNLETGRFEPID-  375

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++AL+RFA++LS+EK+ R
Sbjct  376  QGTNEEALERFARILSEEKRLR  397



>tpg|DAA42306.1| TPA: patatin T5 [Zea mays]
Length=407

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  204  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  260  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  320  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  379

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  380  GTNAEALAHFAKKLSDERKLR  400



>ref|XP_010320535.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=380

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T + +G   E+NL+DG +AANNPTL+A++  T+++  + P F  +    +P    +FL
Sbjct  170  FQTQNEDGKFHEFNLIDGAIAANNPTLIAINEATKQIFEQTPYFK-NFKEMKPTNYGKFL  228

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LSIGTG+AK   KY AK A+ WG+ GWL+ G  NP+ID F+DAS DMVDYH++ +F+++
Sbjct  229  VLSIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVDYHISVVFQSV  288

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
            ++  +YLRIQ+D L G+ S+VD++T EN+N L +IG NLLKK VS++++ T  +E + + 
Sbjct  289  HSQKHYLRIQDDTLSGADSTVDISTKENMNKLVEIGTNLLKKPVSRVNLQTGLFEQLNKD  348

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++ALK FAKLLS+EKK R
Sbjct  349  GGTNEEALKEFAKLLSEEKKIR  370



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ +V     F       +P+   RFL
Sbjct  198  FETEDPTGKVREFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G PLIDVF+ AS+DMVDYHL+ +F+AL
Sbjct  254  VISLGTGTGKVEGKYTAHEAAKWGVLGWLTSG-GTPLIDVFTQASADMVDYHLSAVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQ+D L G  SSVDV T +NL  L + G+ LLKK  S++++     EP    
Sbjct  313  QLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLVKTGEALLKKPASRVNLENGVCEPTPNQ  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL RFAKLLS E++ R   S 
Sbjct  373  ETNEEALIRFAKLLSQERQLRHVKSP  398



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+T D A     E+NL+DGGVAANNPTLVA+  VT+ ++ ++P F     + +P+   RF
Sbjct  195  FKTEDTAAKTTREFNLIDGGVAANNPTLVAIGEVTKEVIKQNPDFF----AIKPMDYRRF  250

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG  K   +YTA+ AA WG+L WL+ G   P+IDVFS ASSDMVD+HL+ IF+A
Sbjct  251  LVISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDFHLSVIFQA  310

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L+  DNYLRIQ+D L G  SSVDV T +NLN L ++G++LLKK VS++++ T  +E    
Sbjct  311  LHCEDNYLRIQDDTLSGDLSSVDVATQKNLNDLVKVGESLLKKPVSRVNLQTGVFEDCPS  370

Query  538  -AGTNQDALKRFAKLLSDEKKRRIAAS  615
             + TN  AL RFAKLLSDE++ R A S
Sbjct  371  NSETNDQALTRFAKLLSDERRLRHARS  397



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 145/207 (70%), Gaps = 7/207 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E+NL+DGGVAANNPTLVA+S +T+ ++ K+P F   N    P+   RFL
Sbjct  199  FKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDFCPIN----PLDYTRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WG++ WL      PL+D +  A  DMVDYH++ +F+AL
Sbjct  254  VISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE--  534
             + DNYLRI++D L+G  +S+D+TT EN   L + G+ LLKK VS++++ T  YEPIE  
Sbjct  314  QSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDTGLYEPIENG  373

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAAS  615
             AGTN++ALKRFAK+LSDE+K R + S
Sbjct  374  SAGTNEEALKRFAKMLSDERKLRESKS  400



>ref|XP_004234672.1| PREDICTED: patatin-like protein 3 isoform X2 [Solanum lycopersicum]
Length=410

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ +++ ++    K+       + +   + L
Sbjct  213  FETRDAAGRIHTFDLIDGGVAANNPTLMAITHISKEIMMGSLKY----EEMERMDSKKML  268

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY A  A  WG+LGW+      P+IDV+SDAS+DMVD H++T+F+ L
Sbjct  269  VLSLGTGIGKHQGKYNAASATKWGLLGWVYNNGDTPIIDVYSDASADMVDIHVSTMFQTL  328

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+DNL G A+S+D+ TTEN+  L QIG NLLKK VS++++ T QYEP+ G 
Sbjct  329  HNEKNYLRIQDDNLIGDAASMDIATTENMETLVQIGNNLLKKPVSRVNLETGQYEPVHGE  388

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA LLS EKK R
Sbjct  389  GTNEEALIRFANLLSHEKKLR  409



>ref|XP_008668146.1| PREDICTED: patatin T5 isoform X1 [Zea mays]
Length=407

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  204  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  260  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  320  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  379

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  380  GTNAEALAHFAKKLSDERKLR  400



>ref|XP_008671927.1| PREDICTED: patatin-like protein 3 [Zea mays]
Length=306

 Score =   206 bits (525),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T    G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  103  FKTEATEGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  158

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  159  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  218

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  219  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  278

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSD +K R
Sbjct  279  GTNAEALAHFAKKLSDVRKLR  299



>ref|XP_002284571.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=425

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNP LVA+  VTQ ++   P F       +P+   RFL
Sbjct  212  FETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIRGSPDFF----PIKPMDYGRFL  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A QAA WG+LGWL+ G   PL+DVF+ AS DMVD HL+ +F+AL
Sbjct  268  VISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQAL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  328  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEP-SNH  386

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL  FA+LLS EK+RR A S 
Sbjct  387  ETNEEALTSFARLLSQEKQRRDARSP  412



>ref|XP_003577355.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=413

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = +1

Query  34   EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKY  213
            EY+LVDGGVAANNPT+ A+S +T+ ++ K+P F   N    P   + +LI+SIGTG+AK 
Sbjct  221  EYHLVDGGVAANNPTMAAMSMITKEVLRKNPDFTHGN----PAEYNNYLIISIGTGSAKM  276

Query  214  GSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQE  393
              KYTA   A WGVL WL  G   PLID+FS AS+DMVD H A +F+AL   +NYLRIQ+
Sbjct  277  AEKYTAPACAKWGVLRWLYDGGFTPLIDIFSHASADMVDIHAAVLFKALRVKENYLRIQD  336

Query  394  DNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFA  573
            D+L G  SSVD+ T +N+ AL +IG  LL+K V++++I T  YE +EG GTN++ALKRFA
Sbjct  337  DSLEGDTSSVDIATKKNMEALIEIGNGLLQKKVARVNIDTGMYETVEGEGTNEEALKRFA  396

Query  574  KLLSDEKKRRIA  609
              LS+E+K R A
Sbjct  397  VKLSNERKLRQA  408



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T  + G+  E++LVDGGVAANNP LV++  VT+ +  K+P +       +P+   + L
Sbjct  200  FQTKCSKGSSREFHLVDGGVAANNPALVSVGEVTKELHKKNPDYF----PYKPMDYRKIL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K++AK+A+ WGVLGWL     NPL DVF  +S+DMVD HL+ +F+AL
Sbjct  256  LISLGTGSAKVEGKFSAKRASKWGVLGWLLSSGSNPLFDVFMQSSADMVDIHLSVVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
             +  NYLRI++D L G+ SSVD++T ENL  L  +G+ LLKK VS++++ T  YEP+  G
Sbjct  316  QSKSNYLRIEDDTLSGTVSSVDISTKENLADLVNVGEQLLKKPVSRVNLETGIYEPVGNG  375

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN+DALKRFA++LSDE++ R
Sbjct  376  EGTNEDALKRFARILSDERRLR  397



>gb|EMS45954.1| Patatin group A-3 [Triticum urartu]
Length=398

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 141/205 (69%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    FETTDANG--AKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHR  174
            F T D  G     EY+LVDGGVAANNPT+VA+S +TQ ++ ++P F    +  +P     
Sbjct  193  FTTHDPLGKLPDREYHLVDGGVAANNPTMVAMSMITQEVMRRNPDF----THGKPAEYSN  248

Query  175  FLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFR  354
            +LI+SIGTGTAK   KYTA   A WGVL WL  G   PL+D+FS AS+DMVD H A +F+
Sbjct  249  YLIISIGTGTAKQAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHAAVLFQ  308

Query  355  ALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE  534
            +L    NYLRIQ+D+L G  SSVD++T EN+ AL  IG  LLK +V++++I T  YEP++
Sbjct  309  SLRVEKNYLRIQDDSLTGHTSSVDISTKENMEALIGIGNKLLKMSVARVNIDTGMYEPVD  368

Query  535  GAGTNQDALKRFAKLLSDEKKRRIA  609
              GTN++AL RFAK LS+E+K R A
Sbjct  369  DEGTNEEALARFAKKLSNERKLRQA  393



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D N  + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFL
Sbjct  156  FTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFL  211

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGTAK   K++A  AA WG+LGWL+    NPLIDVF+ +S DMVD+HL+ + +AL
Sbjct  212  IISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQAL  271

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G  SSVD+ T ENL  L +IG  LLKK VS++++    +EP+   
Sbjct  272  HSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVIDG  331

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+ ALKR AK LS E++ R
Sbjct  332  ETNEQALKRLAKTLSQERRLR  352



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  +++G   E+NL+DGGVAANNP LVA+S VT+ +   +  F       +P    RFL
Sbjct  196  FKIKNSDGKVREFNLIDGGVAANNPALVAMSEVTKEIFRGNTDFF----PIKPTDYGRFL  251

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGTAK   K+ AK+++ WGVLGWL  G  NPL+D F+ ASSDMVD H++ +F+AL
Sbjct  252  VISLGTGTAKNEEKFDAKESSKWGVLGWLLSGGSNPLVDAFTQASSDMVDIHISVVFQAL  311

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++   YLRIQ+D L+G+ SSVDV T ENL++L +IG+ LLKK  S++++ T  YEP++  
Sbjct  312  HSDSKYLRIQDDTLKGTVSSVDVATKENLDSLVKIGEELLKKPTSRINLETGVYEPVDKE  371

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+ ALKRFAK+LS+E++ R
Sbjct  372  -TNEQALKRFAKILSEERRLR  391



>emb|CBI25858.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET +ANG    +NL+DGGVAANNPTLVA+S +++ ++  + +F+      +P+     L
Sbjct  178  FETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQFI----EMKPMDSKSML  233

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY+A +A+ WG+  W       PL+D+FS ASSDMVD H++T+F++L
Sbjct  234  VLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDMVDIHVSTVFQSL  293

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D L G  SSVDV TTENL  L +IGK LL K +S++++ T ++E +EG 
Sbjct  294  GCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLAKPLSRVNLETGRHEQLEGE  353

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTNQ+AL +FAKLLS+E+K R
Sbjct  354  GTNQEALTQFAKLLSEERKFR  374



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F   D  G  V E+NL+DGGVAANNPTLVA+  VT++++ K      +  S  P+   RF
Sbjct  200  FTKQDEQGNVVREFNLIDGGVAANNPTLVAIREVTKQIIRKP-----NEISSSPLNYDRF  254

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTG+ K   KY AK  + WG+L W+ +    P+ID FS+ASSDMVDYH   +FRA
Sbjct  255  LVLSLGTGSNKNEHKYDAKMVSKWGILTWVFRSGLTPIIDCFSEASSDMVDYHNCVVFRA  314

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L + DNYLRIQ+D L+G  +SV + TTENLN L  +GK LLKK V+++++ T  YEP+  
Sbjct  315  LQSEDNYLRIQDDTLKGDLASVHIATTENLNNLVNVGKQLLKKRVTRVNLDTGLYEPVPD  374

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++ALKRFAK LSD +K++
Sbjct  375  KGTNEEALKRFAKSLSDVRKKK  396



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+ +D+ G   E+NL+DGGV ANNP+LVA++ VT++++  +P F     S +P+   RFL
Sbjct  200  FKNSDSEGTMHEFNLIDGGVCANNPSLVAINQVTKQIINDNPDFF----SIKPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   K+ AK AA WG+  WL+     PLIDV + +S+DMVD+HLAT+ +AL
Sbjct  256  VISLGTGTPKNEHKFNAKMAAKWGLFDWLTNSGSTPLIDVLTHSSADMVDFHLATVTQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  +S+D+ T EN+  L QIG  LLKK VS++++ T  +EP+   
Sbjct  316  HSKNNYLRIQDDTLTGVDASLDIATKENMEKLSQIGDRLLKKPVSQINLETGLFEPMGDG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DAL+RFAK+LSDE+  R
Sbjct  376  ETNEDALRRFAKMLSDERSFR  396



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 5/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T+D+ GA  +YNL+DGG+AANNPTL+A+S VT+ +  K P F   N+S+      RFL
Sbjct  197  FQTSDSTGALRDYNLIDGGMAANNPTLIAISEVTREITRKSPAFNSINASE----FGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY AK  A WGV GWL   +  PLID F   S+DMVD HL+ +F+AL
Sbjct  253  VISVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAFMQGSADMVDIHLSVVFKAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+  NYLRIQ+D L G+ S+VD +T ENLN L  +G+ LLKK VSK+++ T   E     
Sbjct  313  NSESNYLRIQDDTLSGTVSTVDTSTKENLNNLVGVGEKLLKKPVSKVNLETGNLEA-SKM  371

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
             TN+ ALKRFAKLL +E++RR A
Sbjct  372  ETNEQALKRFAKLLVEERRRRHA  394



>emb|CAN62059.1| hypothetical protein VITISV_024099 [Vitis vinifera]
Length=397

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET +ANG    +NL+DGGVAANNPTLVA+S +++ ++  + +F+      +P+     L
Sbjct  197  FETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQFI----EMKPMDSKSML  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY+A +A+ WG+  W       PL+D+FS ASSDMVD H++T+F++L
Sbjct  253  VLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDMVDIHVSTVFQSL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D L G  SSVDV TTENL  L +IGK LL K +S++++ T ++E +EG 
Sbjct  313  GCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLXKPLSRVNLETGRHEQLEGE  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTNQ+AL +FAKLLS+E+K R
Sbjct  373  GTNQEALTQFAKLLSEERKFR  393



>emb|CBI19544.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNP LVA+  VTQ ++   P F       +P+   RFL
Sbjct  247  FETKDPTGRVREFNLIDGGVAANNPALVAIGEVTQEIIRGSPDFF----PIKPMDYGRFL  302

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A QAA WG+LGWL+ G   PL+DVF+ AS DMVD HL+ +F+AL
Sbjct  303  VISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSQVFQAL  362

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  363  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGVFEP-SNH  421

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL  FA+LLS EK+RR A S 
Sbjct  422  ETNEEALTSFARLLSQEKQRRDARSP  447



>ref|XP_006338216.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=412

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++LVDGGVAANNPTL+A++ V+++++T + ++       + + C + L
Sbjct  214  FETKDAQGKPRTFDLVDGGVAANNPTLMAITYVSKQIMTGNFQY----EGMKNMDCKKML  269

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY A  A+ WG+LGW+      PLID++ DAS+DMVD H++T+F+ L
Sbjct  270  VLSLGTGIGKQEEKYNATVASRWGMLGWVYNNGATPLIDIYGDASADMVDIHVSTMFQTL  329

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ TT+N+  L QIG +LLKK +S++++ T +YEP+ G 
Sbjct  330  GSEKNYIRIQDDNLTGEAASMDIATTKNMETLVQIGNDLLKKPISRVNLETGRYEPVVGE  389

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN+ A+ RFA+LLS+E+K RI
Sbjct  390  GTNEAAIVRFAQLLSEERKLRI  411



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DANG    +NLVDGGVAANNPTL A+S VT+ ++ K+  F    S  +P+   +FL
Sbjct  274  FETKDANGNTRSFNLVDGGVAANNPTLAAISEVTKEILKKNEDF----SPIKPMDYGKFL  329

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +++A++A+ WGVL WL      PLID+F+ AS+DMVD H + +F+AL
Sbjct  330  VISLGTGSAKNEERFSAQKASKWGVLRWLYNNGAAPLIDIFTQASADMVDIHASVVFQAL  389

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+DNL G+ASSVD++T ENL  L QIGK+LLKK VS++++ T   E + G 
Sbjct  390  HSTGNYLRIQDDNLTGNASSVDISTEENLLKLVQIGKDLLKKRVSRVNLETGLSEEVNGE  449

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  FAKLLS+E++ R
Sbjct  450  VTNEEALIHFAKLLSNERRLR  470



>tpg|DAA42302.1| TPA: hypothetical protein ZEAMMB73_996038 [Zea mays]
Length=459

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  256  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  311

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  312  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  371

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  372  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  431

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  432  GTNAEALAHFAKKLSDERKLR  452



>ref|XP_006374982.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
 gb|ERP52779.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
Length=417

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET   +G   E+NL+DGGVAANNPTLVA+S V++ +  K+P F        P+   RFL
Sbjct  209  FETKGPSGKVREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFF----PTAPMDYGRFL  264

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+LGWL+  +  PL+DVF++AS DMVD H++T+F+AL
Sbjct  265  VLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASGDMVDLHVSTVFQAL  324

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SS+DV T ENL  L ++G+ LLKK VS++D+ T  + P +  
Sbjct  325  HSEENYLRIQDDTLTGTLSSMDVATKENLENLVKVGEKLLKKPVSRVDLGTGIFTPTDKM  384

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK  R
Sbjct  385  -TNEEALIKMAKLLSREKHLR  404



>ref|XP_002262942.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=397

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET +ANG    +NL+DGGVAANNPTLVA+S +++ ++  + +F+      +P+     L
Sbjct  197  FETKEANGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQFI----EMKPMDSKSML  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY+A +A+ WG+  W       PL+D+FS ASSDMVD H++T+F++L
Sbjct  253  VLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDMVDIHVSTVFQSL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D L G  SSVDV TTENL  L +IGK LL K +S++++ T ++E +EG 
Sbjct  313  GCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEIGKELLAKPLSRVNLETGRHEQLEGE  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTNQ+AL +FAKLLS+E+K R
Sbjct  373  GTNQEALTQFAKLLSEERKFR  393



>gb|KHN12766.1| Patatin-3-Kuras 1 [Glycine soja]
Length=315

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+ G   E+NL+DGGV ANNPTLVA++ VT++++ ++  F       +P+   RFL
Sbjct  121  FNNHDSKGNVHEFNLIDGGVCANNPTLVAMNEVTKQIIKQNSDFF----PIKPMEYGRFL  176

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTGT+K   K+ A+ AA WG+L WL+Q   NPLIDVFS +S+DMVD+HL+ + +AL
Sbjct  177  IISIGTGTSKTEEKFNAQMAAKWGLLDWLTQSGSNPLIDVFSQSSADMVDFHLSAVTQAL  236

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ DNYLRIQ+D L G+ SSVD+ T ENL  L QIG+NLLKK VS++++    ++P++  
Sbjct  237  NSQDNYLRIQDDTLTGTDSSVDIATKENLEKLYQIGENLLKKPVSRVNLENGLFQPLKNG  296

Query  541  GTNQDALKRFAK  576
             TN+ ALKR AK
Sbjct  297  ETNEHALKRLAK  308



>gb|KGN62064.1| hypothetical protein Csa_2G294910 [Cucumis sativus]
Length=301

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRM-VTKDPKFLLDNSSKQPIGCHRF  177
            F+T D+ G    Y +VDGGVAANNPTL A++ VT+ M + +    LL     +P+   R 
Sbjct  100  FQTKDSKGNIRNYEMVDGGVAANNPTLAAMTHVTKEMSILRHRSELL---KIKPMETERM  156

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTGT K   KY+A +A+ WG+L W+  G G P++D+FSDAS+DMVDYH+++IF++
Sbjct  157  LVLSLGTGTPKNDEKYSAAKASKWGMLDWVYHGGGTPIVDIFSDASADMVDYHISSIFQS  216

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
             +   NYLRIQ+D L G  SSVD+ T ENL  L  +G+NLLKK +S++++ + ++EP++ 
Sbjct  217  DHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLIYVGENLLKKPLSRVNLESGKFEPLDA  276

Query  538  AGTNQDALKRFAKLLSDEKKRRIA  609
             GTN+ AL  FAK+LS+E+K R++
Sbjct  277  KGTNEQALAEFAKMLSNERKLRLS  300



>emb|CDP02475.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 148/203 (73%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ ++++++T   +F L  +  +P+  +R L
Sbjct  212  FETKDAQGNTRSFDLIDGGVAANNPTLMAITHISKQILTG--QFQL--TDLKPMESNRML  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG AK   KYTA  A  WG LGW+      PL+DVF  A+SDMVD H++T+F++L
Sbjct  268  VLSLGTGMAKNEEKYTAAAANQWGSLGWVYNKGATPLLDVFGAATSDMVDIHVSTLFQSL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQE+ L G ASSVDV TTEN+  L QIG +LL+K VS++++ T + E ++G 
Sbjct  328  GSEKNYLRIQEEGLTGDASSVDVATTENMETLVQIGNSLLQKPVSRVNLETGRSEAVQGE  387

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
            GTN++AL +FAKLLSDE+K R+A
Sbjct  388  GTNEEALTQFAKLLSDERKLRLA  410



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DANG    +NLVDGGVAANNPTL A+  +T+  + K+ K L      +P    +FL
Sbjct  199  FETKDANGNIRSFNLVDGGVAANNPTLAAMGLITKE-ICKENKHLF---PIKPTDYGKFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K++A++A+ WG+LGWL      PLI+VF+ AS+DMVD H + +F+AL
Sbjct  255  VISLGTGSAKIEEKFSAQEASKWGILGWLYDHGATPLINVFTQASADMVDIHTSAVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + +NYLRIQ+D L GS SSVD++T ENL  L QIG +LLKK VS++++ T  +E +EG 
Sbjct  315  YSKENYLRIQDDTLIGSTSSVDISTKENLLKLVQIGNDLLKKHVSRVNLETGLFELVEGE  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL  FAKLLS+E++ R
Sbjct  375  GTNEEALTHFAKLLSEERRLR  395



>ref|XP_006466736.1| PREDICTED: patatin-11-like [Citrus sinensis]
Length=391

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 144/207 (70%), Gaps = 7/207 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E+NL+DGGVAANNPTLVA+S +T+ ++ K+P F   N    P+   RFL
Sbjct  188  FKNPDEHGTLKEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDFCPIN----PLDYTRFL  242

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK A+ WG++ WL      PL+D +  A  DMVDYH++ +F+AL
Sbjct  243  VISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDMVDYHISVVFQAL  302

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE--  534
             + DNYLRI++D L+G  +S+D+TT EN   L + G+ LLKK VS++++    YEPIE  
Sbjct  303  QSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRAGETLLKKPVSRINLDAGLYEPIENG  362

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAAS  615
             AGTN++ALKRFAK+LSDE+K R + S
Sbjct  363  SAGTNEEALKRFAKMLSDERKLRESKS  389



>ref|XP_002451118.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
 gb|AAD22170.1|AF061282_24 patatin-like protein [Sorghum bicolor]
 gb|EES10106.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
Length=410

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 139/201 (69%), Gaps = 3/201 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T    G   EY+LVDGGVAANNPT+VA+S +T+ +  ++P F   N   +P     +L
Sbjct  206  FKTEATGGRSREYHLVDGGVAANNPTMVAMSMLTKEVHRRNPDF---NVVGRPTEYTNYL  262

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KYTA+Q A WG++ WL  G   P+ID+FS ASSDMVD H + +F+AL
Sbjct  263  VISVGTGSAKQAEKYTAEQCAKWGLIQWLYHGGFTPIIDIFSHASSDMVDIHASVLFQAL  322

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D+L G ASSVD+ T EN+ +L  IG+ LLKK V++++I T  YE   G 
Sbjct  323  HCEKNYLRIQDDSLTGDASSVDIATKENMESLIGIGQELLKKPVARVNIDTGVYESCSGE  382

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  383  GTNAEALAHFAKQLSDERKLR  403



>gb|AAF98369.1|AF158253_1 patatin-like protein 3 [Nicotiana tabacum]
Length=411

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++LVDGG+AANNPTL+A++ ++++++T + ++       + + C + L
Sbjct  212  FETKDAEGKTRTFDLVDGGLAANNPTLMAMTHISKQIMTGNFQY----EDMEKMDCKKVL  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT K+  KY A  A+ WG+LGW+      PLIDV++DAS+DMVD H++T+F+ L
Sbjct  268  VLSLGTGTGKHEEKYNATIASRWGMLGWIYNNGATPLIDVYADASADMVDIHVSTMFQTL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ T EN+  L QIG +LLKK VS++++ T +YEP+   
Sbjct  328  ASEKNYIRIQDDNLTGEAASMDIATIENMGRLVQIGNDLLKKPVSRVNLETGRYEPVVAE  387

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN+ A+ RFA+LLS+E+K R+
Sbjct  388  GTNEAAIIRFAQLLSEERKLRL  409



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+ G   ++NL+DGGV ANNPTLVA++ VT++++  +P F     S +P+   RFL
Sbjct  200  FNNKDSEGNMHQFNLIDGGVCANNPTLVAMNQVTKQILNDNPDFF----SIKPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGT K   K+ A+ AA WG+L WL+     PLIDVF+ +S+DMVD+HLAT+ +AL
Sbjct  256  IISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSADMVDFHLATVTQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+  SVD+ T ENL  L QIG+ LLKK VS++++    +EP+   
Sbjct  316  HSENNYLRIQDDTLTGTDYSVDIATKENLEKLSQIGERLLKKPVSQINLEDGLFEPVGNG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+DALKRFAK+L  E++ R
Sbjct  376  ETNEDALKRFAKILLKERRLR  396



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 144/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPT VA+  VT+ ++     F       +P+   RFL
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    Y A++AA WGVLGWLS   G+PL+DVF  AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSAVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L GS +SVD+ T +NLN L + G+ LLKK VSK+D+ T Q+   +  
Sbjct  314  HLEANYLRIQDDTLSGSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNACK-L  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS+E++ R A S
Sbjct  373  ETNEEALRRFAKLLSNERQLRHARS  397



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D N  + E+NL+DGGV ANNP LVA++ VT++++ + P F       +P+   RFL
Sbjct  202  FTNKDPNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSPDFF----PIKPLEYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTGTAK   K++A  AA WG+LGWL+    NPLIDVF+ +S DMVD+HL+ + +AL
Sbjct  258  IISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G  SSVD+ T ENL  L +IG  LLKK VS++++    +EP+   
Sbjct  318  HSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVIDG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN+ ALKR AK LS E++ R
Sbjct  378  ETNEQALKRLAKTLSQERRLR  398



>tpg|DAA42304.1| TPA: hypothetical protein ZEAMMB73_137328 [Zea mays]
Length=333

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T    G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  130  FKTEATEGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  185

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  186  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  245

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  246  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  305

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSD +K R
Sbjct  306  GTNAEALAHFAKKLSDVRKLR  326



>ref|XP_008393828.1| PREDICTED: patatin-like protein 2 isoform X2 [Malus domestica]
Length=408

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   ++NL+DGGVAANNPTL+A+  VT+ +++    F       +P+   RFL
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFF----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A  AA WG+L WL+ G G P+IDVFS +SSDMVDYHL+ +F+AL
Sbjct  255  VISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  SSVD+   +NL+ L ++G+ LLKK VS++++ T + EP +  
Sbjct  315  HSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             +N++AL RFAKLLS+EK+ R+A S 
Sbjct  375  -SNEEALTRFAKLLSEEKRLRLAKSP  399



>gb|EPS59074.1| hypothetical protein M569_15736, partial [Genlisea aurea]
Length=355

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = +1

Query  16   ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIG  195
            + G   ++NL+DGGVAANNP L A+  VT ++  +D  F    S  Q +   +FL++S+G
Sbjct  162  SGGDSWDFNLIDGGVAANNPALAAIREVTNQLYKQDRSF----SHYQTLDYTKFLVISLG  217

Query  196  TGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDN  375
            TG+ K   KYTAK+AA W VLGWL  G+  P+I+VFS AS DMVDY L+ +F+A ++ DN
Sbjct  218  TGSDKQEQKYTAKEAAQWSVLGWLIHGNSVPIIEVFSQASVDMVDYFLSVVFQAFHSQDN  277

Query  376  YLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQD  555
            YLRIQ+D L G  SS DV T +N++ L  IG++LLKK+VS+ D+ T  YE I   GTN+D
Sbjct  278  YLRIQDDALPGDNSSSDVATKKNMDDLVGIGEDLLKKSVSRFDLQTGNYEAIPKGGTNED  337

Query  556  ALKRFAKLLSDEKKRR  603
            ALKRFAKLLSDE+K R
Sbjct  338  ALKRFAKLLSDERKLR  353



>ref|XP_009589625.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=411

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++LVDGG+AANNPTL+A++ ++++++T + ++       + + C + L
Sbjct  212  FETKDAEGKTRTFDLVDGGLAANNPTLMAMTHISKQIMTGNFQY----EDMEKMDCKKVL  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT K+  KY A  A+ WG+LGW+      PLIDV++DAS+DMVD H++T+F+ L
Sbjct  268  VLSLGTGTGKHEEKYNATIASRWGMLGWIYNNGATPLIDVYADASADMVDIHVSTMFQTL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ T EN+  L QIG +LLKK VS++++ T +YEP+   
Sbjct  328  ASEKNYIRIQDDNLTGEAASMDIATIENMERLVQIGNDLLKKPVSRVNLETGRYEPVVAE  387

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN+ A+  FA+LLS+E+K RI
Sbjct  388  GTNEAAIIHFAQLLSEERKLRI  409



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP L+A+S V++ +   +P F       +P+   RFL
Sbjct  198  FKVEDTKGNFKEHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFY----PIKPMEYGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AKY  KY +  AA WG+L WL     NPLI+VF+ +S+DMVDYH + +F+AL
Sbjct  254  VISLGTGAAKYEQKYNSSMAAKWGILEWLLNKGSNPLIEVFTQSSADMVDYHNSVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + D+YLRIQED L G+ +SVDV T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  314  RSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPKG  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++ALKRFA LL +E++ R + S 
Sbjct  374  GTNEEALKRFATLLVNERRLRESKSP  399



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D  G+  E+NL+DGG+AA+NPTLVA+S VT+++  K+P F    S  +PI     L
Sbjct  200  FVNQDDQGSTREFNLIDGGLAASNPTLVAISEVTKQVTNKNPDF----SPFKPIDYGSLL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+G+G+ K   KY AK AA WG+LGWL      PL+D F+ AS+DMVDYH A +F+AL
Sbjct  256  VISVGSGSPKQEHKYNAKMAAKWGILGWLYNNGSTPLVDSFTQASADMVDYHNAVVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               +NYLRI E  L G  +S D+ T +N+N L ++G+ LLKK VS++++ T +YE I+  
Sbjct  316  GCQENYLRIDEATLTGDLASTDIATKKNMNELVKVGEELLKKPVSRVNLDTGEYEAIKNG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL+RFAKLLSDE+K R
Sbjct  376  GTNEEALRRFAKLLSDERKLR  396



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 144/202 (71%), Gaps = 2/202 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T + +G   E+NL+DG +AANNPT +A++ VT+++  + P F  +    +P    +FL
Sbjct  199  FQTQNEDGKFQEFNLIDGAIAANNPTFIAINEVTKQIFEQTPYFK-NFDEMKPANYGKFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+ GWLS G  NP+ID F+DAS+DMVDYH++ +F+ +
Sbjct  258  VISIGTGSAKLVHKYDAKIASNWGIFGWLSDGGSNPIIDAFADASNDMVDYHISVVFQCV  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
             +   YLRIQ+D L G   SVD++T EN++ L +IG NLLKK VS++++ T  +EP+   
Sbjct  318  CSQKQYLRIQDDTLSGEDFSVDISTKENMDKLVEIGTNLLKKPVSRVNLKTCLFEPLGTT  377

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++ALK FAKLLS+EKK R
Sbjct  378  GGTNEEALKEFAKLLSEEKKFR  399



>ref|XP_004232051.1| PREDICTED: patatin-like protein 3 [Solanum lycopersicum]
Length=412

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++LVDGGVAANNPTL+A++ V+++++T + ++       + + C++ L
Sbjct  214  FETKDAQGKTRTFDLVDGGVAANNPTLMAITYVSKQIMTGNFQY----EGMKNMDCNKML  269

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY A  A+ WG++GW+      PLID++ DAS+DMVD H +T+F+ L
Sbjct  270  VLSLGTGIGKQEEKYNATVASRWGMVGWVYNNGATPLIDIYGDASADMVDIHTSTMFQTL  329

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ TT+N+  L QIG +LLKK +S++++ T +YEP+ G 
Sbjct  330  GSEKNYIRIQDDNLTGEAASMDIATTQNMETLVQIGNDLLKKPISRVNLETGRYEPVVGE  389

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN+ A+ RFA+LLS+E+K RI
Sbjct  390  GTNEAAIVRFAQLLSEERKLRI  411



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    +NLVDGGVAANNPTLVA+S V + ++ K+  F    S  +P+   +FL
Sbjct  199  FETKDAKGNTRSFNLVDGGVAANNPTLVAISEVMKEILKKNEDF----SPFKPMDYGKFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +++A++A+ WGVLGWL      PLID+F  AS+DMVD H + +F+AL
Sbjct  255  VISLGTGSAKNEERFSAQKASKWGVLGWLYNNGATPLIDIFKQASADMVDIHASVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+DNL G ASSVD++T ENL  L QIGK+LLKK VS++++ T   E +   
Sbjct  315  HSTGNYLRIQDDNLTGKASSVDISTDENLLRLMQIGKDLLKKRVSRVNLETGLSEEVSED  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++ L  FAKLLSDE++ R
Sbjct  375  ETNEEELMHFAKLLSDERRLR  395



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 143/203 (70%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+ +DA G + E+NL+DGG+AANNPTLVA+S VT++++ K+P F       +P+   RFL
Sbjct  202  FKNSDAQGNEREFNLIDGGIAANNPTLVAVSEVTKQVMKKNPDFF----PIKPMDYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    Y AK A+ WGV GWL      PLI   + AS+DMVD+H + +F+AL
Sbjct  258  VISLGTGSDKNEHTYNAKMASKWGVFGWLYYKGSTPLIKAVNQASADMVDFHNSVVFQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSV   T +NL+ L ++G+ LLKK V ++++ +  +EP+E  
Sbjct  318  HSDDNYLRIQDDALTGTLSSVATATKQNLDNLVKVGEELLKKPVLRVNLTSGDHEPVENG  377

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
            GTN DAL RFAKLLSDE+K R A
Sbjct  378  GTNMDALTRFAKLLSDERKLRDA  400



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 140/205 (68%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+ GGVAANNPTLVA+  V + ++     F   N    P+   RFL
Sbjct  198  FETQDPTGKVREFNLIVGGVAANNPTLVAMGEVRKEIIGGSSDFFPIN----PMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A +AA WGVL WLS   G+PLIDV   AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMVDFHLSVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D L G+ +SVD+   +N+N L + G+ LLKK VS++++ T +YEP    
Sbjct  314  LIEANYLRIQDDTLSGAVASVDIAMKKNMNDLVKTGEALLKKPVSRVNLETGRYEPTPNQ  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS E++ R+A S
Sbjct  374  ETNEEALRRFAKLLSQERQLRLARS  398



>ref|XP_010664584.1| PREDICTED: patatin-like protein 2 isoform X2 [Vitis vinifera]
 emb|CBI19548.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++   P F       +P+   RFL
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A +AA WGVLGWL+ G   PL+ VF+ AS DM+D HL+ +F+AL
Sbjct  256  VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSELFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D LRG  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  316  HSEKSYLRIQDDTLRGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEP-SNH  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  FA+LLS EK+RR
Sbjct  375  ETNEEALTSFARLLSQEKQRR  395



>ref|XP_006466737.1| PREDICTED: patatin-14-like [Citrus sinensis]
Length=402

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  D +G   E+NL+DGGVAANNPTLVA+  VT+ ++ K+P F   N    P+   RFL
Sbjct  199  FENPDDHGTLKEFNLIDGGVAANNPTLVAICEVTKHIL-KNPDFCQIN----PLDYTRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ +   KY AK A+ WGV+ WL      PL+D +  A  DMVDYH++ +F AL
Sbjct  254  VISLGTGSKRSEHKYNAKMASRWGVINWLYDNGDTPLLDCYGQAIGDMVDYHISVVFHAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIE--  534
             + DNYLRI +D L+G  SS+D+TT EN   L + G+ LLKK VS++++ T  YEPIE  
Sbjct  314  QSEDNYLRIDDDTLQGDLSSIDLTTPENSENLVRAGEALLKKPVSRINLDTGLYEPIENG  373

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAASA  618
             AGTN++ALKRFAK+LSDE+K R + S+
Sbjct  374  SAGTNEEALKRFAKMLSDERKLRESKSS  401



>ref|XP_009367377.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=401

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D NG   E+NL+DGGVAANNPTLVA+  VT++++   P F       +P+   R+L
Sbjct  199  FETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDFF----PIKPMDYGRYL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY+A  AA WG+L WL+ G   P+IDVFS  S+DMVD +L+ +F+AL
Sbjct  255  VISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D LRG  SSVD+ T +NL+ L ++G+ LLK+ VS++++ T ++E     
Sbjct  315  HSEKNYLRIQDDKLRGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLDTGKFEACNHE  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL RFAKLLS+EK+ R+A S 
Sbjct  375  -TNEEALIRFAKLLSEEKRLRLAKSP  399



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP L+A+S V++ ++  +P F       +P+   RFL
Sbjct  198  FKVEDGKGNVKEHHLIDGGVAANNPALIAVSEVSKEILKDNPDFF----PIKPMDYGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK+  KY A   A WG++ WL      PLI+VF+ +S+D+VDYH + +F+AL
Sbjct  254  VISIGTGSAKWEHKYNASMTAKWGIVDWLFHKGSTPLIEVFTQSSADLVDYHNSVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               DNYLRIQED L G+ +SVD+ T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  314  RCDDNYLRIQEDELNGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLAEPIPKG  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFA+LL +E++ R
Sbjct  374  GTNEEALKRFARLLVNERRLR  394



>gb|KHG27256.1| Patatin group M-3 [Gossypium arboreum]
Length=412

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+    NG   EYNL+DGGVAANNPTLVA+  V++ ++  +P F       +P+   +FL
Sbjct  198  FKIQTDNGDVREYNLIDGGVAANNPTLVAMGEVSKEIIKGNPDFF----PTKPMDYGKFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   +Y AKQ+A WG+LGWL+ G   PL+DVF+ AS DMVD HL+ +F AL
Sbjct  254  VISLGTGSKKDEKRYNAKQSAKWGMLGWLTSGGSTPLVDVFTQASGDMVDLHLSVVFEAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G  SSVD+ T  NLN L ++G+ LLKK VS++++ T  +EP +  
Sbjct  314  HS-DKYLRIQDDGLSGDVSSVDIATANNLNELVKVGEGLLKKQVSRVNLETGIFEPFK-E  371

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++ALKRFAKLLS E+ RR
Sbjct  372  ETNEEALKRFAKLLSQERHRR  392



>ref|NP_001151996.1| patatin T5 [Zea mays]
 gb|ACG45309.1| patatin T5 precursor [Zea mays]
Length=407

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  204  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  260  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSV + T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  320  HCEKNYLRIQDDTLIGNTSSVVIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  379

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  380  GTNAEALAHFAKKLSDERKLR  400



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            FET  ++G KV ++NL+DGGVAANNPT+VA+S VT+ ++  +P F       +P+   RF
Sbjct  197  FETKGSHGTKVRKFNLIDGGVAANNPTIVAISEVTKEILKGNPDFF----PIKPMDYGRF  252

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG+ K   KY+AK AA WG+LGWL      PL+DVF+ AS DMVD+ ++ +F+A
Sbjct  253  LVISLGTGSPKKDEKYSAKMAAKWGILGWLLSRGSTPLVDVFTQASGDMVDFQISVVFQA  312

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L++  NYLRIQ+D L  + +SVD+ T ENL  L ++G+ LLKK VS++++ T     IE 
Sbjct  313  LHSEINYLRIQDDTLNETLASVDIATKENLENLVKVGEALLKKPVSRVNLETGSCVHIES  372

Query  538  AGTNQDALKRFAKLLSDEKKRRIAAS  615
             GTN+ ALKRFAKLLS+E++ R A S
Sbjct  373  EGTNEQALKRFAKLLSNERRVREARS  398



>ref|XP_009617802.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=343

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 143/206 (69%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP L+A+S V++ ++  +P F       +P+   RFL
Sbjct  127  FKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEILKDNPDFF----PIKPMDYGRFL  182

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK+  KY A  AA WG++ WL      PLI+VF  +S+D+VDYH + +F+AL
Sbjct  183  VISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQAL  242

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQED L G+ +SVD+ T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  243  HSDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKG  302

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN++AL RFA+LL +E++ R + S 
Sbjct  303  GTNEEALIRFARLLVNERRLRESRSP  328



>ref|NP_001068268.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|ABA94817.1| Patatin-like phospholipase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28631.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|EAZ18421.1| hypothetical protein OsJ_33950 [Oryza sativa Japonica Group]
 dbj|BAG86724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+TTD ++G   E++L+DGGVAANNPT+VA+S +++ ++ ++  F L     +P     +
Sbjct  213  FKTTDVSSGKSREFHLIDGGVAANNPTMVAMSMISKEVLRENQDFKLG----KPADYKHY  268

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++SIGTGTAK   KYTA   A WGVL WL  G   PLID+F+ AS+DMVD H + +F++
Sbjct  269  LVISIGTGTAKMAEKYTAPACAKWGVLRWLYDGGFTPLIDIFTHASADMVDIHASVLFQS  328

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L    +YLRIQ+D+L G  SSVD+ T EN+ AL +IGK+LL K V++++I T  YEP++G
Sbjct  329  LCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKIGKDLLTKRVARVNIDTGVYEPVDG  388

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++AL RFAK LS+E++ R
Sbjct  389  EGTNEEALARFAKKLSEERRLR  410



>ref|XP_004980751.1| PREDICTED: patatin group D-2-like [Setaria italica]
Length=311

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 133/202 (66%), Gaps = 7/202 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T   +G   E++LVDGGVAANNPT+VA+S +T+ ++  +P F       +P     FL
Sbjct  111  FRTEGPSGKSREFHLVDGGVAANNPTMVAMSMLTKEVLRHNPDF-------RPAEYGNFL  163

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG  K    YTA + A WG+L WL  G   PLID+F  AS+DMVD H   +F AL
Sbjct  164  IISVGTGAPKQAEMYTAPKCAKWGLLRWLYDGGFTPLIDIFCHASADMVDIHAKVLFEAL  223

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRIQ+D+L G  SSVD+ T EN+ AL +IG+ LLKK V++++I T  YEP+ G 
Sbjct  224  GCEKNYLRIQDDSLVGHTSSVDIATKENMEALIRIGRELLKKPVARVNIDTGMYEPVAGE  283

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            G N+ AL+RFA+ LSDE K R+
Sbjct  284  GNNEQALERFARKLSDELKLRM  305



>ref|XP_007017307.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14532.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=410

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 142/201 (71%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D  G   EYNL+DGGVAANNPTLVA+  V++ ++  +  F       +P+   RFL
Sbjct  198  FKTEDQKGNVREYNLIDGGVAANNPTLVAMGEVSKEIIKGNADFF----PIKPMDYGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   K++A++AA WG+LGWL+ G   PL+DVF+ AS DMVD HL+ +F AL
Sbjct  254  VISLGTGSRKAEEKFSAQEAAKWGLLGWLTSGGSTPLVDVFTQASGDMVDLHLSVVFEAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G  SSVDV T ENLN L ++G+ LLKK VS++++ T  +EP    
Sbjct  314  HS-DKYLRIQDDTLSGVVSSVDVATKENLNELVKVGQALLKKQVSRVNLETGIFEPF-SE  371

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++ALKRFA LLS E++RR
Sbjct  372  ETNEEALKRFATLLSQERQRR  392



>tpg|DAA42305.1| TPA: hypothetical protein ZEAMMB73_127435 [Zea mays]
Length=556

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  353  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  408

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG+  WL  G   P+ID+FS ASSDMVD H A +F+AL
Sbjct  409  IISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFQAL  468

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G+ SSVD+ T EN+ +L  IG++LLKK V++++I T  YEP  G 
Sbjct  469  HCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGIGQDLLKKPVARVNIDTGVYEPCSGE  528

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  529  GTNAEALAHFAKKLSDERKLR  549



>gb|EAY88437.1| hypothetical protein OsI_09902 [Oryza sativa Indica Group]
Length=417

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+TTD ++G   E++L+DGGVAANNPT+VA+S +++ ++ ++  F L     +P     +
Sbjct  213  FKTTDVSSGKSREFHLIDGGVAANNPTMVAMSMISKEVLRENQDFKLG----KPADYKHY  268

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++SIGTGTAK   KYTA   A WGVL WL  G   PLID+F+ AS+DMVD H + +F++
Sbjct  269  LVISIGTGTAKMAEKYTAPACAKWGVLRWLYDGGFTPLIDIFTHASADMVDIHASILFQS  328

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L    +YLRIQ+D+L G  SSVD+ T EN+ AL +IGK+LL K V++++I T  YEP++G
Sbjct  329  LCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKIGKDLLTKRVARVNIDTGVYEPVDG  388

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++AL RFAK LS+E++ R
Sbjct  389  EGTNEEALARFAKKLSEERRLR  410



>ref|XP_009773110.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=417

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ V + M+  + KF  +    + + C R L
Sbjct  212  FETKDAQGKTHTFDLIDGGVAANNPTLMAMTHVIKEMM--NGKFQYEGV--KTMDCKRML  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K+  KY A  A+ WG+LGW+     +PLIDV+ DAS D+VD HL+TIF++ 
Sbjct  268  VLSLGTGIGKHEEKYNAASASKWGLLGWMYNNGASPLIDVYGDASVDIVDIHLSTIFKSF  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQ+DNL G A+++DV T EN+  L +IG +LLKK VS++++ T +YE + G 
Sbjct  328  GSEKNYLRIQDDNLTGDAANMDVATKENMETLVKIGNDLLKKPVSRVNLETGRYEAVHGE  387

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++A+ RF KLLS+E+K R
Sbjct  388  GTNEEAIIRFVKLLSEERKLR  408



>ref|XP_002449852.1| hypothetical protein SORBIDRAFT_05g024390 [Sorghum bicolor]
 gb|EES08840.1| hypothetical protein SORBIDRAFT_05g024390 [Sorghum bicolor]
Length=405

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  205  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  260

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG++ WL  G   P+ID+FS ASSDMVD H A +F AL
Sbjct  261  IISVGTGSAKQAEKYTAPQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFEAL  320

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G  SSVD+ T EN+ +L  IG+ LLKK V++++I T  YE   G 
Sbjct  321  HCEKNYLRIQDDTLTGDTSSVDIATKENMESLIGIGQELLKKPVARVNIDTGVYESCSGE  380

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  381  GTNAEALAHFAKKLSDERKLR  401



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 142/206 (69%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D NG K E+NL+DGGV ANNPTLVA++ V+++++  +P    D  +  P+G   FL
Sbjct  192  FVNEDINGKKTEFNLIDGGVTANNPTLVAMTAVSKQIIMNNP----DMGNMNPLGYDHFL  247

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY A +++ WG+L WL +   +P+ID +S++SSDMV YH++  F+AL
Sbjct  248  VVSIGTGSAKKEEKYNATKSSKWGILSWLYEDGSSPIIDCYSESSSDMVHYHISVAFQAL  307

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRI +D L G  SS+D++T  NL  L +IG+ +LK  V K++I T +YEP+   
Sbjct  308  DSQENYLRIDDDTLEGDTSSLDISTKANLENLVKIGEKMLKNRVEKMNIETGKYEPVPDD  367

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN+  LKRFAK+LSDE K R + S 
Sbjct  368  ITNEQELKRFAKILSDEMKLRKSRSP  393



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 144/206 (70%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  DA G   E+NL+DGG+AANNPTLVA+S V+++M  K+P F       +P    R+L
Sbjct  199  FKNQDAQGNFEEFNLIDGGIAANNPTLVAISEVSKQMSKKNPDFF----PIKPTNYERYL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG  + G+ Y+AK A+ WGV+GWL      PLI  +++ASSDMVDYH + +F+A 
Sbjct  255  VISIGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDYHNSVVFQAF  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ + YLRI ED L+G   SVD+ T ENL  L ++G++LLK  VS++++ T  YEP+E  
Sbjct  315  HSENYYLRIDEDKLQGDLYSVDIATKENLENLVKVGEDLLKSPVSRINLDTGGYEPVEDG  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             T ++AL+RFAKLLS+E+K R + SA
Sbjct  375  VTYEEALQRFAKLLSEERKLRQSNSA  400



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 144/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPT VA+  VT+ ++     F       +P+   RFL
Sbjct  198  FETQDSTGKIREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    Y A++AA WGVLGWLS   G+PL+DVF  AS+DMVD+HL+++F+AL
Sbjct  254  VISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMVDFHLSSVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L  S +SVD+ T +NLN L + G+ LLKK VSK+D+ T Q+   +  
Sbjct  314  HLEANYLRIQDDTLSDSVASVDIATKKNLNDLVKTGEALLKKPVSKVDLETGQHNACK-L  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN++AL+RFAKLLS+E++ R A S
Sbjct  373  ETNEEALRRFAKLLSNERQLRHARS  397



>ref|XP_008393827.1| PREDICTED: patatin-like protein 2 isoform X1 [Malus domestica]
Length=407

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   ++NL+DGGVAANNPTL+A+  VT+ +++    F       +P+   RFL
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFF----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A  AA WG+L WL+ G G P+IDVFS +SSDMVDYHL+ +F+AL
Sbjct  255  VISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  SSVD+   +NL+ L ++G+ LLKK VS++++ T + EP +  
Sbjct  315  HSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             +N++AL RFAKLLS+EK  R+A S 
Sbjct  375  -SNEEALTRFAKLLSEEKWLRLAKSP  399



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 144/207 (70%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+T D    +  E+NL+DGGVAANNPTLVA+  VT+ ++ + P F     + +P+   RF
Sbjct  195  FKTEDTAAKETREFNLIDGGVAANNPTLVAIGEVTKEVIKQTPDFF----AIKPMDYRRF  250

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG  K   +YTA+ AA WG+L WL+ G   P+IDVFS ASSDMVD HL+ IF+A
Sbjct  251  LVISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDMVDLHLSVIFQA  310

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L+  +NYLRIQ+D L G  SSVDV T +NLN L ++G++LLKK VS++++ T  +E    
Sbjct  311  LHCEENYLRIQDDTLSGDLSSVDVATEKNLNDLVKVGESLLKKQVSRVNLQTGIFEDCPS  370

Query  538  -AGTNQDALKRFAKLLSDEKKRRIAAS  615
             + TN  AL RFAKLLSDE++ R A S
Sbjct  371  NSETNDQALTRFAKLLSDERRLRHARS  397



>emb|CAA73328.1| patatin-like protein [Cucumis sativus]
Length=405

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRM-VTKDPKFLLDNSSKQPIGCHRF  177
            F+T D+ G    Y +VDGGVAANNPTL A++ VT+ M + +    LL     +P+   R 
Sbjct  204  FQTKDSKGNIRNYEMVDGGVAANNPTLAAMTHVTKEMSILRHRSELL---KIKPMETERM  260

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTGT K   KY+A +A+ WG+L W+  G G P++D+FSDAS+DMVDYH+++IF++
Sbjct  261  LVLSLGTGTPKNDEKYSAAKASKWGMLDWVYHGGGTPIVDIFSDASADMVDYHISSIFQS  320

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
             +   NYLRIQ+D L G  SSVD+ T ENL  L  +G+NLLKK +S++++ + ++EP++ 
Sbjct  321  DHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLIYVGENLLKKPLSRVNLESGKFEPLDA  380

Query  538  AGTNQDALKRFAKLLSDEKKRRIA  609
             GTN+ AL  FAK+LS+E+K R++
Sbjct  381  KGTNEQALAEFAKMLSNERKLRLS  404



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 139/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F   DA G  + E+NL+DGG+AANNPTLVA+  VT++ + K      D ++  P+   RF
Sbjct  199  FTKQDAEGKVIKEFNLIDGGLAANNPTLVAIREVTKQTIRKP-----DETTISPLDYDRF  253

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTG+     KY AK  + WG+L WL      P+ID FS+AS+DMVDYH   +F +
Sbjct  254  LVLSLGTGSNMSEHKYNAKMVSNWGILTWLFNSGSTPIIDCFSEASTDMVDYHNVVVFSS  313

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L + DNYLRIQE+ L+G  +SVD+ TTENLN L ++G+NLLKK V+++++ T  YEP   
Sbjct  314  LQSEDNYLRIQENTLKGDLASVDIATTENLNNLVKVGENLLKKTVTRVNLDTGLYEPAPD  373

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++ALKRFAK LS+ +K +
Sbjct  374  KGTNEEALKRFAKSLSEARKNK  395



>gb|AAD22169.1|AF061282_23 patatin-like protein [Sorghum bicolor]
Length=422

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T   +G   E++LVDGGVAANNPT+VA+S +T+ ++ ++P F    ++ +P     +L
Sbjct  222  FKTEATDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDF----NAGRPTEYTNYL  277

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+S+GTG+AK   KYTA Q A WG++ WL  G   P+ID+FS ASSDMVD H A +F AL
Sbjct  278  IISVGTGSAKQAEKYTAPQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHAAVLFEAL  337

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G  SSVD+ T EN+ +L  IG+ LLKK V++++I T  YE   G 
Sbjct  338  HCEKNYLRIQDDTLTGDTSSVDIATKENMESLIGIGQELLKKPVARVNIDTGVYESCSGE  397

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN +AL  FAK LSDE+K R
Sbjct  398  GTNAEALAHFAKKLSDERKLR  418



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DG +AANNPTL+A S VT+++  ++  F       +P    RFL
Sbjct  202  FQTQDKDGKVQEFNLIDGAIAANNPTLIATSEVTKQIYAENKDFF----PIKPSDHGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   K+ AK AA WG+LGWL++G  NP+IDVF+    DMVDY+ +  F+AL
Sbjct  258  VISIGTGSAKLEQKFNAKMAAKWGLLGWLTKGGSNPIIDVFTQGGDDMVDYYNSVAFQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + D+YLRIQ+D L G  SSVD+ T EN+  L +IG+NLLKK VS++++    +EP E  
Sbjct  318  RSQDHYLRIQDDTLSGIDSSVDIATKENMAKLVEIGENLLKKPVSRINLKKGIFEPHETG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ LKRFA  LS+EK+ R
Sbjct  378  GTNEETLKRFATKLSEEKRLR  398



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D+ G   ++NL+DGGV ANNPTLVA++ VT++++ ++  F       +P+   RFL
Sbjct  201  FTNQDSQGNLHQFNLIDGGVCANNPTLVAMNEVTKQIIKQNSDFF----PIKPLEYSRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTGTA+   K+  + AA WG+L WL+     PL DVF+ +S+DMVD+HL+ + +AL
Sbjct  257  IISIGTGTARNEEKFNGETAAKWGLLDWLTYNGSTPLTDVFTQSSADMVDFHLSAVTQAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD+ T ENL  L +IG+NLLKK+VS++++    +EP+   
Sbjct  317  HSEDNYLRIQDDTLSGTESSVDIATKENLQKLSEIGQNLLKKSVSRVNLENGLFEPLANG  376

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TNQ AL RFAK+LS E++ R
Sbjct  377  ETNQHALTRFAKILSQERRLR  397



>ref|XP_008457873.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=392

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 146/207 (71%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSK----QPIGC  168
            F+T D+ G    +++VDGGVAANNPTL AL+ VT+ M       +L N S+    +P+  
Sbjct  191  FQTKDSKGNTRNFDMVDGGVAANNPTLAALTHVTKEMS------ILRNRSELLKIKPMEA  244

Query  169  HRFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATI  348
             R LILS+GTG AK   KY+A  A+ WG+LGW+      P++D+FSDAS+DMVDYH+++I
Sbjct  245  KRMLILSLGTGVAKNDEKYSAAIASKWGMLGWIYHRGATPIVDIFSDASADMVDYHISSI  304

Query  349  FRALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEP  528
            F++ +   NYLRIQ+D L G  SSVD+ T +NL  L ++G+NLLKK +S++++ +  +EP
Sbjct  305  FQSEHNQKNYLRIQDDTLSGDVSSVDIATQQNLLKLIEVGENLLKKPLSRVNLESGNFEP  364

Query  529  IEGAGTNQDALKRFAKLLSDEKKRRIA  609
            ++G GTN+ AL  FA++LSDE+K R++
Sbjct  365  LDGEGTNEKALADFAQMLSDERKLRLS  391



>ref|XP_009589751.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=412

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ V++ + T+     ++    +   C + L
Sbjct  211  FETKDAEGKIRTFDLIDGGVAANNPTLMAITHVSREIKTRK----MEYEDMKTADCKKML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT     KY A+ A+ WGVLGW+     +PL+D+FSDAS+D+VD H++T+F++L
Sbjct  267  VLSLGTGTGTNKEKYNARSASRWGVLGWMYNNGASPLLDIFSDASTDVVDIHVSTMFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ D L G A+S D++T +N+  L Q+GK+LLKK VS++++ T ++E + G 
Sbjct  327  HNEKNYLRIQNDTLTGEAASTDISTMKNMQTLVQVGKDLLKKPVSRVNLDTGRFEAVHGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+ AL RFAKLLS+E+K R
Sbjct  387  GTNEQALIRFAKLLSEERKLR  407



>gb|KJB58443.1| hypothetical protein B456_009G210300 [Gossypium raimondii]
Length=322

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 139/201 (69%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D+ G   E+NL+DGGVAANNPTLVA++ VT+ ++  +P+F       +P    RFL
Sbjct  102  FQTQDSTGKTKEFNLIDGGVAANNPTLVAMNEVTKEILRGNPEFF----PIKPTDYARFL  157

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   KY A  AA WGVLGWL+     PL+D+F  ASSDMVD+H+AT+F+AL
Sbjct  158  VVSLGTGSPKSEGKYHANMAAKWGVLGWLTSEHSTPLVDIFMQASSDMVDFHIATVFQAL  217

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + ++YLRIQ+D L    SSVD+ T ENL  L ++G+ LL K+VS++++   Q+EP  G 
Sbjct  218  QSENSYLRIQDDTLSQQISSVDIATKENLENLVKVGEELLNKSVSRVNLENGQFEP-AGK  276

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN +AL R A +LS EK+ R
Sbjct  277  VTNGEALIRLAAVLSKEKQLR  297



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  D      E+NL+DGG+AANNP LVA+S VT+++  K+P F       +P+   RFL
Sbjct  201  FENQDDQENNEEFNLIDGGLAANNPCLVAISEVTKQVFNKNPDFF----PIKPMDYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KYTAK AA WGVLGWL   +G+ L+     AS+DMVD+H   +F AL
Sbjct  257  VISVGTGSAKEEYKYTAKMAAKWGVLGWLYD-NGSTLLSPRVSASADMVDFHNCVVFEAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRI +D L+G+ +SV++ T +NL++L ++G+ LLKK VS++++ T +YEPI+  
Sbjct  316  HSEENYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKNG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAKLLSDEK+ R
Sbjct  376  GTNEEALIRFAKLLSDEKRLR  396



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 142/206 (69%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FETTD++G    YNL+DGG+AANNPTLVA+S + + +   +  F    ++ + I  H+F+
Sbjct  211  FETTDSDGKSHSYNLIDGGIAANNPTLVAMSQIKKEIALTNKNF----ANFKSIDYHKFI  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            I+SIGTG+AK   K++A  A+ WGVL WL  G  NPLID F   S+D+VD H++++F++L
Sbjct  267  IISIGTGSAKVEQKFSAHLASKWGVLQWLYHGGSNPLIDSFFQGSADVVDIHMSSLFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N   NYLRIQ+D L G  SSVDV+T ENL  L QIGKNLL K VS++++ T  ++ I+  
Sbjct  327  NCEKNYLRIQDDTLMGERSSVDVSTKENLLELVQIGKNLLNKKVSRVNLETGIFQEIDEE  386

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            GTN DAL + AK LS E++ R A  A
Sbjct  387  GTNADALTQLAKRLSRERQLRKATVA  412



>ref|XP_009781952.1| PREDICTED: patatin-like protein 3 [Nicotiana sylvestris]
Length=411

 Score =   204 bits (518),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 145/202 (72%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ ++++++T + ++       + + C + L
Sbjct  212  FETKDAEGKIRTFDLIDGGVAANNPTLMAITHISKQIMTGNFQY----EDMEKMDCKKML  267

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT K+  KY A  A+ WG+LGW+      PLIDV++DAS+DMVD H++T+F+ L
Sbjct  268  VLSLGTGTGKHEEKYNATIASRWGMLGWIYNNGATPLIDVYADASADMVDIHVSTMFQTL  327

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NY+RIQ+DNL G A+S+D+ T EN+  L QIG +LLKK VS++++ T +YEP+   
Sbjct  328  GSEKNYIRIQDDNLTGEAASMDIATVENMERLVQIGNDLLKKPVSRVNLETGRYEPVVVE  387

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN+ A+   A+LLS+E+K RI
Sbjct  388  GTNEAAIVHVAQLLSEERKLRI  409



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 140/205 (68%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE    +G    ++L+DGG+AANNPTLVA+  +T+ +  ++P F       +P+   RFL
Sbjct  198  FENEGNDGKIKSFHLIDGGIAANNPTLVAMGEITREVHKENPDFF----PIKPMDYGRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK    YTAK AA WGVLGWL    G PLID F  AS+DMVD H++ +F+AL
Sbjct  254  VISLGTGSAKSTDNYTAKDAAKWGVLGWLYNNGGTPLIDTFQQASADMVDIHISNVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T +NL  L ++G  LL+K VS++++ T ++EP+   
Sbjct  314  HSEQSYLRIQDDTLTGDTSSVDIATEKNLKDLVKVGTELLQKQVSRVNLETGKFEPVPNE  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN+ AL RFAKLLS E++ R+  S
Sbjct  374  GTNEQALIRFAKLLSKERRTRLQRS  398



>ref|XP_009589752.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=416

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ V + M+  + KF  +    + + C R L
Sbjct  211  FETKDAQGKTHTFDLIDGGVAANNPTLMAMTHVIKEMM--NGKFQYEGV--KTMDCKRML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG  K   KY A  A+ WG+LGW+     +PLIDV+ DAS D+VD HL+TIF++ 
Sbjct  267  VLSLGTGIGKQEKKYNAASASKWGLLGWMYNNGASPLIDVYGDASVDIVDIHLSTIFKSF  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQ+DNL G A+++D+ T EN+  L +IG +LLKK VS++++ T +YE + G 
Sbjct  327  GSEKNYLRIQDDNLTGDAANMDIATKENMETLVKIGNDLLKKPVSRVNVETGRYEAVHGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++A+ RF KLLS+E+K R
Sbjct  387  GTNEEAIIRFVKLLSEERKLR  407



>ref|XP_004165471.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=451

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRM-VTKDPKFLLDNSSKQPIGCHRF  177
            F+T D+ G    Y +VDGGVAANNPTL A++ VT+ M + +    LL     +P+   R 
Sbjct  250  FQTKDSKGNIRNYEMVDGGVAANNPTLAAMTHVTKEMSILRHRSELL---KIKPMETERM  306

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTGT K   KY+A +A+ WG+L W+  G G P++D+FSDAS+DMVDYH+++IF++
Sbjct  307  LVLSLGTGTPKNDEKYSAAKASKWGMLDWVYHGGGTPIVDIFSDASADMVDYHISSIFQS  366

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
             +   NYLRIQ+D L G  SSVD+ T ENL  L  +G+NLLKK +S++++ + ++EP++ 
Sbjct  367  DHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLIYVGENLLKKPLSRVNLESGKFEPLDA  426

Query  538  AGTNQDALKRFAKLLSDEKKRRIA  609
             GTN+ AL  FAK+LS+E+K R++
Sbjct  427  KGTNEQALAEFAKMLSNERKLRLS  450



>ref|XP_008813725.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008813726.1| PREDICTED: patatin-like protein 2 isoform X2 [Phoenix dactylifera]
Length=336

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 144/207 (70%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G   E++L+DGGVAANNP L+A+  VT+ +   +P +       +P+   + L
Sbjct  126  FETKDAKGNVREFHLIDGGVAANNPALIAIREVTKEVHKGNPDYF----PYRPMDYRKLL  181

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +YTAK+A+ WGVLGWL  G   PL+DVF  +S+DMVD H++ +F+AL
Sbjct  182  LISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSADMVDIHISVVFQAL  241

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
             +  NYLRI++D L G+ SSVDV+T +NL  L + G+ LLKK VS++++ T  +E +  G
Sbjct  242  RSESNYLRIEDDTLNGTVSSVDVSTKDNLQDLVKRGEQLLKKPVSRVNLETGVFETVGNG  301

Query  538  AGTNQDALKRFAKLLSDEKKRRIAASA  618
             GTN+DAL+RFAKLLS E+  R + S 
Sbjct  302  EGTNKDALRRFAKLLSHERGLRESRSP  328



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 145/206 (70%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   ++NL+DGGVAANNPTL+A+  VT+ +++    F       +P+   RFL
Sbjct  199  FETIDPEGNVKDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDFF----PIKPMDYGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   KY A  AA WG+L WL+ G G P+IDVFS +SSDMVDYHL+ +F+AL
Sbjct  255  VISLGTGSPKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDMVDYHLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  SSVD+   +NL+ L ++G+ LLKK VS++++ T + EP +  
Sbjct  315  HSENNYLRIQDDTLTGQVSSVDIADKKNLDDLLKVGEGLLKKPVSRVNLETGRVEPSKHE  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             +N++AL RFAKLLS+EK  R+A S 
Sbjct  375  -SNEEALTRFAKLLSEEKWLRLAKSP  399



>ref|XP_002282481.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=413

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 139/201 (69%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ +    P F       +P+   RFL
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITRGSPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A +AA WGVLGWL+ G   PL+ VF+ AS DM+D HL+ IF+AL
Sbjct  256  VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  316  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEP-SNH  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  FA+LLS EK+RR
Sbjct  375  ETNEEALTSFARLLSQEKQRR  395



>ref|XP_010238243.1| PREDICTED: patatin-like protein 2 isoform X3 [Brachypodium distachyon]
Length=331

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DGGVAANNP LVA+  VT+++  ++P F       +P+   RFL
Sbjct  127  FKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFF----PIKPMDYGRFL  182

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K+  KY A++A +WGVL WL      PL+D+F+ AS+DMVD H+A +F+AL
Sbjct  183  VISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKAL  242

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D L+G+ SSVDV T +NL  L  +G+ LLKK+VS+ ++ T Q  P  G 
Sbjct  243  HSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQMVPTCGD  302

Query  541  G--TNQDALKRFAKLLSDEKKRRIAAS  615
               TN+ AL+RFA LLS+E++ R A S
Sbjct  303  SEMTNEKALERFANLLSEERRIRQARS  329



>ref|XP_004288058.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=387

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 138/201 (69%), Gaps = 9/201 (4%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE TD  G    ++L+DGGVAANNPT++A+S + + M+  D          +P+   R L
Sbjct  193  FEVTDNQGTTRTFDLIDGGVAANNPTMIAISHINREMLKHD---------SEPLDATRLL  243

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+AK   KYTA + + WG++ WL      PL+D+F DAS+DMVD H++T+F++L
Sbjct  244  VLSLGTGSAKSEGKYTAAEVSKWGLINWLFNNGSTPLVDMFGDASADMVDIHVSTLFQSL  303

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N  DNYLRIQ+DNL G  +SVD++T +NL  L +IG  LLKK +S+L++ T +YE  EG 
Sbjct  304  NCNDNYLRIQDDNLVGEEASVDISTEKNLKRLVEIGNALLKKPLSRLNLETGRYETSEGE  363

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL  FAK L++ KK R
Sbjct  364  GTNEEALVEFAKRLAEGKKLR  384



>ref|XP_006660709.1| PREDICTED: patatin-2-Kuras 2-like isoform X1 [Oryza brachyantha]
Length=344

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 144/207 (70%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T D +G   E+NL+DGGVAANNP LVA+  V++++  ++P F       +P+   RFL
Sbjct  140  FRTEDCHGNIKEFNLIDGGVAANNPALVAIGEVSKQIFKQNPDFF----PIKPMDYGRFL  195

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K  +KY+A++A +WGVL WL  G   PL+D+F+ AS+DMVD H+A +F+ L
Sbjct  196  VISLGTGSPKIEAKYSAEKAKSWGVLDWLLVGGSTPLVDIFTQASADMVDIHIAAVFKVL  255

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI--E  534
            ++  NYLRIQ+D L+G+ +SVDV T +NL  L  +G+ LL K VS+ ++ T Q  P   +
Sbjct  256  HSEQNYLRIQDDTLQGTVASVDVATRDNLEKLANVGEILLNKPVSRANLETGQMVPACDD  315

Query  535  GAGTNQDALKRFAKLLSDEKKRRIAAS  615
               TN++ALKRFAKLLSDEK+ R A S
Sbjct  316  PEMTNREALKRFAKLLSDEKRIREARS  342



>ref|XP_008777590.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=403

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 140/202 (69%), Gaps = 3/202 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA+G K  +NLVDGGVAANNPTL A+S + + +V  + K   D  S +P+   +FL
Sbjct  199  FETKDAHGNKRSFNLVDGGVAANNPTLAAMSQIAKEVVCVENK---DFHSIKPVDYRKFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K+TA +A+ WGV GWL      PLI+ F+ AS+DM D HL  +F+AL
Sbjct  256  VISLGTGSAKMEEKFTAHEASKWGVRGWLYDSGDTPLINAFTQASADMDDIHLCAMFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               +NYLRIQ+DNL G  SSVDV+T +NL  L QIG +LLKK VS++++ T  +E ++G 
Sbjct  316  ACRENYLRIQDDNLIGGTSSVDVSTKKNLLKLVQIGSDLLKKHVSRVNLETGSFEEVKGK  375

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
             TN +AL R AK LSDE++ R 
Sbjct  376  VTNDEALSRLAKRLSDERRLRF  397



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DG +AANNPTL+A S VT+++  ++P F       +P    RFL
Sbjct  205  FQTQDRDGNFHEFNLIDGAIAANNPTLIATSEVTKQIYAENPDFF----PIKPSDHGRFL  260

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   K+ AK AA WG+LGWL+ G  NP+IDVF+    DMVDY+++  F+AL
Sbjct  261  VISIGTGSAKLEHKFNAKMAAKWGILGWLTNGGSNPIIDVFTQGGDDMVDYYISVAFQAL  320

Query  361  NAG-DNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
             +  D+YLRIQ+D L G+ SSVD+ T EN+  L +IG+ LLKK VS++++    +EP E 
Sbjct  321  RSDEDHYLRIQDDTLSGTDSSVDIATKENMAKLVEIGETLLKKPVSRINLKKGIFEPHEI  380

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++ LKRFA  LS+EK+ R
Sbjct  381  GGTNEETLKRFATKLSEEKRLR  402



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G+  E+NL+DGGVAANNPTL A++ VT+ +  ++  F       +P+   RFL
Sbjct  200  FETKDDEGSTREFNLIDGGVAANNPTLTAMNQVTKEIFMENADFF----PIKPVDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   +++A+++  WG+LGWL      P+ID+FS AS+DMVD H + +F+AL
Sbjct  256  VISLGTGSNKQEERFSAEESGKWGLLGWLYNKGTTPIIDIFSQASADMVDIHASVLFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQED L G  +SVDV+T ENL  L ++G NLLKK VS++++    +EP +G 
Sbjct  316  HSEQHYLRIQEDALVGDTASVDVSTRENLEKLMEVGGNLLKKPVSRVNLENGTFEPCDGE  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA+ LS E+K R
Sbjct  376  GTNEEALTRFARRLSSERKLR  396



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E++L+DGGVAANNP L+A+S V++ ++  +P F       +P+   RFL
Sbjct  204  FKVEDTKGNVKEHHLIDGGVAANNPALIAISEVSKEILKDNPDFF----PIKPMDYGRFL  259

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK+  KY A  AA WG++ WL      PLI+VF  +S+D+VDYH + +F+AL
Sbjct  260  VISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIEVFFQSSADLVDYHNSVVFQAL  319

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQED L G+ +SVD+ T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  320  HSDNNYLRIQEDELSGTEASVDIATKENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKG  379

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA+LL +E++ R
Sbjct  380  GTNEEALIRFARLLVNERRLR  400



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  D      E+NL+DGG+AANNP LVA+S VT+++  K+P F       +P+   RFL
Sbjct  201  FENQDDQENNEEFNLIDGGLAANNPCLVAISEVTKQVFNKNPDFF----PIKPMDYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KYTAK AA WGVLGWL       L    S AS+DMVD+H   +F AL
Sbjct  257  VISVGTGSAKEEYKYTAKMAAKWGVLGWLYDNGSTLLSPRVSGASADMVDFHNCVVFEAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRI +D L+G+ +SV++ T +NL++L ++G+ LLKK VS++++ T +YEPI+  
Sbjct  317  HSEENYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKNG  376

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAKLLSDEK+ R
Sbjct  377  GTNEEALIRFAKLLSDEKRLR  397



>ref|XP_011099198.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=416

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G +  ++L+DGGVAANNPTL+A+  +++ ++  +  F L N   QP+   R L
Sbjct  213  FETKDAKGKRRTFDLIDGGVAANNPTLMAIVQISREILGGN--FELMNM--QPMDSSRML  268

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT K+  KY A++A  WG+L WL      PLID++ DASSD+VD H++T F++ 
Sbjct  269  VLSLGTGTPKHEEKYNAREATNWGLLSWLYYKGSTPLIDIYGDASSDIVDIHVSTFFQSF  328

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
                NYLRI+ED L G A+SVD++TT+N+  L  IGK LLKK V ++++ T + EP++G 
Sbjct  329  GNEKNYLRIEEDMLSGEAASVDISTTQNMQRLANIGKLLLKKQVCRVNLDTGRQEPVKGV  388

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+ AL RFAKLL+ EKK R
Sbjct  389  GTNEQALARFAKLLAHEKKSR  409



>ref|XP_008361010.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=401

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D NG   E+NL+DGGVAANNPTLVA+  VT++++   P F       +P+   R+L
Sbjct  199  FETKDHNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDFF----PIKPMDYGRYL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY+A  AA WG+L WL+ G   P+IDVFS  S+DMVD +L+ +F+AL
Sbjct  255  VISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADMVDLNLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D L G  SSVD+ T +NL+ L ++G+ LLK+ VS++++ T ++E +   
Sbjct  315  HSEKNYLRIQDDKLHGDVSSVDIATEKNLDNLVKVGEGLLKQPVSRVNLETGKFE-VCNH  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             TN++AL RFAKLLS+EK  R+A S 
Sbjct  374  ETNEEALIRFAKLLSEEKWLRLAKSP  399



>ref|XP_008457877.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Cucumis 
melo]
Length=392

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 145/207 (70%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSK----QPIGC  168
            F+T D+ G    Y +VDGGVAANNPTL A++ VT+ M       +L + S+    +P+  
Sbjct  191  FQTKDSKGNIRNYEMVDGGVAANNPTLAAMTHVTKEMS------ILRHRSELLKIKPMET  244

Query  169  HRFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATI  348
             R L+LS+GTGT K   KY+A +A+ WG+L W+  G   P++D+FSDAS+DMVDYH+++I
Sbjct  245  KRMLVLSLGTGTPKNDEKYSAAKASKWGMLDWVYHGGATPIVDIFSDASADMVDYHISSI  304

Query  349  FRALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEP  528
            F++ +   NYLRIQ+D L G  SSVD+ T ENL  L  +G++LLKK +S++++ + ++EP
Sbjct  305  FQSDHCHKNYLRIQDDTLSGEVSSVDIATAENLLKLIYVGEDLLKKPLSRVNLESGKFEP  364

Query  529  IEGAGTNQDALKRFAKLLSDEKKRRIA  609
            ++  GTN+ AL  FAK+LSDE+K R++
Sbjct  365  LDAQGTNEQALTEFAKMLSDERKLRLS  391



>emb|CBI19552.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 139/201 (69%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ +    P F       +P+   RFL
Sbjct  254  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEITRGSPDFF----PIKPMDYGRFL  309

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A +AA WGVLGWL+ G   PL+ VF+ AS DM+D HL+ IF+AL
Sbjct  310  VISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQASGDMIDLHLSQIFQAL  369

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  370  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEP-SNH  428

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  FA+LLS EK+RR
Sbjct  429  ETNEEALTSFARLLSQEKQRR  449



>ref|XP_002324124.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
 gb|EEF04257.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
Length=335

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D +G   E+NL+DGGVAANNP   A+S V++ +  + P     N    P+   RFL
Sbjct  126  FETKDPSGKVREFNLIDGGVAANNPVF-AISEVSKAINRESPGSFRMN----PMEYGRFL  180

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGTAK   KY A +AA WG+ GWL+     PL+DVF+ AS DMVD+H++T+F+AL
Sbjct  181  VLSLGTGTAKSEGKYDADEAAKWGIFGWLTSDHSTPLVDVFTQASGDMVDFHISTVFQAL  240

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ +NYLRIQ+D L G+ SSVDV T ENL  L ++G+ LL+K VS++++ T  YEPI   
Sbjct  241  NSEENYLRIQDDTLTGTLSSVDVATKENLENLVKVGEKLLEKPVSRVNLATGVYEPINKM  300

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL + AKLLS EK+ R
Sbjct  301  -TNEEALTKLAKLLSREKQLR  320



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D      E++L+DGGV ANNP L+A+S V++ +   +P F       +P+   RFL
Sbjct  197  FKVEDGKNNVREHHLIDGGVVANNPGLIAISEVSKEIFKNNPDFY----PIKPMEYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AKY  KY +  AA WG++ WL     NPLI+VF+ +S+DMVDYH + +F+AL
Sbjct  253  VISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + D+YLRIQED L G+ +SVDV T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  313  RSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRVNLETGLSEPIPKG  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFA LL +E++ R
Sbjct  373  GTNEEALKRFATLLVNERRLR  393



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 137/201 (68%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E+NL+DGGVAANNP LVA+  VT+++   +P F       +P    RFL
Sbjct  200  FQNHDELGNVQEFNLIDGGVAANNPALVAIGQVTKQIFRGNPDFF----PIKPTDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   +Y A +AA WGV GWL  G   PL+DVF+ AS+DMVD HL+ +F+AL
Sbjct  256  VISIGTGSAKVEERYNAAKAAKWGVFGWLISGHSTPLVDVFTQASADMVDLHLSEVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ+D L G+ SSVD+ T +NL+ L   G  LLKK VS+++      E I   
Sbjct  316  HSEDNYLRIQDDTLIGTVSSVDIATKKNLDNLVITGTQLLKKPVSRVNQQNGAVETIANG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFA+LLS+E++ R
Sbjct  376  GTNEEALKRFARLLSEERRLR  396



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T DA   + E+NL+DGGVAANNPTL+A+  VT++++ K      D    +P+   RFL
Sbjct  200  FKTKDAQNNEHEFNLIDGGVAANNPTLIAIGEVTKQVLMKHE----DLFPIKPMEYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AK   KY AK AA WG+L WL+  +  P+I+ F+ AS+DMVDYH   +F+AL
Sbjct  256  VISLGTGNAKNEGKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNFVVFKAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + D YLRIQ+D L G+ +SVD+ T ENL  L ++G+ LL K  SK+++    YE +E  
Sbjct  316  QSDDQYLRIQDDTLTGNLASVDIATKENLEGLVKVGERLLDKPASKINLDKGVYEAVENG  375

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL+RFAK LSDE+K R
Sbjct  376  GTNKEALRRFAKTLSDERKFR  396



>tpg|DAA45677.1| TPA: hypothetical protein ZEAMMB73_598493 [Zea mays]
Length=401

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMV-TKDPKFLLDNSSKQPIGCHRF  177
            F+T DANG + EYNL+DGGVAANNPT+VA++ +T++M+ +KD    L     +P  C RF
Sbjct  182  FQTEDANGKEREYNLIDGGVAANNPTMVAMTQITKKMLASKDKAEEL--YPVKPSNCRRF  239

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LSIGTG+      YTA+Q + WG+  WL      P+ID+F  ASSD+VD H+A +F++
Sbjct  240  LVLSIGTGSTSEQGLYTARQCSRWGICRWLRNNGMAPIIDIFMAASSDLVDIHVAAMFQS  299

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L++  +YLRIQ+++LRG+A++VD  T EN+  L  IG+ +L + VS++++ T +YEP+ G
Sbjct  300  LHSDGDYLRIQDNSLRGAAATVDAATPENMRTLVGIGERMLAQRVSRVNVETGRYEPVTG  359

Query  538  AGTNQDALKRFAKLLSDEKKRRIA  609
             G+N DAL   A+ LS+E++ R+A
Sbjct  360  EGSNADALGGLARQLSEERRTRLA  383



>gb|KJB29505.1| hypothetical protein B456_005G103900 [Gossypium raimondii]
Length=408

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  ++ G   E++L+DGGVAANNPTLVA+S V + +  +   F       +P    RF 
Sbjct  199  FEIKNSTGEVKEFHLIDGGVAANNPTLVAMSEVAKEINRESSDFF----HIKPNDYARFQ  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+     KY+A +AA WGVLGWL+    +PLIDVF  ASSDMVD+HLAT+FRAL
Sbjct  255  VLSLGTGSQNPEEKYSAHKAAKWGVLGWLTSEHSSPLIDVFMQASSDMVDFHLATVFRAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G+ +SVD++T ENL  L ++G+ LLKK VS++++ T ++EP++  
Sbjct  315  HSEHSYLRIQDDTLSGAVTSVDISTKENLENLVKLGEELLKKPVSRVNLETGKFEPVD-Q  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL R A++LS+EK+ R
Sbjct  374  GTNEEALIRLAEVLSEEKRLR  394



>ref|XP_007227189.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
 gb|EMJ28388.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
Length=410

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET  + G   +++L+DGGVAANNP LVA+S VT+ +   +  F    S++      RFL
Sbjct  199  FETKTSTGESRDFDLIDGGVAANNPALVAISEVTKEIHQGNSDFFAIRSTEY----GRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A  AA WG+LGWL++G   PL+DVF+ ASSDMVD+HLAT+FRAL
Sbjct  255  VISLGTGSAKSEEKYNADDAAKWGLLGWLTKGGSTPLVDVFTQASSDMVDFHLATVFRAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L  + SSVD+ T ENLN L ++G+ LLKK VS++++ T  YEP    
Sbjct  315  DCEKNYLRIQDDTLEKTVSSVDIATQENLNNLVKVGEELLKKPVSRVNLQTGIYEPAH-Q  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL R A++LS E++ R
Sbjct  374  DTNEEALVRVAQILSREREVR  394



>ref|XP_010317808.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010317809.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=416

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 141/207 (68%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNP------TLVALSTVTQRMVTKDPKFLLDNSSKQPI  162
            FET DA G    ++L+DGGVAANNP      TL+A++ +++ ++    K+       + +
Sbjct  213  FETRDAAGRIHTFDLIDGGVAANNPNFFYWQTLMAITHISKEIMMGSLKY----EEMERM  268

Query  163  GCHRFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLA  342
               + L+LS+GTG  K+  KY A  A  WG+LGW+      P+IDV+SDAS+DMVD H++
Sbjct  269  DSKKMLVLSLGTGIGKHQGKYNAASATKWGLLGWVYNNGDTPIIDVYSDASADMVDIHVS  328

Query  343  TIFRALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQY  522
            T+F+ L+   NYLRIQ+DNL G A+S+D+ TTEN+  L QIG NLLKK VS++++ T QY
Sbjct  329  TMFQTLHNEKNYLRIQDDNLIGDAASMDIATTENMETLVQIGNNLLKKPVSRVNLETGQY  388

Query  523  EPIEGAGTNQDALKRFAKLLSDEKKRR  603
            EP+ G GTN++AL RFA LLS EKK R
Sbjct  389  EPVHGEGTNEEALIRFANLLSHEKKLR  415



>gb|KJB71085.1| hypothetical protein B456_011G105000, partial [Gossypium raimondii]
Length=356

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 140/205 (68%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA+G    ++L+DGGVAANNPTL+A++ +T+ M  +  + +      + I C R L
Sbjct  156  FETKDADGKTRTFDLIDGGVAANNPTLLAINQITKDMWKEKSEIV----GNEAIDCRRML  211

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+G G AK+  KY A  A+ WG + WL  G   P+IDVF DASSDMVD+H AT+F + 
Sbjct  212  VLSLGAGAAKHEEKYNAAAASKWGRIDWLYNGGKTPIIDVFFDASSDMVDFHTATLFHSF  271

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG-  537
             +  NYLRIQ+D L G ASSVD+ T +NL  L QIG  LLKK VS+++ +T +YE +EG 
Sbjct  272  QSECNYLRIQDDTLTGDASSVDIATEKNLKNLVQIGAKLLKKPVSRVNWVTGKYEAVEGE  331

Query  538  AGTNQDALKRFAKLLSDEKKRRIAA  612
            + TN++AL  FAK LS E+K R+A+
Sbjct  332  SSTNEEALVDFAKKLSQERKLRLAS  356



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  DA  ++ E+NL+DGGVAANNPTLVA+  VT++++ +           +P+   RFL
Sbjct  201  FKNKDAQDSEREFNLIDGGVAANNPTLVAIGEVTKQVLMQHGDLF----PIKPMDYGRFL  256

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AK   K+ A+ AA WG+L WL   +  P+ID F+ AS+DMVDYH   +F+AL
Sbjct  257  VISLGTGNAKNEHKFNAQMAAKWGLLSWLLNNNSTPIIDAFNQASADMVDYHNFVVFKAL  316

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G+ +SVD+ T ENL +L ++G++LL+K VSK+++    YE +E  
Sbjct  317  HSDDKYLRIQDDTLTGNLASVDIATKENLQSLVKVGEHLLEKPVSKINLDKGVYEAVENG  376

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL+RFAK+LSDE+K R
Sbjct  377  GTNKEALQRFAKILSDERKFR  397



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET  + G   +++L+DGGVAANNP LVA+S VT+ +   +  F    S++      RFL
Sbjct  199  FETKTSTGESRDFDLIDGGVAANNPALVAISEVTKEIHQGNSDFFAIRSTE----YGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A  AA WG+LGWL++G  +PL+DVF+ ASSDMVD+HLAT+F+AL
Sbjct  255  VISLGTGSAKSEEKYDADDAAKWGLLGWLTKGGSSPLVDVFTQASSDMVDFHLATVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D L  + SSVD+ T ENLN L ++G+ LLKK VS++++ T  YEP    
Sbjct  315  DSEKNYLRIQDDTLEKTVSSVDIATQENLNNLVKVGEELLKKPVSRVNLQTGIYEPAH-Q  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL R A++LS E+K R
Sbjct  374  DTNEEALVRVAQILSRERKVR  394



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  D  G   E+NL+DGG+AANNP+LVA+S VT+++V  +P F    ++ +     R L
Sbjct  202  FENKDDQGNVKEFNLIDGGIAANNPSLVAISEVTKQIVKSNPNFFPIKATDR----ERLL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K    Y AK AA WG++ WL      PL+D F+ + +DMVD+H +  F+A 
Sbjct  258  VISLGTGSDKVEQLYNAKSAAKWGIISWLFDNGNTPLLDAFNQSKADMVDFHNSVAFQAY  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + DNYLRIQ+D L+G ++SVDV TTENL  L  IGK LLKK VS+++  T +Y+PI   
Sbjct  318  GSLDNYLRIQDDTLKGVSASVDVATTENLANLVTIGKALLKKPVSRINFDTGRYQPIPNG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFAKLL++EK RR
Sbjct  378  GTNEEALIRFAKLLTEEKSRR  398



>ref|XP_002523555.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF38750.1| Patatin precursor, putative [Ricinus communis]
Length=405

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E++L+DGG+AA+NPTLVA+S VT++ + K+P F       +P    RFL
Sbjct  198  FKNEDPDGKVEEFHLIDGGLAASNPTLVAISEVTKQTMKKNPDFF----PIKPTDYDRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+   G K+ AK A+ WGV+ WL      P+ID +S AS+DMVDYH + +F+AL
Sbjct  254  VISLGTGSKTDGGKFNAKMASKWGVISWLYYKGDTPIIDCYSKASTDMVDYHNSVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRI +D L+G+ +SVD++T EN+  L ++GKNLLK  VS++++    YEPIE  
Sbjct  314  HSENNYLRIDDDKLQGNLTSVDMSTKENMEDLVKVGKNLLKSPVSRVNLENGLYEPIENG  373

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GT ++AL+RFAKLLS+E+  R
Sbjct  374  GTYEEALQRFAKLLSEERIIR  394



>ref|XP_010268755.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=392

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G    +NL+DGGVAANNPTL+AL+ +++ ++  DP FL      +P+   +FL
Sbjct  190  FETNDSKGNTRSFNLIDGGVAANNPTLLALTHISKDILINDPDFL----HIKPMDASKFL  245

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG A +  KY+A+ A+ WG+L W       PLID F  +SSD+VD H +T+F+ L
Sbjct  246  VLSLGTGAANHEEKYSAEIASNWGLLEWTYNDGATPLIDAFMHSSSDVVDIHASTLFQVL  305

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +A  NYLRIQ+D L G+ASSVD+ T ENL  L +IGK LLKK +S +++ T ++E + G 
Sbjct  306  HAQKNYLRIQDDTLTGAASSVDIATEENLQNLVRIGKELLKKPMSMVNLETGKFEQLHGE  365

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA+LLS +++ +
Sbjct  366  GTNEEALIRFARLLSQQRRLK  386



>emb|CAN71554.1| hypothetical protein VITISV_034739 [Vitis vinifera]
Length=532

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F   D  G+  E+NL+DGG+AA NPTLVA+S VT+++  K+P F    S  +P+     L
Sbjct  325  FVNQDDQGSTREFNLIDGGLAAXNPTLVAISEVTKQVTNKNPDF----SPFKPMDYGSLL  380

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+G+G+ K   KY AK AA WG+LGWL      PL+D F+ AS+DMVDYH A +F+AL
Sbjct  381  VISVGSGSPKQEHKYNAKMAAKWGILGWLYNNGSTPLVDSFTQASADMVDYHNAVVFQAL  440

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               +NYLRI E  L G  +S D+ T +N+N L ++G+ LLKK VS++++ T +YE I+  
Sbjct  441  GCQENYLRIDEATLTGDLASTDIATKKNMNELVKVGEELLKKPVSRVNLDTGEYEAIKNG  500

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL+RFAKLLSDE+K R
Sbjct  501  GTNEEALRRFAKLLSDERKLR  521



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D+NG   E++L+DG VAAN+P LVA+S +T+ +V + PK+       +P    +F+
Sbjct  192  FKTEDSNGVAKEFHLIDGAVAANDPALVAVSEMTKEIVRRAPKYF----PIKPTDYSKFV  247

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K+ ++ +A WG+LGWLS  + +PL+DVF+ ASSDM +YHLA +F+A 
Sbjct  248  VISLGTGSAKSEGKFDSENSAKWGILGWLSSENSSPLVDVFTQASSDMAEYHLAAVFQAF  307

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + ++YLRIQ+D L G  +SVD++T ENL  L ++G++LLKK VS++++ T ++EP    
Sbjct  308  QSENSYLRIQDDTLEGPLASVDISTKENLENLVKVGEDLLKKPVSRVNLETGKFEPC-NQ  366

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL R AK+LS EK+ R
Sbjct  367  GTNEEALIRMAKVLSKEKRLR  387



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T DA     E+NL+DGGVAANNPTL+A+  VT++ + K           +P+   RFL
Sbjct  203  FKTQDAQNKDREFNLIDGGVAANNPTLIAIGEVTKQTLMKHGDLF----PIKPMDYGRFL  258

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AK   KY AK AA WG+L WL+  +  P+I+ F+ AS+DMVDYH   +F+AL
Sbjct  259  VISLGTGNAKNEEKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNFVVFKAL  318

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G+ +SVD++T ENL  L ++G+ LL K  SK+++    YE +E  
Sbjct  319  HSDDKYLRIQDDTLTGNLASVDISTKENLEGLIKVGEELLDKPTSKINLDKGVYEAVENG  378

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
            GTN++AL+RFAK LSDE+K R A
Sbjct  379  GTNKEALRRFAKKLSDERKFRQA  401



>ref|XP_007017306.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14531.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 140/204 (69%), Gaps = 10/204 (5%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCH---  171
            FET ++NG   E++L+DGGVAANNPTLVA++ VT+ +  K       NS   P   +   
Sbjct  210  FETKNSNGEVKEFHLIDGGVAANNPTLVAMNEVTKEITRK-------NSDSFPTKANDFA  262

Query  172  RFLILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIF  351
            RFL+LS+GTG+ K   KY A  AA WG+L WL+     PL+DVF  ASSDMVD+H+AT+F
Sbjct  263  RFLVLSLGTGSQKCEEKYPAPMAAKWGLLEWLTFQHSTPLMDVFMQASSDMVDFHIATVF  322

Query  352  RALNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI  531
            +AL + + YLRIQ+D L G+ SSVD+ T ENL  L ++G+ LLKK VS++++   ++EPI
Sbjct  323  QALQSEEKYLRIQDDTLCGTVSSVDIATKENLENLVKVGEELLKKPVSRVNLDNGKFEPI  382

Query  532  EGAGTNQDALKRFAKLLSDEKKRR  603
                TN++AL R AK+LS EK+ R
Sbjct  383  NNEDTNENALIRLAKVLSQEKRLR  406



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 144/206 (70%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTL+A+  VT+ ++     F       +P+   RFL
Sbjct  199  FETMDPEGNVREFNLIDGGVAANNPTLLAIGEVTKTIIKGSSDFF----PIKPMDYARFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A  AA WG+L WL+ G G P+IDVFS +S+DMVDYHL+ +F+AL
Sbjct  255  VISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADMVDYHLSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G  SSVD+   +NL+ L  +G+ LLKK VS++++ T + EP +  
Sbjct  315  HSENNYLRIQDDTLTGHVSSVDIADKKNLDDLLIVGEGLLKKPVSRVNLETGRVEPSKHE  374

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
             +N++AL RFAKLLS+EK  R+A S 
Sbjct  375  -SNEEALTRFAKLLSEEKWLRLARSP  399



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 145/203 (71%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            FET D+ G+   E++L+DGG+AANNP LVA+  VT+ +  K+P    D+ +++ +   +F
Sbjct  198  FETKDSEGSSSREFHLIDGGIAANNPALVAVGEVTKEVHKKNP----DHFNREAVDYRKF  253

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG+AK   KY AK A+ WGV GWL  G   PL+DV   + +D+VD HL+ +F+A
Sbjct  254  LLISLGTGSAKVEGKYRAKSASRWGVFGWLLGGGSTPLVDVLMQSCADIVDIHLSVVFKA  313

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-E  534
            L +  NYLRI++D L G+ SS D++T ENL+ L  +G+ LLKK VS++++ T  +EP+  
Sbjct  314  LRSESNYLRIEDDTLTGAVSSADISTEENLDDLVSVGERLLKKPVSRVNLETGVFEPVGN  373

Query  535  GAGTNQDALKRFAKLLSDEKKRR  603
            G GTN+DAL+RFA+LLSDE++ R
Sbjct  374  GEGTNEDALRRFARLLSDERRLR  396



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D      E++L+DGGVAANNP L+A+S V++ +   +P F       +P+   RFL
Sbjct  197  FKVEDGKDNVREHHLIDGGVAANNPGLIAISEVSKEIFKNNPDFY----PIKPMEYGRFL  252

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AKY  KY +  AA WG++ WL     NPLI+VF+ +S+DMVDYH + +F+AL
Sbjct  253  VISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVFTQSSADMVDYHNSVVFQAL  312

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             + D+YLRIQED L G+ +SVDV T ENL  L +IG+NLLKK +S++++ T   EPI   
Sbjct  313  RSEDSYLRIQEDELSGTEASVDVATKENLERLVEIGENLLKKPLSRINLETGLTEPIPKG  372

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL RFA LL +E++ R
Sbjct  373  GTNEEALTRFATLLVNERRLR  393



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 142/202 (70%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G   E++L+DGGVAANNP L+A+  VT+ +   +P +       +P+   + L
Sbjct  200  FETKDAKGNVREFHLIDGGVAANNPALIAIREVTKEVHKGNPDYF----PYRPMDYRKLL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   +YTAK+A+ WGVLGWL  G   PL+DVF  +S+DMVD H++ +F+AL
Sbjct  256  LISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSADMVDIHISVVFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
             +  NYLRI++D L G+ SSVDV+T +NL  L + G+ LLKK VS++++ T  +E +  G
Sbjct  316  RSESNYLRIEDDTLNGTVSSVDVSTKDNLQDLVKRGEQLLKKPVSRVNLETGVFETVGNG  375

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN+DAL+RFAKLLS E+  R
Sbjct  376  EGTNKDALRRFAKLLSHERGLR  397



>ref|XP_008777592.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=507

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 140/202 (69%), Gaps = 3/202 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA+G K  +NLVDGGVAANNPTL A+S + + +V  + K   D  S +P+   +FL
Sbjct  303  FETKDAHGNKRSFNLVDGGVAANNPTLAAMSQIAKEVVCVENK---DFHSIKPVDYRKFL  359

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   K+TA +A+ WGV GWL      PLI+ F+ AS+DM D HL  +F+AL
Sbjct  360  VISLGTGSAKMEEKFTAHEASKWGVRGWLYDSGDTPLINAFTQASADMDDIHLCAMFQAL  419

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
               +NYLRIQ+DNL G  SSVDV+T +NL  L QIG +LLKK VS++++ T  +E ++G 
Sbjct  420  ACRENYLRIQDDNLIGGTSSVDVSTKKNLLKLVQIGSDLLKKHVSRVNLETGSFEEVKGK  479

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
             TN +AL R AK LSDE++ R 
Sbjct  480  VTNDEALSRLAKRLSDERRLRF  501



>gb|AAD22149.1|AF061282_2 patatin-like protein [Sorghum bicolor]
Length=438

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 134/192 (70%), Gaps = 7/192 (4%)
 Frame = +1

Query  34   EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKY  213
            EY+LVDGGVAANNPT++A+S +T+ ++  +P F    +  +P     +L++S   G    
Sbjct  249  EYHLVDGGVAANNPTMIAMSMLTKEVLRGNPDF----NPGKPTEYRNYLVIS---GPPSL  301

Query  214  GSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQE  393
              KYTA Q A WG++ WL +G   P+ID+FS AS+DMVD H A +F AL+   NYLRIQ+
Sbjct  302  AEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHAAVLFEALHCEKNYLRIQD  361

Query  394  DNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFA  573
            D+L G ASSVD+ T EN+ AL  IGK LLKK V++++I T  YEP+ G GTN+DAL RFA
Sbjct  362  DSLTGHASSVDIATKENMEALIGIGKKLLKKPVARVNIDTGMYEPVAGEGTNEDALARFA  421

Query  574  KLLSDEKKRRIA  609
            K+LSDE++ R A
Sbjct  422  KMLSDERRLRQA  433



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D +G   E+NL+DGGVAANNP LVA+  VT+++  ++P F       +P+   RFL
Sbjct  200  FKTEDLHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K+  KY A++A +WGVL WL      PL+D+F+ AS+DMVD H+A +F+AL
Sbjct  256  VISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIAAVFKAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  NYLRIQ+D L+G+ SSVDV T +NL  L  +G+ LLKK+VS+ ++ T Q  P  G 
Sbjct  316  HSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNVGEMLLKKSVSRANLETGQMVPTCGD  375

Query  541  G--TNQDALKRFAKLLSDEKKRRIAAS  615
               TN+ AL+RFA LLS+E++ R A S
Sbjct  376  SEMTNEKALERFANLLSEERRIRQARS  402



>gb|ACN36732.1| unknown [Zea mays]
Length=331

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +1

Query  4    ETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLI  183
            E TD    + EY+LVDGGVAANNPT+VA+S +T+ +  ++P F    ++  P     +LI
Sbjct  130  EATDGRPPR-EYHLVDGGVAANNPTMVAMSMLTKEVHRRNPNF----NAGSPTEYTNYLI  184

Query  184  LSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALN  363
            +S+GTG+AK   KYTA+Q A WG++ WL  G   P+ID+FS ASSDMVD H + +F+AL+
Sbjct  185  ISVGTGSAKQAEKYTAEQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHASILFQALH  244

Query  364  AGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAG  543
                YLRIQ+D L G+ASSVD+ T EN+ +L  IG+ LL K V++++I T  YE  EG G
Sbjct  245  CERKYLRIQDDTLTGNASSVDIATKENMESLISIGQELLNKPVARVNIDTGLYESCEGEG  304

Query  544  TNQDALKRFAKLLSDEKKRR  603
            TN  +L  FAK LSDE+K R
Sbjct  305  TNAQSLADFAKQLSDERKLR  324



>ref|XP_008656522.1| PREDICTED: patatin-like protein 1 [Zea mays]
 tpg|DAA45678.1| TPA: hypothetical protein ZEAMMB73_598493 [Zea mays]
Length=428

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMV-TKDPKFLLDNSSKQPIGCHRF  177
            F+T DANG + EYNL+DGGVAANNPT+VA++ +T++M+ +KD    L     +P  C RF
Sbjct  209  FQTEDANGKEREYNLIDGGVAANNPTMVAMTQITKKMLASKDKAEEL--YPVKPSNCRRF  266

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LSIGTG+      YTA+Q + WG+  WL      P+ID+F  ASSD+VD H+A +F++
Sbjct  267  LVLSIGTGSTSEQGLYTARQCSRWGICRWLRNNGMAPIIDIFMAASSDLVDIHVAAMFQS  326

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L++  +YLRIQ+++LRG+A++VD  T EN+  L  IG+ +L + VS++++ T +YEP+ G
Sbjct  327  LHSDGDYLRIQDNSLRGAAATVDAATPENMRTLVGIGERMLAQRVSRVNVETGRYEPVTG  386

Query  538  AGTNQDALKRFAKLLSDEKKRRIA  609
             G+N DAL   A+ LS+E++ R+A
Sbjct  387  EGSNADALGGLARQLSEERRTRLA  410



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 142/207 (69%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCH-RF  177
            FE  D  G   E+NL+DGGVAANNP  VA+S V +    ++P F+      +P+  + R 
Sbjct  200  FENNDQQGEPKEFNLIDGGVAANNPASVAISEVIKETKNQNPDFM----EIKPMELYDRL  255

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG+ +   KY AK+A+ WG++GWL +   +PL++ F +AS+ MVDYH + +F+A
Sbjct  256  LLVSLGTGSDRSELKYNAKKASKWGLIGWLYEDGSSPLLECFDEASACMVDYHNSVVFQA  315

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L++ +NYLRI+ED L+G+ +S D  T ENL  L ++G  LL+K +S +D+ T  YEP+E 
Sbjct  316  LHSEENYLRIEEDTLKGNLASADKATQENLENLVEVGNQLLQKPISTMDLDTGLYEPVEN  375

Query  538  AGTNQDALKRFAKLLSDEKKRRIAASA  618
             GTNQ AL+RFAKLLSDEKK R + S 
Sbjct  376  GGTNQQALQRFAKLLSDEKKLRESKSP  402



>ref|XP_006663045.1| PREDICTED: patatin-2-Kuras 1-like [Oryza brachyantha]
Length=411

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            F+  D A G   E++L+DGGVAANNPT+VA+S +++ ++ ++  F L     +P     +
Sbjct  207  FQIPDPAGGEPREFHLIDGGVAANNPTMVAMSMISREVLRQNQDFKL----GKPADYRHY  262

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++SIGTGTAK   KYTA + A WGVL WL  G   PLID+F+ AS+DMVD H + +F++
Sbjct  263  LVISIGTGTAKIAQKYTAPECAKWGVLRWLYDGGFTPLIDIFTHASADMVDIHASVLFQS  322

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L    +YLRIQ+D+L G  SSVD+ T EN+ AL  IGK LLKK V++++I T  +E ++G
Sbjct  323  LCCEQSYLRIQDDSLEGHTSSVDIATKENMEALIGIGKGLLKKPVARVNIDTGVHEAVDG  382

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++AL RFAK LSDE++ R
Sbjct  383  EGTNEEALARFAKQLSDERRLR  404



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  DA   + E+NL+DGGVAANNPTLVA+  VT++++ +           +P+   RFL
Sbjct  202  FKNKDAQDNEREFNLIDGGVAANNPTLVAIGEVTKQVLMQHADLF----PIKPMDYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG AK   KY A+ AA WG+L WL   +  P+ID F+ AS+DMVD+H   +F+AL
Sbjct  258  VISLGTGNAKNEHKYNAQMAAKWGLLSWLFNDNSTPIIDAFNQASADMVDFHNFVVFKAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ D YLRIQ+D L G+ +SVD+ T ENL  L ++G++LL+K VSK+++    YE +E  
Sbjct  318  HSDDKYLRIQDDTLTGNLASVDIATKENLQGLVKVGEHLLEKPVSKINLDKGVYEAVENG  377

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++AL+RFAK+LSDE+K R
Sbjct  378  GTNKEALQRFAKILSDERKLR  398



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G    +NLVDGGVAANNP L+A S +T+++   +  F    S  +P    +FL
Sbjct  199  FETKDSQGKTRSFNLVDGGVAANNPMLIATSQITKQIFWNNEDF----SKFKPTDFAKFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   K+TA ++A WG+LGWL      P+ID+FS +S+DMVD H + +F+AL
Sbjct  255  VVSLGTGSPKQEQKFTAPESAKWGLLGWLQNKGSTPIIDIFSQSSADMVDIHASILFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
             +  NYLRIQ+D L G  +SVDV+T+ENL  L Q+G++LLKK VS++++ T   E  +  
Sbjct  315  RSEKNYLRIQDDTLEGDTASVDVSTSENLRKLVQVGQDLLKKPVSRVNLETGVSEACDVE  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+DAL RFAK+LS+E+K R
Sbjct  375  GTNEDALIRFAKMLSNERKSR  395



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++   P F       +P+   RFL
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A +AA WG+LGWL+ G   PL+ VF+ AS+DMVD HL+  F+AL
Sbjct  256  VISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  316  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEP-SNH  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  F +LLS EK+RR
Sbjct  375  ETNEEALTSFTRLLSQEKQRR  395



>ref|XP_009410116.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D++G    YNL+DGG+AANNPTLVA+S + + +   +  F    ++ + I  H F+
Sbjct  210  FETKDSDGNTRSYNLIDGGIAANNPTLVAMSQIKKEIALMNKDF----ANFKSIDYHNFI  265

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   K++A  A+ WGVL WL  G   PLID F   S+D+VD H++++F++L
Sbjct  266  VISIGTGSAKIEQKFSADLASKWGVLQWLYHGGSTPLIDSFFQGSADVVDIHMSSLFQSL  325

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N   NYLRIQ+D L G  SSVDV+T ENL  L QIGKNLLKK VS++++ T  +E ++G 
Sbjct  326  NCEKNYLRIQDDTLVGERSSVDVSTKENLQELVQIGKNLLKKPVSRVNLETGIFEELDGE  385

Query  541  GTNQDALKRFAKLLSDEKKRRIA  609
            GTN DAL   A+ LS E++ R A
Sbjct  386  GTNADALTHLAQRLSQERRLRKA  408



>ref|XP_008457870.1| PREDICTED: patatin-like protein 2 isoform X2 [Cucumis melo]
Length=330

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 140/206 (68%), Gaps = 4/206 (2%)
 Frame = +1

Query  1    FETTD-ANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            FET D    A   Y+++DG +A NNPTL A++ + + +     K   +NS  +     R 
Sbjct  128  FETKDDVTNATRTYDVIDGAIAVNNPTLAAITHINREIAIHHQK---ENSRIKANDTRRM  184

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTG  K+  KY A QA+ WG   W+ QG   P+ID FSDASSDMVDYH++T+F++
Sbjct  185  LVLSLGTGLGKHEEKYNATQASKWGAFSWIFQGGSTPIIDFFSDASSDMVDYHVSTLFQS  244

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
             NA  NYLRIQED+L G A+ VD+ T ENL  L +IG++LLKK VS++++ T +YE ++G
Sbjct  245  SNAQQNYLRIQEDSLTGDAALVDIATPENLLKLVKIGEDLLKKPVSRVNLETGKYEIVDG  304

Query  538  AGTNQDALKRFAKLLSDEKKRRIAAS  615
             G+N+DAL +FAKLL  E+K R++ +
Sbjct  305  EGSNEDALTKFAKLLHQERKLRLSTA  330



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D+ G   E+NL+DGG+AANNP LVA+  +T+    ++P F       +P+  HRFL
Sbjct  199  FQTEDSQGNIREFNLIDGGLAANNPALVAMGEITKETFEENPDFF----PIKPMDYHRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   +Y+A  A  WGVLGWL      PL+D F  AS+DMVD H++  F+AL
Sbjct  255  VISLGTGSSK-EERYSANHAKRWGVLGWLLSNGSTPLVDAFMQASADMVDIHISEAFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPI-EG  537
            ++G NYLRI++D L G  +SVD +T ENL  L ++G+ LLKK VS++++ T   EP+ EG
Sbjct  314  HSGKNYLRIEDDALSGILASVDTSTKENLENLVKVGEMLLKKPVSRVNLETGHVEPVSEG  373

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN++AL R AKLLSDE++ R
Sbjct  374  EGTNEEALIRLAKLLSDERRLR  395



>ref|XP_010059968.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
Length=411

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 140/209 (67%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+ GGVAANNPTLVA+  V + ++     F   N    P+   RFL
Sbjct  198  FETQDPTGKVREFNLIVGGVAANNPTLVAMGEVRKEIIGGSSDFFPIN----PMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A +AA WGVL WLS   G+PLIDV   AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMVDFHLSVVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQY----EP  528
                NYLRIQ+D L G+ +SVD+   +N+N L + G+ LLKK VS++++ T +Y    EP
Sbjct  314  LIEANYLRIQDDTLSGAVASVDIAMKKNMNDLVKTGEALLKKPVSRVNLETGRYEAFCEP  373

Query  529  IEGAGTNQDALKRFAKLLSDEKKRRIAAS  615
                 TN++AL+RFAKLLS E++ R+A S
Sbjct  374  TPNQETNEEALRRFAKLLSQERQLRLARS  402



>ref|XP_003561574.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=423

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D NG   EYNL+DGGVAANNPT+VA++ +T++++ KD + L      +P  C +FL
Sbjct  210  FQTEDDNGKVREYNLIDGGVAANNPTMVAMTQITKKIMAKDKEELY---PVKPSDCGKFL  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LSIGTG+      YTAKQ + WG++ WL      P+ID+F  ASSD+VD H A +F++L
Sbjct  267  VLSIGTGSTSDQGLYTAKQCSRWGIIRWLRNKGMAPIIDIFMAASSDLVDIHAAVLFQSL  326

Query  361  NA-GDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            ++ GD YLRIQ+++LRG+A++VD  T +N+  L +IG+ +L + VSK+++ T +YE ++G
Sbjct  327  HSDGDCYLRIQDNSLRGAAATVDTATPDNMRELVRIGERMLAQRVSKVNVETGRYEEMQG  386

Query  538  AGTNQDALKRFAKLLSDEKKRRI  606
            AGTN DAL  FA+ LSDE++ R 
Sbjct  387  AGTNADALAGFARQLSDERRARF  409



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 135/201 (67%), Gaps = 20/201 (10%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D  G   E NL+DGGVAANNP LVA+S VT+++  K+P FL      +P+   RFL
Sbjct  244  FKNQDKEGKARELNLIDGGVAANNPALVAISQVTKQVFDKNPDFL----PIKPMDYGRFL  299

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+ K   KY AK AA WGVLGWL  G   PL+DVF+ AS+DMVD+H++ +F+AL
Sbjct  300  VISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASADMVDFHISVVFQAL  359

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ DNYLRIQ                ENL  L +IG+ LLKK VS++++ T    P+E  
Sbjct  360  HSEDNYLRIQ----------------ENLGNLVKIGERLLKKPVSRVNLETGLSVPVENC  403

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN++ALKRFAKLLSDEK+ R
Sbjct  404  GTNEEALKRFAKLLSDEKRLR  424



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D  G   E+NL+DGGVAANNPTLVA+  VT+ ++   P F       +P+   RFL
Sbjct  200  FETKDPAGRVREFNLIDGGVAANNPTLVAIGEVTKEIIRGSPDFF----PIKPMDYGRFL  255

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG++K   KY A +AA WG+LGWL+ G   PL+ VF+ AS+DMVD HL+  F+AL
Sbjct  256  VISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQASADMVDLHLSEAFQAL  315

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++  +YLRIQ+D L G  SSVD+ T ENL+ L +IG+ LLKK VS++++ T  +EP    
Sbjct  316  HSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKKRVSRVNLDTGIFEP-SNH  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  F +LLS EK+RR
Sbjct  375  ETNEEALTSFTRLLSQEKQRR  395



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +1

Query  1    FETTDANGAKV-EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRF  177
            FE  D  G K+ E+NL DGGVAANNPTL+A+S V +++  K+P F    S  +P+   R 
Sbjct  194  FENPDEKGGKMREFNLTDGGVAANNPTLLAISEVAKQVSNKNPDF----SPFKPMEYDRL  249

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L++S+GTG+AK   KY  K A+ WG++ WL  G   PL++ F+ AS+DMVD++++  F+ 
Sbjct  250  LVISLGTGSAKTEHKYNGKMASKWGLVEWLYNGGNTPLVECFAQASTDMVDFYISLAFQT  309

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
                +NYLRI +D L G+ +S+DV T ENLN L Q+G+ LLKK VS++++ T QYEP++ 
Sbjct  310  HQYEENYLRIDDDTLTGTLASLDVATKENLNNLVQVGEKLLKKPVSRVNLETGQYEPVKN  369

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             G+N+ AL++FAK LSDE++ R
Sbjct  370  GGSNEKALRKFAKKLSDERRLR  391



>gb|KCW54997.1| hypothetical protein EUGRSUZ_I00973 [Eucalyptus grandis]
Length=289

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFL-LDNSSKQPIGCHRF  177
            FET D NG    ++L+DGGVAANNPTLVALS + +  +  D +F  ++     PI     
Sbjct  91   FETIDENGKAHSFDLIDGGVAANNPTLVALSHIKRESLLHDGEFKDINLRETDPI-----  145

Query  178  LILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRA  357
            L+LS+GTG AK+  KY+A +A+ WG++ W+      PL+D+F+DASSDMVD HL+T+F+ 
Sbjct  146  LVLSLGTGVAKHEEKYSATEASRWGLINWILHNGFTPLLDIFNDASSDMVDIHLSTLFQF  205

Query  358  LNAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEG  537
            L+   NYLRIQ+D L G  SSVDV T +NL  L  IG+ LL+K VS++ + T ++E IEG
Sbjct  206  LSCKHNYLRIQDDTLIGEESSVDVATPKNLQRLMGIGQKLLQKRVSRVKLETGRFEEIEG  265

Query  538  AGTNQDALKRFAKLLSDEKKRR  603
             GTN DAL  FA  LS E+KRR
Sbjct  266  EGTNGDALNCFATRLSTERKRR  287



>ref|XP_010064187.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66460.1| hypothetical protein EUGRSUZ_F00256 [Eucalyptus grandis]
Length=421

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 141/205 (69%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D+ G   E+NL+DGGVAANNPTLVA+  VT+ ++     F       +P+   RFL
Sbjct  198  FETQDSTGKLREFNLIDGGVAANNPTLVAMGEVTKEIIGGSSDFF----PIKPMDYRRFL  253

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+     KY A +AA WGVL WL+   G+PLIDVF  AS+DMVD+HL+ +F+AL
Sbjct  254  VISLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMVDFHLSAVFQAL  313

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+DNL G+ +SVD+ T +NLN L + G+ LLKK VSK+D+     E     
Sbjct  314  HLEANYLRIQDDNLSGAVASVDIATKKNLNDLVRTGEALLKKPVSKVDLEKGGCEACN-L  372

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
             TN+ AL+RFAK+LS+E++ R+A S
Sbjct  373  ETNEQALRRFAKMLSNERQLRLARS  397



>gb|KCW66469.1| hypothetical protein EUGRSUZ_F002673, partial [Eucalyptus grandis]
Length=249

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 132/188 (70%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET D      E+NL+DGGVAANNPTLVA+  VT+ ++  +  F       +P+   RFL
Sbjct  67   FETKDPTDQVREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFF----PIKPMDYRRFL  122

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTGT K   KYTA +AA WGVLGWL+ G G+PLIDVFS AS+DMVD+H++ +F+AL
Sbjct  123  VISLGTGTRKAEGKYTAHEAAKWGVLGWLTSG-GSPLIDVFSQASADMVDFHISAVFQAL  181

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +  DNYLRIQ+D L G  SSVDV T +NLN L + G+ LLKK VS++++ T   EP    
Sbjct  182  HLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPVSRVNLETGACEPTPNQ  241

Query  541  GTNQDALK  564
             TN++AL+
Sbjct  242  ETNEEALR  249



>ref|XP_008393826.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=415

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET  + G   E++L+DGGVAANNP LVA++ VT+ +   +  F   N S +P    RFL
Sbjct  204  FETKTSTGETREFHLIDGGVAANNPALVAINEVTKZIHQGNSDF---NFSXRPTXYGRFL  260

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK   KY A   A WG+L WL+ G   PLIDVF+ ASSDMVD+HLAT+F+AL
Sbjct  261  VVSLGTGSAKCEEKYHANDVAKWGLLAWLTSGGSCPLIDVFTQASSDMVDFHLATVFQAL  320

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N   +YLRIQ+D L  + SSVD+ T ENL+ L ++G+ LLKK VS++++ T  +EP   +
Sbjct  321  NCEKSYLRIQDDTLEKTVSSVDIATKENLDNLVKVGEKLLKKPVSRVNMDTGAFEPAHQS  380

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL R A++LS E+K R
Sbjct  381  -TNEEALVRIARILSRERKVR  400



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 135/189 (71%), Gaps = 4/189 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F T D +G   E+NLVDGGVAANNP LVA S VT++++T +P F       +PI   RFL
Sbjct  202  FRTQDKDGNFHEFNLVDGGVAANNPALVATSQVTRQIMTGNPDFF----PIKPIDYGRFL  257

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++SIGTG+AK   KY AK A+ WG+LGWL  G   P++DVF+ AS DMVD H++ +F+AL
Sbjct  258  VISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMVDLHISVVFQAL  317

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVD++T EN++ L +IGK LLKK VS++++ T   E  +  
Sbjct  318  HSEENYLRIQDDTLTGTDSSVDISTKENMDKLVEIGKTLLKKPVSRVNLQTGLSEQSKND  377

Query  541  GTNQDALKR  567
            GTN++ LKR
Sbjct  378  GTNEETLKR  386



>ref|XP_009590385.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=326

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 141/206 (68%), Gaps = 8/206 (4%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+  D +G   E+NLVDGGVAANNP LVA S VT+++   DP F +D        C RFL
Sbjct  126  FKNQDKDGHVQEFNLVDGGVAANNPVLVATSQVTKQIFLGDPDFSMD--------CGRFL  177

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+ K   KY A  A  WG+  WL  G  +P++DV + AS DMV+  L+ + +AL
Sbjct  178  VISLGTGSPKVKPKYNATTAIKWGLCRWLLNGGSSPIVDVLTQASDDMVNLPLSALLQAL  237

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L  + SSVD++T +N++ L +IGKNLLKK VS+++  T   EP +  
Sbjct  238  HSENNYLRIQDDTLSRTNSSVDISTKDNMDKLVEIGKNLLKKPVSRINSHTGLLEPCQNG  297

Query  541  GTNQDALKRFAKLLSDEKKRRIAASA  618
            G+N+++LKRFAKLLS+E++ R + +A
Sbjct  298  GSNEESLKRFAKLLSEERRLRKSKAA  323



>gb|KCW54973.1| hypothetical protein EUGRSUZ_I00941 [Eucalyptus grandis]
Length=403

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   EYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKY  213
            E+NL+DGG+ ANNPTLVA+S VT++++ ++  F+     K P+   R L++S+GTG+   
Sbjct  206  EFNLIDGGMVANNPTLVAVSEVTKQILREEAHFI---DIKPPVDYTRLLVISLGTGSDTS  262

Query  214  GSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQE  393
               + AK+A+ WG+  WL Q   +PLID++S  SSD+VDYH + +F+A  +  NYLRI +
Sbjct  263  ELMFNAKKASKWGLFCWLYQDGTSPLIDIYSQGSSDLVDYHNSVVFKAYQSEKNYLRIND  322

Query  394  DNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFA  573
            D+L+G+ SSVD +T ENL  L ++G++LLKK VS+ D+ T +YE I  AGTN++ALKRFA
Sbjct  323  DSLKGTLSSVDTSTKENLEGLVKVGEHLLKKPVSRFDLDTGRYESIPNAGTNEEALKRFA  382

Query  574  KLLSDEKKRR  603
            KLLSDEKK R
Sbjct  383  KLLSDEKKLR  392



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 137/202 (68%), Gaps = 4/202 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            F+T D N     +NL+DGG+AANNPTL+AL+ VT+    ++  F       +P    +FL
Sbjct  183  FQTKDFNRKSRSFNLIDGGIAANNPTLLALNEVTKESFKQNDDFF----PIKPADYGKFL  238

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+AK   K+ A  A+ WGVLGWL      PLID FS ASSDMVD H + IF+AL
Sbjct  239  VLSLGTGSAKQEKKFNASMASKWGVLGWLYNSGMTPLIDSFSQASSDMVDIHASVIFQAL  298

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ+D L G  +SVDV++ ENL  L QIGK LLKK VS++++ +  YE ++ A
Sbjct  299  HCESNYLRIQDDTLIGDTASVDVSSKENLLKLVQIGKELLKKPVSRVNLESGMYEAVQMA  358

Query  541  GTNQDALKRFAKLLSDEKKRRI  606
            GTN++ L RFAK+LS E++ R+
Sbjct  359  GTNEEELIRFAKMLSSERQLRL  380



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE   + G    ++L+DGGV ANNPTLVA+S VT+ +  ++P+F       +P+   RFL
Sbjct  199  FENKGSGGEVRFFDLIDGGVVANNPTLVAISEVTKEISRRNPEFF----KTKPLDYARFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            ++S+GTG+AK  + Y+AK AA WG++GWL     +PL++ F+  S+DMVD+H + +F+AL
Sbjct  255  VISLGTGSAKTQNTYSAKAAAGWGIIGWLYNKGNSPLVESFTQGSADMVDFHNSVVFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            N+ DNYLRIQED+L   A+SVD++T ENL  L  IG+ LLK  VS++++ T  +EP++  
Sbjct  315  NSEDNYLRIQEDDLSNEAASVDISTKENLQNLVNIGQQLLKNPVSRVNVETGLFEPLKNQ  374

Query  541  GTNQDALKRFAKLLSDEKKRR  603
             TN++AL  FAKLLS E++ R
Sbjct  375  STNEEALVIFAKLLSQERRLR  395



>ref|XP_009780402.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=413

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FET DA G    ++L+DGGVAANNPTL+A++ V++ + T+  ++       + +  ++ L
Sbjct  211  FETKDAQGKVRTFDLIDGGVAANNPTLMAITHVSREIKTRKMQY----EDMKTVDYNKML  266

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTGT     KY A+ A+ WGVLGW+      PL+D++SDAS+D+VD H++T+F++L
Sbjct  267  VLSLGTGTGTNKEKYNARSASRWGVLGWMYNNGATPLLDIYSDASTDVVDIHVSTMFQSL  326

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            +   NYLRIQ D L G A+S D++T +N+  L Q+GK+LLKK VS++++ T ++E + G 
Sbjct  327  HNEKNYLRIQNDTLTGEAASTDISTIKNMQTLVQVGKDLLKKPVSRVNLETGRFEAVHGE  386

Query  541  GTNQDALKRFAKLLSDEKKRR  603
            GTN+ AL RFAKLLS+E+K R
Sbjct  387  GTNEQALIRFAKLLSEERKLR  407



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 138/205 (67%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    FETTDANGAKVEYNLVDGGVAANNPTLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFL  180
            FE  D+ G   E+NL+DGGVAANNPTLVA++ VT+ +     +        +P    RFL
Sbjct  199  FENKDSEGRIREFNLIDGGVAANNPTLVAINQVTKEITRGSSEIF----PLKPKEDGRFL  254

Query  181  ILSIGTGTAKYGSKYTAKQAAAWGVLGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRAL  360
            +LS+GTG+AK   KY A+ AA WGVLGWL  G   PL DVF+ ASSDMVD+H  T F+AL
Sbjct  255  VLSLGTGSAKAEEKYDAEGAAKWGVLGWLLNGGSTPLFDVFNRASSDMVDFHTTTFFQAL  314

Query  361  NAGDNYLRIQEDNLRGSASSVDVTTTENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGA  540
            ++ +NYLRIQ+D L G+ SSVDV T ENL  L + G+ LLKK VS+++  T  YEP    
Sbjct  315  HSQNNYLRIQDDTLTGAMSSVDVATKENLEDLVKAGEKLLKKPVSRVNWETGIYEP-SNQ  373

Query  541  GTNQDALKRFAKLLSDEKKRRIAAS  615
            GTN++AL R A+LLS EK+ R A S
Sbjct  374  GTNEEALIRLAELLSKEKRLRDAPS  398



>gb|EYU21992.1| hypothetical protein MIMGU_mgv1a024079mg, partial [Erythranthe 
guttata]
Length=181

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = +1

Query  76   TLVALSTVTQRMVTKDPKFLLDNSSKQPIGCHRFLILSIGTGTAKYGSKYTAKQAAAWGV  255
            TLVA+  VT+ ++ K+P F       QP    R L++S+GTG+AK   KYTAK AA WGV
Sbjct  1    TLVAVREVTKEIMRKNPDFF----PIQPFDYRRLLVISLGTGSAKQEEKYTAKMAAKWGV  56

Query  256  LGWLSQGDGNPLIDVFSDASSDMVDYHLATIFRALNAGDNYLRIQEDNLRGSASSVDVTT  435
             GWL Q +  P+IDVFS ++ DMVDY+L+ +F+AL + DNY+RIQ+ +L GS SSVDV+T
Sbjct  57   FGWLFQRNSTPIIDVFSQSNQDMVDYYLSVVFQALQSQDNYIRIQDQSLTGSTSSVDVST  116

Query  436  TENLNALEQIGKNLLKKAVSKLDILTRQYEPIEGAGTNQDALKRFAKLLSDEKKRRIA  609
              NLN L  IG+NLLK   S++++ T   EP+   GTN+DALK+FAKLLSDE+K R A
Sbjct  117  KRNLNDLINIGQNLLKAPFSRVNLQTGNSEPVINGGTNEDALKKFAKLLSDEQKLRKA  174



Lambda      K        H        a         alpha
   0.314    0.130    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520