BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005D04 658 bp,

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627128.1|  PREDICTED: methylthioribose-1-phosphate isom...    336   1e-111   Nicotiana tomentosiformis
ref|XP_009781605.1|  PREDICTED: methylthioribose-1-phosphate isom...    335   3e-111   Nicotiana sylvestris
ref|XP_006346696.1|  PREDICTED: methylthioribose-1-phosphate isom...    335   3e-111   Solanum tuberosum [potatoes]
ref|XP_004244859.1|  PREDICTED: methylthioribose-1-phosphate isom...    333   1e-110   Solanum lycopersicum
gb|KJB82985.1|  hypothetical protein B456_013G223100                    328   4e-110   Gossypium raimondii
gb|KHG04432.1|  Methylthioribose-1-phosphate isomerase                  332   7e-110   Gossypium arboreum [tree cotton]
gb|KDP33930.1|  hypothetical protein JCGZ_07501                         330   4e-109   Jatropha curcas
gb|KJB82983.1|  hypothetical protein B456_013G223100                    328   4e-109   Gossypium raimondii
ref|XP_007012613.1|  NagB/RpiA/CoA transferase-like superfamily p...    331   6e-109   Theobroma cacao [chocolate]
ref|XP_002516257.1|  Methylthioribose-1-phosphate isomerase, puta...    329   6e-109   Ricinus communis
ref|XP_010412762.1|  PREDICTED: methylthioribose-1-phosphate isom...    329   6e-109   Camelina sativa [gold-of-pleasure]
gb|KJB82981.1|  hypothetical protein B456_013G223100                    328   2e-108   Gossypium raimondii
ref|XP_011078119.1|  PREDICTED: methylthioribose-1-phosphate isom...    328   2e-108   Sesamum indicum [beniseed]
gb|KJB82984.1|  hypothetical protein B456_013G223100                    327   2e-108   Gossypium raimondii
gb|EYU28322.1|  hypothetical protein MIMGU_mgv1a008441mg                327   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_010467106.1|  PREDICTED: methylthioribose-1-phosphate isom...    327   3e-108   Camelina sativa [gold-of-pleasure]
ref|XP_007012614.1|  NagB/RpiA/CoA transferase-like superfamily p...    330   5e-108   Theobroma cacao [chocolate]
ref|XP_010488779.1|  PREDICTED: methylthioribose-1-phosphate isom...    327   5e-108   Camelina sativa [gold-of-pleasure]
ref|XP_002883712.1|  eukaryotic translation initiation factor 2B ...    326   1e-107   Arabidopsis lyrata subsp. lyrata
ref|XP_010666847.1|  PREDICTED: methylthioribose-1-phosphate isom...    325   4e-107   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007202151.1|  hypothetical protein PRUPE_ppa007089mg             324   6e-107   Prunus persica
ref|XP_009337200.1|  PREDICTED: methylthioribose-1-phosphate isom...    324   7e-107   Pyrus x bretschneideri [bai li]
ref|XP_008388900.1|  PREDICTED: methylthioribose-1-phosphate isom...    323   1e-106   Malus domestica [apple tree]
ref|XP_006396133.1|  hypothetical protein EUTSA_v10002579mg             322   2e-106   Eutrema salsugineum
ref|NP_001077883.1|  methylthioribose-1-phosphate isomerase             321   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973428.1|  methylthioribose-1-phosphate isomerase                320   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242258.1|  PREDICTED: methylthioribose-1-phosphate isom...    322   3e-106   Prunus mume [ume]
ref|XP_008337840.1|  PREDICTED: methylthioribose-1-phosphate isom...    322   5e-106   Malus domestica [apple tree]
ref|XP_010090181.1|  Methylthioribose-1-phosphate isomerase             321   9e-106   Morus notabilis
gb|KFK39882.1|  hypothetical protein AALP_AA3G300900                    320   2e-105   Arabis alpina [alpine rockcress]
ref|NP_027726.1|  methylthioribose-1-phosphate isomerase                320   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166700.1|  PREDICTED: methylthioribose-1-phosphate isom...    318   2e-105   
gb|AAM65143.1|  putative translation initiation factor eIF-2B alp...    319   4e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03069.1|  unnamed protein product                                319   5e-105   Coffea canephora [robusta coffee]
ref|XP_006280656.1|  hypothetical protein CARUB_v10026616mg             318   6e-105   Capsella rubella
emb|CDY33397.1|  BnaA07g04420D                                          318   7e-105   Brassica napus [oilseed rape]
ref|XP_009102357.1|  PREDICTED: methylthioribose-1-phosphate isom...    318   7e-105   Brassica rapa
emb|CDY70356.1|  BnaCnng67980D                                          318   8e-105   Brassica napus [oilseed rape]
gb|KHN12290.1|  Methylthioribose-1-phosphate isomerase                  318   1e-104   Glycine soja [wild soybean]
ref|XP_008450940.1|  PREDICTED: methylthioribose-1-phosphate isom...    318   1e-104   Cucumis melo [Oriental melon]
gb|KGN66312.1|  hypothetical protein Csa_1G597100                       317   3e-104   Cucumis sativus [cucumbers]
ref|XP_004144039.1|  PREDICTED: methylthioribose-1-phosphate isom...    317   4e-104   
ref|XP_010047466.1|  PREDICTED: methylthioribose-1-phosphate isom...    316   7e-104   Eucalyptus grandis [rose gum]
ref|XP_004488081.1|  PREDICTED: methylthioribose-1-phosphate isom...    316   7e-104   Cicer arietinum [garbanzo]
ref|XP_010261799.1|  PREDICTED: methylthioribose-1-phosphate isom...    316   7e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009359722.1|  PREDICTED: methylthioribose-1-phosphate isom...    316   7e-104   Pyrus x bretschneideri [bai li]
gb|AES65569.2|  methylthioribose-1-phosphate isomerase                  316   7e-104   Medicago truncatula
ref|XP_003595318.1|  Methylthioribose-1-phosphate isomerase             316   1e-103   
ref|XP_010541997.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    315   2e-103   Tarenaya hassleriana [spider flower]
ref|XP_004287647.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   3e-103   Fragaria vesca subsp. vesca
ref|XP_011019339.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   3e-103   Populus euphratica
ref|XP_006452823.1|  hypothetical protein CICLE_v10008682mg             314   3e-103   Citrus clementina
gb|KDO73879.1|  hypothetical protein CISIN_1g017293mg                   313   4e-103   Citrus sinensis [Valencia orange]
ref|XP_006474713.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   6e-103   Citrus sinensis [Valencia orange]
ref|XP_006452822.1|  hypothetical protein CICLE_v10008682mg             313   6e-103   Citrus clementina
gb|KDO73876.1|  hypothetical protein CISIN_1g017293mg                   313   7e-103   Citrus sinensis [Valencia orange]
ref|XP_002308521.2|  eukaryotic translation initiation factor 2B ...    313   7e-103   Populus trichocarpa [western balsam poplar]
ref|XP_004979099.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   9e-103   Setaria italica
gb|KCW79381.1|  hypothetical protein EUGRSUZ_C00793                     315   3e-102   Eucalyptus grandis [rose gum]
sp|B6TZD1.1|MTNA_MAIZE  RecName: Full=Methylthioribose-1-phosphat...    311   6e-102   Zea mays [maize]
ref|XP_010930603.1|  PREDICTED: methylthioribose-1-phosphate isom...    311   9e-102   Elaeis guineensis
ref|NP_001105275.1|  methylthioribose-1-phosphate isomerase             309   3e-101   Zea mays [maize]
ref|XP_008786516.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    309   4e-101   Phoenix dactylifera
gb|ACG37871.1|  methylthioribose-1-phosphate isomerase                  309   4e-101   Zea mays [maize]
ref|XP_006662829.1|  PREDICTED: methylthioribose-1-phosphate isom...    308   6e-101   Oryza brachyantha
sp|Q9AYT7.1|MTNA_HORVU  RecName: Full=Methylthioribose-1-phosphat...    307   1e-100   Hordeum vulgare [barley]
dbj|BAJ86257.1|  predicted protein                                      307   1e-100   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007138649.1|  hypothetical protein PHAVU_009G226400g             307   2e-100   Phaseolus vulgaris [French bean]
ref|XP_002277806.1|  PREDICTED: methylthioribose-1-phosphate isom...    306   4e-100   Vitis vinifera
gb|EMS50123.1|  Methylthioribose-1-phosphate isomerase                  306   5e-100   Triticum urartu
emb|CBI27788.3|  unnamed protein product                                306   1e-99    Vitis vinifera
ref|XP_003577698.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   2e-99    Brachypodium distachyon [annual false brome]
gb|EMT32201.1|  Methylthioribose-1-phosphate isomerase                  305   9e-99    Aegilops tauschii
ref|XP_009406483.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
sp|A2ZCP0.1|MTNA_ORYSI  RecName: Full=Methylthioribose-1-phosphat...    302   2e-98    Oryza sativa Indica Group [Indian rice]
ref|NP_001067511.1|  Os11g0216900                                       302   2e-98    
gb|EPS64192.1|  methylthioribose-1-phosphate isomerase                  299   1e-97    Genlisea aurea
gb|ABA92066.2|  Initiation factor 2 subunit family protein, expre...    301   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KHG23802.1|  Methylthioribose-1-phosphate isomerase                  287   9e-95    Gossypium arboreum [tree cotton]
gb|ADE77025.1|  unknown                                                 288   1e-92    Picea sitchensis
ref|XP_006842716.1|  hypothetical protein AMTR_s00147p00099160          287   1e-92    Amborella trichopoda
gb|KJB07315.1|  hypothetical protein B456_001G015800                    280   6e-91    Gossypium raimondii
gb|KJB07314.1|  hypothetical protein B456_001G015800                    281   8e-91    Gossypium raimondii
ref|XP_002967758.1|  hypothetical protein SELMODRAFT_87975              276   2e-88    Selaginella moellendorffii
ref|XP_002992382.1|  hypothetical protein SELMODRAFT_135203             276   2e-88    Selaginella moellendorffii
ref|XP_001754539.1|  predicted protein                                  275   4e-88    Physcomitrella patens
emb|CBV37018.1|  5-methylthioribose-1-phosphate isomerase               251   2e-81    Plantago major [cart-track plant]
gb|KHN06061.1|  Methylthioribose-1-phosphate isomerase                  251   3e-80    Glycine soja [wild soybean]
ref|XP_003218379.1|  PREDICTED: methylthioribose-1-phosphate isom...    248   3e-77    Anolis carolinensis [Carolina anole]
ref|XP_001604505.1|  PREDICTED: methylthioribose-1-phosphate isom...    244   3e-76    Nasonia vitripennis
ref|XP_006621213.1|  PREDICTED: methylthioribose-1-phosphate isom...    244   7e-76    Apis dorsata [rock honeybee]
ref|XP_392553.1|  PREDICTED: methylthioribose-1-phosphate isomera...    243   2e-75    Apis mellifera [European honey bee]
ref|XP_003697763.1|  PREDICTED: methylthioribose-1-phosphate isom...    243   2e-75    
gb|EPY88013.1|  hypothetical protein CB1_000201003                      239   2e-75    Camelus ferus
ref|XP_001742754.1|  hypothetical protein                               243   2e-75    Monosiga brevicollis MX1
ref|XP_011052943.1|  PREDICTED: methylthioribose-1-phosphate isom...    242   4e-75    Acromyrmex echinatior
ref|XP_003760740.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   5e-75    Sarcophilus harrisii
ref|XP_006003718.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   6e-75    Latimeria chalumnae
ref|XP_005310723.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   8e-75    Chrysemys picta bellii
ref|XP_004993054.1|  methylthioribose-1-phosphate isomerase             242   8e-75    Salpingoeca rosetta
ref|XP_003700639.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   9e-75    Megachile rotundata
emb|CAD27760.1|  putative translation initiation factor                 240   1e-74    Anopheles gambiae
ref|XP_321518.1|  AGAP001589-PA                                         240   1e-74    Anopheles gambiae str. PEST
ref|XP_004530069.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   1e-74    Ceratitis capitata
ref|XP_006175447.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   1e-74    Camelus ferus
ref|XP_010992133.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   2e-74    Camelus dromedarius [camel]
ref|XP_010952462.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   2e-74    Camelus bactrianus [camel]
ref|XP_001510432.2|  PREDICTED: methylthioribose-1-phosphate isom...    239   2e-74    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_006918814.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   2e-74    Pteropus alecto
ref|XP_011380861.1|  PREDICTED: methylthioribose-1-phosphate isom...    240   2e-74    Pteropus vampyrus
ref|XP_003486247.1|  PREDICTED: methylthioribose-1-phosphate isom...    239   3e-74    Bombus impatiens
ref|XP_003397603.1|  PREDICTED: methylthioribose-1-phosphate isom...    239   3e-74    Bombus terrestris [large earth bumblebee]
gb|EHJ70136.1|  eIF2B-alpha-like protein                                239   3e-74    Danaus plexippus [American monarch]
ref|XP_007422307.1|  PREDICTED: methylthioribose-1-phosphate isom...    239   4e-74    Python bivittatus
ref|XP_011143671.1|  PREDICTED: methylthioribose-1-phosphate isom...    238   8e-74    Harpegnathos saltator
ref|XP_006206282.1|  PREDICTED: methylthioribose-1-phosphate isom...    238   1e-73    Vicugna pacos
gb|KIW51203.1|  S-methyl-5-thioribose-1-phosphate isomerase             239   1e-73    Exophiala xenobiotica
ref|XP_006262838.1|  PREDICTED: methylthioribose-1-phosphate isom...    239   2e-73    Alligator mississippiensis
emb|CDS04006.1|  hypothetical protein LRAMOSA06961                      238   2e-73    Lichtheimia ramosa
ref|XP_006023465.1|  PREDICTED: methylthioribose-1-phosphate isom...    238   2e-73    Alligator sinensis
ref|XP_002072272.1|  GK22419                                            238   2e-73    Drosophila willistoni
gb|KEQ63615.1|  Methylthioribose-1-phosphate isomerase                  238   3e-73    Aureobasidium melanogenum CBS 110374
gb|ETN63911.1|  translation initiation factor eif-2b                    237   3e-73    Anopheles darlingi [American malaria mosquito]
gb|KEQ71351.1|  Methylthioribose-1-phosphate isomerase                  238   3e-73    Aureobasidium namibiae CBS 147.97
ref|XP_002733184.1|  PREDICTED: methylthioribose-1-phosphate isom...    237   3e-73    Saccoglossus kowalevskii
ref|XP_001993776.1|  GH21593                                            237   5e-73    Drosophila grimshawi
ref|XP_001357949.1|  GA10928                                            236   5e-73    Drosophila pseudoobscura pseudoobscura
ref|XP_003798062.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   6e-73    Otolemur garnettii
ref|XP_011184740.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   6e-73    Bactrocera cucurbitae [melon fruit fly]
ref|XP_003639811.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    237   6e-73    
ref|XP_001641945.1|  predicted protein                                  236   6e-73    Nematostella vectensis
ref|XP_002023756.1|  GL27236                                            236   6e-73    Drosophila persimilis
ref|XP_005336293.1|  PREDICTED: methylthioribose-1-phosphate isom...    237   6e-73    Ictidomys tridecemlineatus
ref|XP_004009303.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    234   7e-73    
ref|XP_011210381.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   7e-73    Bactrocera dorsalis
ref|XP_011166414.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   7e-73    Solenopsis invicta [imported red fire ant]
ref|XP_005615138.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    234   7e-73    Equus caballus [domestic horse]
gb|KEQ84160.1|  Methylthioribose-1-phosphate isomerase                  237   9e-73    Aureobasidium pullulans EXF-150
ref|XP_003123394.2|  PREDICTED: methylthioribose-1-phosphate isom...    237   9e-73    
ref|XP_006900885.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    236   9e-73    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006874338.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   1e-72    Chrysochloris asiatica
ref|XP_001953494.1|  GF17194                                            236   1e-72    Drosophila ananassae
gb|KEQ98081.1|  hypothetical protein AUEXF2481DRAFT_63242               236   1e-72    Aureobasidium subglaciale EXF-2481
ref|XP_007098210.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   1e-72    Panthera tigris altaica
ref|XP_004399024.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   1e-72    Odobenus rosmarus divergens
ref|XP_007737063.1|  S-methyl-5-thioribose-1-phosphate isomerase        236   2e-72    Capronia epimyces CBS 606.96
ref|XP_010740335.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   2e-72    Larimichthys crocea [croceine croaker]
gb|EFN81802.1|  Translation initiation factor eIF-2B subunit alph...    235   2e-72    Harpegnathos saltator
ref|XP_005336292.1|  PREDICTED: methylthioribose-1-phosphate isom...    237   2e-72    
ref|XP_003982003.3|  PREDICTED: methylthioribose-1-phosphate isom...    235   2e-72    Felis catus [cat]
ref|XP_001664017.1|  AAEL013828-PA                                      235   2e-72    Aedes aegypti
emb|CDH49387.1|  methylthioribose-1-phosphate isomerase                 236   2e-72    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006779623.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    232   2e-72    
ref|XP_008505941.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   2e-72    Equus przewalskii [Przewalski horse]
ref|XP_004389786.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   2e-72    Trichechus manatus latirostris
ref|XP_005185612.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   2e-72    Musca domestica
gb|KIX06934.1|  S-methyl-5-thioribose-1-phosphate isomerase             236   2e-72    Rhinocladiella mackenziei CBS 650.93
ref|XP_005682375.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    234   3e-72    
gb|EHH29705.1|  Methylthioribose-1-phosphate isomerase                  235   3e-72    Macaca mulatta [rhesus macaque]
ref|XP_004748335.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    236   3e-72    
ref|XP_010359906.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   3e-72    Rhinopithecus roxellana
ref|XP_008965945.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    234   3e-72    Pan paniscus [bonobo]
ref|XP_006993155.1|  PREDICTED: methylthioribose-1-phosphate isom...    235   3e-72    Peromyscus maniculatus bairdii
ref|XP_003389526.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   3e-72    Amphimedon queenslandica
ref|NP_001010947.1|  methylthioribose-1-phosphate isomerase             234   4e-72    Rattus norvegicus [brown rat]
ref|XP_002054225.1|  GJ22917                                            234   4e-72    Drosophila virilis
ref|XP_009152452.1|  S-methyl-5-thioribose-1-phosphate isomerase        235   5e-72    Exophiala dermatitidis NIH/UT8656
ref|NP_080699.3|  methylthioribose-1-phosphate isomerase                234   5e-72    Mus musculus [mouse]
ref|XP_005881674.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    232   5e-72    
ref|XP_004688304.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   6e-72    Condylura cristata
ref|XP_002001025.1|  GI10562                                            234   6e-72    Drosophila mojavensis
ref|XP_004672487.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   6e-72    Jaculus jaculus
ref|XP_001366752.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   6e-72    Monodelphis domestica
ref|XP_003915067.2|  PREDICTED: methylthioribose-1-phosphate isom...    234   6e-72    Papio anubis [Doguera baboon]
ref|XP_003972078.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   7e-72    Takifugu rubripes [tiger puffer]
ref|XP_004715550.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   8e-72    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004066207.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   8e-72    Oryzias latipes [Japanese rice fish]
ref|XP_002761866.2|  PREDICTED: methylthioribose-1-phosphate isom...    234   9e-72    Callithrix jacchus [common marmoset]
ref|XP_003455807.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   9e-72    Oreochromis niloticus
ref|XP_007993674.1|  PREDICTED: methylthioribose-1-phosphate isom...    234   9e-72    Chlorocebus sabaeus
ref|XP_004060186.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   9e-72    Gorilla gorilla gorilla [lowland gorilla]
gb|AIC57312.1|  MRI1                                                    233   1e-71    synthetic construct
ref|XP_011166413.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   1e-71    Solenopsis invicta [imported red fire ant]
gb|AEE61699.1|  unknown                                                 233   1e-71    Dendroctonus ponderosae
ref|NP_001026897.1|  methylthioribose-1-phosphate isomerase isofo...    233   1e-71    Homo sapiens [man]
ref|XP_008156200.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   1e-71    Eptesicus fuscus
ref|XP_009235038.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    233   1e-71    Pongo abelii [Orang-utan]
gb|KIW17463.1|  S-methyl-5-thioribose-1-phosphate isomerase             234   1e-71    Exophiala spinifera
ref|XP_007780227.1|  methylthioribose-1-phosphate isomerase             234   1e-71    Coniosporium apollinis CBS 100218
ref|XP_006100374.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    233   1e-71    Myotis lucifugus
ref|XP_003501976.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   1e-71    Cricetulus griseus [Chinese hamsters]
ref|XP_003468199.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   1e-71    Cavia porcellus [guinea pig]
ref|XP_002921063.2|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    234   2e-71    Ailuropoda melanoleuca
ref|XP_008315471.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   2e-71    Cynoglossus semilaevis
ref|XP_003275653.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   2e-71    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_008315470.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   2e-71    Cynoglossus semilaevis
ref|NP_001037650.1|  methylthioribose-1-phosphate isomerase             232   2e-71    Bombyx mori [silk moth]
ref|XP_008853656.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-71    Nannospalax galili
ref|XP_005805132.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-71    Xiphophorus maculatus
ref|XP_009433120.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-71    
ref|XP_969152.1|  PREDICTED: methylthioribose-1-phosphate isomerase     232   3e-71    Tribolium castaneum [rust-red flour beetle]
ref|NP_001039852.1|  methylthioribose-1-phosphate isomerase             232   3e-71    Bos taurus [bovine]
dbj|GAA90121.1|  translation initiation factor                          231   3e-71    Aspergillus kawachii IFO 4308
ref|XP_007570269.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-71    Poecilia formosa
ref|XP_005370998.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-71    Microtus ochrogaster [prairie voles]
ref|XP_010327857.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   3e-71    Saimiri boliviensis boliviensis
pdb|4LDR|A  Chain A, Structure Of The S283y Mutant Of Mrdi              232   3e-71    Homo sapiens [man]
gb|ERL94382.1|  hypothetical protein D910_11661                         233   4e-71    Dendroctonus ponderosae
ref|XP_007952565.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   5e-71    Orycteropus afer afer
ref|XP_008724306.1|  S-methyl-5-thioribose-1-phosphate isomerase        233   5e-71    Cladophialophora carrionii CBS 160.54
ref|XP_003726311.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    232   5e-71    Strongylocentrotus purpuratus [purple urchin]
gb|EHH59270.1|  Methylthioribose-1-phosphate isomerase                  232   5e-71    Macaca fascicularis [crab eating macaque]
ref|XP_008564259.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   5e-71    Galeopterus variegatus [Malayan flying lemur]
ref|NP_001104708.1|  methylthioribose-1-phosphate isomerase             231   6e-71    Danio rerio [leopard danio]
ref|XP_010591802.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   6e-71    Loxodonta africana [African bush elephant]
ref|XP_007753953.1|  S-methyl-5-thioribose-1-phosphate isomerase        232   6e-71    Cladophialophora yegresii CBS 114405
ref|XP_008546891.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   6e-71    Microplitis demolitor
dbj|BAC33016.1|  unnamed protein product                                231   6e-71    Mus musculus [mouse]
ref|XP_004616861.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   7e-71    Sorex araneus [Eurasian shrew]
ref|XP_004635691.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   7e-71    Octodon degus
gb|EHA19257.1|  hypothetical protein ASPNIDRAFT_54270                   231   7e-71    Aspergillus niger ATCC 1015
gb|KIV77933.1|  S-methyl-5-thioribose-1-phosphate isomerase             232   8e-71    Exophiala sideris
ref|XP_001943893.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   8e-71    Acyrthosiphon pisum
ref|XP_002037477.1|  GM12085                                            231   8e-71    Drosophila sechellia
ref|XP_010870944.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   8e-71    
ref|XP_002105622.1|  GD16414                                            231   8e-71    
gb|KDR24083.1|  Methylthioribose-1-phosphate isomerase                  231   9e-71    Zootermopsis nevadensis
ref|XP_011342004.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   1e-70    Cerapachys biroi
ref|XP_006079940.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   1e-70    Bubalus bubalis [domestic water buffalo]
ref|XP_005888077.1|  PREDICTED: methylthioribose-1-phosphate isom...    230   1e-70    Bos mutus
gb|KFB37657.1|  AGAP001589-PA-like protein                              230   1e-70    Anopheles sinensis
gb|KIX97693.1|  hypothetical protein Z520_06471                         231   1e-70    Fonsecaea multimorphosa CBS 102226
gb|ELR62033.1|  Methylthioribose-1-phosphate isomerase                  230   2e-70    Bos mutus
ref|XP_004595907.1|  PREDICTED: methylthioribose-1-phosphate isom...    230   2e-70    Ochotona princeps [southern American pika]
ref|XP_005962906.1|  PREDICTED: methylthioribose-1-phosphate isom...    230   2e-70    Pantholops hodgsonii
ref|XP_010759673.1|  methylthioribose-1-phosphate isomerase             231   2e-70    Paracoccidioides brasiliensis Pb18
ref|XP_011496297.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   2e-70    Ceratosolen solmsi marchali
ref|NP_001090076.1|  methylthioribose-1-phosphate isomerase             229   2e-70    Xenopus laevis [clawed frog]
ref|XP_007720298.1|  S-methyl-5-thioribose-1-phosphate isomerase        231   2e-70    Capronia coronata CBS 617.96
gb|EFX71518.1|  hypothetical protein DAPPUDRAFT_308831                  229   3e-70    Daphnia pulex
sp|C0P108.1|MTNA_AJECG  RecName: Full=Methylthioribose-1-phosphat...    231   3e-70    Histoplasma capsulatum G186AR
ref|XP_002724279.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   3e-70    Oryctolagus cuniculus [European rabbit]
gb|KEF62771.1|  S-methyl-5-thioribose-1-phosphate isomerase             230   3e-70    Exophiala aquamarina CBS 119918
ref|XP_005855554.1|  methylthioribose-1-phosphate isomerase             240   3e-70    Nannochloropsis gaditana CCMP526
ref|NP_651868.1|  CG11334, isoform B                                    229   3e-70    Drosophila melanogaster
ref|XP_008709946.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   3e-70    Ursus maritimus [white bear]
ref|XP_010611767.1|  PREDICTED: methylthioribose-1-phosphate isom...    228   3e-70    Fukomys damarensis [Damara mole rat]
ref|XP_002099512.1|  GE23315                                            229   3e-70    Drosophila yakuba
gb|KIW42782.1|  S-methyl-5-thioribose-1-phosphate isomerase             230   4e-70    Exophiala oligosperma
ref|XP_007229603.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   4e-70    Astyanax mexicanus [blind cave fish]
gb|EWM30107.1|  Methylthioribose kinase                                 239   4e-70    Nannochloropsis gaditana
ref|XP_001981082.1|  GG11866                                            229   5e-70    Drosophila erecta
ref|XP_001540232.1|  hypothetical protein HCAG_04072                    230   5e-70    Histoplasma capsulatum NAm1
ref|XP_004448805.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   5e-70    Dasypus novemcinctus
gb|KIW71970.1|  S-methyl-5-thioribose-1-phosphate isomerase             229   6e-70    Capronia semi-immersa
dbj|GAE00299.1|  translation initiation factor, putative                229   7e-70    Byssochlamys spectabilis No. 5
sp|Q0VFN1.1|MTNA_XENTR  RecName: Full=Methylthioribose-1-phosphat...    228   7e-70    Xenopus tropicalis [western clawed frog]
ref|XP_004872495.1|  PREDICTED: methylthioribose-1-phosphate isom...    228   7e-70    Heterocephalus glaber [naked mole rat]
ref|NP_001016877.1|  methylthioribose-1-phosphate isomerase             228   7e-70    Xenopus tropicalis [western clawed frog]
gb|EHB14460.1|  Methylthioribose-1-phosphate isomerase                  228   9e-70    Heterocephalus glaber [naked mole rat]
ref|XP_004327551.1|  PREDICTED: methylthioribose-1-phosphate isom...    228   1e-69    Tursiops truncatus [Atlantic bottle-nosed dolphin]
emb|CBY10943.1|  unnamed protein product                                227   1e-69    Oikopleura dioica
gb|KIW26197.1|  S-methyl-5-thioribose-1-phosphate isomerase             229   1e-69    Cladophialophora immunda
ref|XP_009056765.1|  hypothetical protein LOTGIDRAFT_190615             229   1e-69    Lottia gigantea
gb|KJE93735.1|  translation initiation factor eif-2b                    228   2e-69    Capsaspora owczarzaki ATCC 30864
ref|XP_005381122.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   2e-69    Chinchilla lanigera
gb|AII98097.1|  BLTX771                                                 223   2e-69    Nephila pilipes
ref|XP_004903067.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   2e-69    
ref|XP_007129465.1|  PREDICTED: methylthioribose-1-phosphate isom...    228   3e-69    Physeter catodon
ref|XP_001933231.1|  methylthioribose-1-phosphate isomerase             228   3e-69    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_004277483.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   4e-69    Orcinus orca [Orca]
ref|XP_007681661.1|  hypothetical protein BAUCODRAFT_319460             227   4e-69    Baudoinia panamericana UAMH 10762
ref|XP_007744831.1|  S-methyl-5-thioribose-1-phosphate isomerase        227   5e-69    Cladophialophora psammophila CBS 110553
ref|XP_011303133.1|  PREDICTED: methylthioribose-1-phosphate isom...    226   5e-69    Fopius arisanus
gb|KIW94717.1|  S-methyl-5-thioribose-1-phosphate isomerase             227   6e-69    Cladophialophora bantiana CBS 173.52
gb|KIW83076.1|  S-methyl-5-thioribose-1-phosphate isomerase             226   9e-69    Fonsecaea pedrosoi CBS 271.37
ref|XP_001216022.1|  hypothetical protein ATEG_07401                    226   1e-68    Aspergillus terreus NIH2624
ref|XP_007469132.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    227   1e-68    Lipotes vexillifer [baiji]
gb|ELK32054.1|  Coiled-coil domain-containing protein 130               232   1e-68    Myotis davidii
ref|XP_001865446.1|  translation initiation factor eif-2b               224   1e-68    
emb|CBY31516.1|  unnamed protein product                                224   2e-68    
gb|EGC42562.1|  translation initiation factor                           225   3e-68    
gb|EKG14703.1|  Initiation factor 2B-related protein                    225   3e-68    
gb|KGQ02006.1|  methylthioribose-1-phosphate isomerase                  225   3e-68    
ref|XP_007182139.1|  PREDICTED: methylthioribose-1-phosphate isom...    225   6e-68    
sp|C0S1C8.1|MTNA_PARBP  RecName: Full=Methylthioribose-1-phosphat...    224   7e-68    
ref|XP_001418690.1|  predicted protein                                  223   8e-68    
ref|XP_005850664.1|  hypothetical protein CHLNCDRAFT_140697             233   8e-68    
gb|EIE81164.1|  S-methyl-5-thioribose-1-phosphate isomerase             223   9e-68    
ref|XP_008719411.1|  S-methyl-5-thioribose-1-phosphate isomerase        224   9e-68    
ref|XP_002151818.1|  translation initiation factor, putative            224   9e-68    
dbj|GAM36840.1|  hypothetical protein TCE0_022f06253                    224   9e-68    
gb|KIV94203.1|  S-methyl-5-thioribose-1-phosphate isomerase             224   1e-67    
ref|XP_002627028.1|  S-methyl-5-thioribose-1-phosphate isomerase        223   1e-67    
ref|XP_007066406.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    221   2e-67    
sp|C5GGE5.1|MTNA_AJEDR  RecName: Full=Methylthioribose-1-phosphat...    223   3e-67    
ref|XP_007632876.1|  PREDICTED: methylthioribose-1-phosphate isom...    219   3e-67    
ref|XP_003296469.1|  hypothetical protein PTT_06581                     223   3e-67    
ref|XP_661894.1|  hypothetical protein AN4290.2                         222   3e-67    
ref|XP_008031489.1|  hypothetical protein SETTUDRAFT_166325             222   4e-67    
ref|XP_011262788.1|  PREDICTED: methylthioribose-1-phosphate isom...    221   5e-67    
gb|AFK48892.1|  unknown                                                 219   7e-67    
ref|XP_010952465.1|  PREDICTED: methylthioribose-1-phosphate isom...    219   9e-67    
ref|XP_003850691.1|  hypothetical protein MYCGRDRAFT_73955              221   1e-66    
gb|KIW03172.1|  S-methyl-5-thioribose-1-phosphate isomerase             221   1e-66    
ref|XP_002480786.1|  translation initiation factor, putative            221   2e-66    
emb|CAG06038.1|  unnamed protein product                                219   2e-66    
gb|EMD90991.1|  hypothetical protein COCHEDRAFT_1176662                 220   2e-66    
ref|XP_010952464.1|  PREDICTED: methylthioribose-1-phosphate isom...    219   2e-66    
emb|CEI86534.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    220   2e-66    
ref|XP_006962902.1|  hypothetical protein TRIREDRAFT_75304              219   3e-66    
dbj|GAM84914.1|  hypothetical protein ANO11243_029160                   220   3e-66    
gb|EUN32000.1|  hypothetical protein COCVIDRAFT_86317                   220   3e-66    
ref|XP_007691907.1|  hypothetical protein COCMIDRAFT_105818             220   3e-66    
ref|XP_007708817.1|  hypothetical protein COCCADRAFT_2167               220   3e-66    
emb|CEF98703.1|  Putative translation initiation factor,aIF-2BI/5...    228   3e-66    
gb|EMF09885.1|  methylthioribose-1-phosphate isomerase                  220   3e-66    
ref|XP_007929107.1|  hypothetical protein MYCFIDRAFT_204427             219   3e-66    
gb|ELU04603.1|  hypothetical protein CAPTEDRAFT_225838                  218   4e-66    
ref|XP_003833699.1|  hypothetical protein LEMA_P064600.1                222   5e-66    
ref|XP_004348313.2|  translation initiation factor eif-2b               219   5e-66    
ref|XP_001820594.2|  methylthioribose-1-phosphate isomerase             218   7e-66    
ref|XP_006621214.1|  PREDICTED: methylthioribose-1-phosphate isom...    217   9e-66    
gb|EFN63924.1|  Translation initiation factor eIF-2B subunit alph...    218   9e-66    
ref|XP_001271470.1|  translation initiation factor, putative            218   1e-65    
ref|XP_002107955.1|  hypothetical protein TRIADDRAFT_19292              218   1e-65    
gb|EIT82996.1|  putative translation initiation factor                  218   1e-65    
ref|XP_002424016.1|  conserved hypothetical protein                     218   1e-65    
emb|CEG65982.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    218   1e-65    
sp|Q2UIM3.1|MTNA_ASPOR  RecName: Full=Methylthioribose-1-phosphat...    218   1e-65    
ref|XP_003057882.1|  translation initiation factor fusion with me...    227   1e-65    
ref|XP_010568132.1|  PREDICTED: coiled-coil domain-containing pro...    226   1e-65    
gb|KGO76677.1|  Initiation factor 2B alpha/beta/delta                   218   1e-65    
ref|XP_003080319.1|  methylthioribose kinase (ISS)                      228   1e-65    
ref|XP_002679019.1|  predicted protein                                  218   2e-65    
gb|KGO39130.1|  Initiation factor 2B alpha/beta/delta                   218   2e-65    
gb|EQD24052.1|  hypothetical protein D084_Lepto4C00613G0001             216   2e-65    
emb|CEJ01322.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    218   2e-65    
ref|XP_001226203.1|  hypothetical protein CHGG_10936                    218   2e-65    
ref|XP_007702121.1|  hypothetical protein COCSADRAFT_38815              218   2e-65    
ref|XP_006560809.1|  PREDICTED: methylthioribose-1-phosphate isom...    216   2e-65    
ref|XP_001267437.1|  translation initiation factor, putative            218   2e-65    
gb|EKV08512.1|  Methylthioribose-1-phosphate isomerase                  217   3e-65    
ref|XP_003654207.1|  hypothetical protein THITE_2117012                 217   3e-65    
emb|CDM34949.1|  Methylthioribose-1-phosphate isomerase                 217   4e-65    
ref|XP_001199953.2|  PREDICTED: methylthioribose-1-phosphate isom...    215   5e-65    
gb|EYE93514.1|  Methylthioribose-1-phosphate isomerase                  216   5e-65    
ref|XP_002842304.1|  hypothetical protein                               216   5e-65    
ref|XP_005648557.1|  hypothetical protein COCSUDRAFT_65695              229   5e-65    
emb|CCX34105.1|  Similar to Methylthioribose-1-phosphate isomeras...    216   5e-65    
gb|EME39638.1|  hypothetical protein DOTSEDRAFT_75327                   216   9e-65    
ref|XP_007583690.1|  putative methylthioribose-1-phosphate isomer...    228   1e-64    
ref|XP_006690569.1|  putative translation initiation factor             216   1e-64    
ref|XP_007514904.1|  translation initiation factor, aIF-2BI family      224   1e-64    
gb|KIL92878.1|  methylthioribose-1-phosphate isomerase                  215   2e-64    
ref|XP_003665347.1|  hypothetical protein MYCTH_2135256                 215   2e-64    
gb|KIZ04682.1|  isopentenyl-diphosphate Delta-isomerase                 219   3e-64    
gb|EWG45098.1|  methylthioribose-1-phosphate isomerase                  215   3e-64    
dbj|GAN06082.1|  translation initiation factor                          214   3e-64    
gb|EWZ41170.1|  methylthioribose-1-phosphate isomerase                  215   3e-64    
gb|EGU81202.1|  hypothetical protein FOXB_08352                         215   3e-64    
gb|EMT60763.1|  Methylthioribose-1-phosphate isomerase                  215   3e-64    
gb|EXA01732.1|  methylthioribose-1-phosphate isomerase                  214   3e-64    
gb|EXA48565.1|  methylthioribose-1-phosphate isomerase                  214   3e-64    
gb|ENH63320.1|  Methylthioribose-1-phosphate isomerase                  214   3e-64    
ref|XP_008104502.1|  PREDICTED: methylthioribose-1-phosphate isom...    213   3e-64    
gb|KEY83965.1|  translation initiation factor                           214   3e-64    
emb|CCT63771.1|  probable cig2 protein (putative GDP-GTP exchange...    214   3e-64    
ref|XP_752241.1|  translation initiation factor                         214   3e-64    
gb|EGE01404.1|  S-methyl-5-thioribose-1-phosphate isomerase             214   4e-64    
ref|XP_011120963.1|  hypothetical protein AOL_s00076g108                214   5e-64    
ref|XP_001111047.1|  PREDICTED: methylthioribose-1-phosphate isom...    213   5e-64    
gb|EGD96919.1|  translation initiation factor                           214   6e-64    
ref|XP_003236958.1|  methylthioribose-1-phosphate isomerase             214   6e-64    
emb|CEP08072.1|  hypothetical protein                                   213   7e-64    
ref|XP_006531381.1|  PREDICTED: methylthioribose-1-phosphate isom...    212   8e-64    
gb|EPB91090.1|  S-methyl-5-thioribose-1-phosphate isomerase             214   8e-64    
ref|XP_005588259.1|  PREDICTED: methylthioribose-1-phosphate isom...    213   9e-64    
ref|XP_002560080.1|  Pc14g00860                                         213   1e-63    
ref|NP_596610.1|  methylthioribose-1-phosphate isomerase (predicted)    213   1e-63    
gb|EPS29452.1|  hypothetical protein PDE_04401                          213   1e-63    
gb|KGQ07769.1|  Methylthioribose-1-phosphate isomerase                  213   1e-63    
gb|KFM78652.1|  Methylthioribose-1-phosphate isomerase                  211   1e-63    
gb|KFH66789.1|  S-methyl-5-thioribose-1-phosphate isomerase             213   2e-63    
ref|WP_041772593.1|  methylthioribose-1-phosphate isomerase             211   2e-63    
ref|WP_038506986.1|  methylthioribose-1-phosphate isomerase             211   2e-63    
ref|XP_008596336.1|  S-methyl-5-thioribose-1-phosphate isomerase        213   2e-63    
ref|WP_036082877.1|  methylthioribose-1-phosphate isomerase             211   2e-63    
gb|EHK18155.1|  hypothetical protein TRIVIDRAFT_80802                   213   2e-63    
ref|XP_011323537.1|  hypothetical protein FGSG_05053                    213   2e-63    
ref|XP_003012717.1|  hypothetical protein ARB_00968                     214   2e-63    
ref|XP_002843502.1|  methylthioribose-1-phosphate isomerase             212   2e-63    
gb|AFS53499.1|  translation initiation factor, aIF-2BI/5-methylth...    211   3e-63    
ref|WP_042225012.1|  methylthioribose-1-phosphate isomerase             211   3e-63    
gb|EAY56266.1|  translation initiation factor, aIF-2BI/5-methylth...    211   3e-63    
ref|XP_008853657.1|  PREDICTED: methylthioribose-1-phosphate isom...    210   3e-63    
ref|XP_003172192.1|  methylthioribose-1-phosphate isomerase             212   3e-63    
gb|KGA93509.1|  Methylthioribose-1-phosphate isomerase                  211   3e-63    
ref|XP_008409355.1|  PREDICTED: methylthioribose-1-phosphate isom...    211   3e-63    
gb|EDZ38932.1|  Translation initiation factor, aIF-2BI/5- methylt...    211   3e-63    
ref|WP_041726234.1|  methylthioribose-1-phosphate isomerase             211   3e-63    
ref|WP_005998427.1|  methylthioribose-1-phosphate isomerase             211   4e-63    
gb|ADU64905.1|  translation initiation factor, aIF-2BI family           211   4e-63    
ref|XP_011454865.1|  PREDICTED: methylthioribose-1-phosphate isom...    211   4e-63    
gb|KFY36346.1|  hypothetical protein V494_05095                         213   7e-63    
ref|XP_001560925.1|  hypothetical protein BC1G_00010                    213   7e-63    
ref|XP_003008283.1|  methylthioribose-1-phosphate isomerase             211   7e-63    
ref|WP_027356529.1|  methylthioribose-1-phosphate isomerase             210   8e-63    
gb|ETS04646.1|  methylthioribose-1-phosphate isomerase                  211   8e-63    
ref|XP_009651895.1|  methylthioribose-1-phosphate isomerase             211   1e-62    
gb|EPY53630.1|  methylthioribose-1-phosphate isomerase                  210   1e-62    
ref|XP_002500043.1|  translation initiation factor fusion with me...    218   1e-62    
gb|EYB31804.1|  hypothetical protein FG05_05053                         210   1e-62    
gb|EFW99958.1|  translation initiation factor                           209   2e-62    
gb|KFY95305.1|  hypothetical protein V498_03420                         211   2e-62    
gb|EPX71175.1|  methylthioribose-1-phosphate isomerase                  209   2e-62    
ref|XP_002949511.1|  eukaryotic translation initiation factor 2B ...    211   2e-62    
gb|KFY12396.1|  hypothetical protein V492_03899                         212   2e-62    
emb|CCF43609.1|  S-methyl-5-thioribose-1-phosphate isomerase            207   2e-62    
ref|XP_006678377.1|  hypothetical protein BATDEDRAFT_19408              210   2e-62    
ref|XP_007275439.1|  methylthioribose-1-phosphate isomerase             210   2e-62    
gb|KFY24283.1|  hypothetical protein V493_05338                         211   2e-62    
ref|WP_027718288.1|  methylthioribose-1-phosphate isomerase             209   2e-62    
gb|KFY77341.1|  hypothetical protein V499_03240                         211   3e-62    
ref|WP_011878387.1|  methylthioribose-1-phosphate isomerase             208   3e-62    
gb|KFZ14857.1|  hypothetical protein V501_03036                         211   3e-62    
emb|CBJ48521.1|  eukaryotic translation initiation factor 2B fami...    217   3e-62    
ref|XP_003025058.1|  hypothetical protein TRV_00716                     213   4e-62    
ref|XP_002584032.1|  S-methyl-5-thioribose-1-phosphate isomerase        209   4e-62    
ref|XP_009853534.1|  hypothetical protein NEUTE1DRAFT_67681             209   4e-62    
gb|KFY51323.1|  hypothetical protein V496_08871                         211   4e-62    
ref|XP_959639.1|  methylthioribose-1-phosphate isomerase                209   4e-62    
ref|XP_005062441.1|  PREDICTED: methylthioribose-1-phosphate isom...    208   4e-62    
ref|WP_014795021.1|  MULTISPECIES: methylthioribose-1-phosphate i...    208   4e-62    
ref|XP_006666062.1|  methylthioribose-1-phosphate isomerase             209   5e-62    
ref|XP_007828445.1|  Methylthioribose-1-phosphate isomerase             209   6e-62    
gb|EWC46238.1|  hypothetical protein DRE_04409                          204   6e-62    
ref|XP_001240294.1|  hypothetical protein CIMG_07457                    207   7e-62    
gb|KFX97244.1|  hypothetical protein O988_04954                         210   7e-62    
gb|EQB52140.1|  S-methyl-5-thioribose-1-phosphate isomerase             208   8e-62    
sp|P0CI29.1|MTNA_SORMK  RecName: Full=Methylthioribose-1-phosphat...    208   9e-62    
ref|XP_003708706.1|  S-methyl-5-thioribose-1-phosphate isomerase        208   1e-61    
ref|WP_013810013.1|  methylthioribose-1-phosphate isomerase             207   1e-61    
ref|XP_005533667.1|  PREDICTED: methylthioribose-1-phosphate isom...    207   1e-61    
ref|WP_003542966.1|  methylthioribose-1-phosphate isomerase             207   1e-61    
ref|WP_015263041.1|  methylthioribose-1-phosphate isomerase             207   1e-61    
ref|XP_011114920.1|  hypothetical protein H072_9321                     208   1e-61    
ref|XP_001594777.1|  hypothetical protein SS1G_04585                    209   1e-61    
gb|ESZ99195.1|  putative Methylthioribose-1-phosphate isomerase         209   1e-61    
gb|KFX96181.1|  hypothetical protein V490_03482                         209   1e-61    
gb|KFZ08582.1|  hypothetical protein V502_09266                         210   1e-61    
gb|EFW14500.1|  methylthioribose-1-phosphate isomerase                  207   2e-61    
gb|ELR06241.1|  S-methyl-5-thioribose-1-phosphate isomerase             209   2e-61    
gb|KFY84155.1|  hypothetical protein V500_09563                         210   2e-61    
ref|XP_011400091.1|  Methylthioribose-1-phosphate isomerase             215   3e-61    
gb|EHL06398.1|  S-methyl-5-thioribose-1-phosphate isomerase             206   3e-61    
gb|EES51572.1|  translation initiation factor, aIF-2BI/5-methylth...    206   3e-61    
ref|XP_007591582.1|  S-methyl-5-thioribose-1-phosphate isomerase        207   3e-61    
gb|KDB15846.1|  methylthioribose-1-phosphate isomerase                  206   4e-61    
gb|ENH78574.1|  methylthioribose-1-phosphate isomerase                  206   4e-61    
ref|WP_040198990.1|  methylthioribose-1-phosphate isomerase             205   4e-61    
ref|WP_031502477.1|  methylthioribose-1-phosphate isomerase             205   4e-61    
ref|XP_009226519.1|  S-methyl-5-thioribose-1-phosphate isomerase        206   5e-61    
ref|XP_003068154.1|  methylthioribose-1-phosphate isomerase, puta...    206   5e-61    
ref|WP_011460451.1|  methylthioribose-1-phosphate isomerase             205   5e-61    
ref|WP_015944768.1|  methylthioribose-1-phosphate isomerase             205   5e-61    
ref|WP_018210953.1|  methylthioribose-1-phosphate isomerase             205   6e-61    
ref|WP_035214189.1|  methylthioribose-1-phosphate isomerase             205   6e-61    
gb|KID80714.1|  methylthioribose-1-phosphate isomerase                  206   7e-61    
emb|CEJ93750.1|  Putative Methylthioribose-1-phosphate isomerase        206   7e-61    
gb|KDN67943.1|  putative S-methyl-5-thioribose-1-phosphate isomerase    206   8e-61    
ref|WP_035585447.1|  methylthioribose-1-phosphate isomerase             201   9e-61    
gb|KFH48781.1|  Methylthioribose-1-phosphate isomerase-like protein     206   1e-60    
gb|ERS95656.1|  methylthioribose-1-phosphate isomerase                  206   1e-60    
ref|WP_029420357.1|  methylthioribose-1-phosphate isomerase             204   1e-60    
ref|XP_003045774.1|  predicted protein                                  205   2e-60    
gb|KFG78348.1|  methylthioribose-1-phosphate isomerase                  205   2e-60    
ref|WP_035578288.1|  methylthioribose-1-phosphate isomerase             200   2e-60    
gb|KEY69218.1|  hypothetical protein S7711_01674                        205   2e-60    
gb|KID90826.1|  methylthioribose-1-phosphate isomerase                  205   2e-60    
ref|WP_018086583.1|  hypothetical protein                               204   2e-60    
ref|XP_005099286.1|  PREDICTED: methylthioribose-1-phosphate isom...    204   2e-60    
gb|KFA77974.1|  hypothetical protein S40288_07704                       205   2e-60    
gb|EFV34322.1|  S-methyl-5-thioribose-1-phosphate isomerase             199   2e-60    
gb|EKC40771.1|  Methylthioribose-1-phosphate isomerase                  211   2e-60    
ref|WP_008411947.1|  Methylthioribose-1-phosphate isomerase             204   2e-60    
ref|XP_007817378.1|  methylthioribose-1-phosphate isomerase             204   3e-60    
ref|WP_038286736.1|  methylthioribose-1-phosphate isomerase, part...    202   3e-60    
gb|EHK50478.1|  hypothetical protein TRIATDRAFT_297230                  204   4e-60    
ref|WP_020709462.1|  methylthioribose-1-phosphate isomerase             203   4e-60    
gb|EPE04150.1|  methylthioribose-1-phosphate isomerase                  204   4e-60    
gb|AFK33839.1|  unknown                                                 197   4e-60    
ref|WP_035176296.1|  methylthioribose-1-phosphate isomerase             203   5e-60    
ref|WP_041082154.1|  methylthioribose-1-phosphate isomerase             203   5e-60    
ref|WP_034431951.1|  methylthioribose-1-phosphate isomerase             202   5e-60    
ref|WP_025322587.1|  methylthioribose-1-phosphate isomerase             202   5e-60    
ref|WP_011683253.1|  methylthioribose-1-phosphate isomerase             202   5e-60    
gb|KEZ46350.1|  Methylthioribose-1-phosphate isomerase                  204   6e-60    
gb|KHJ32211.1|  putative methylthioribose-1-phosphate isomerase         204   7e-60    
ref|WP_034266382.1|  methylthioribose-1-phosphate isomerase             202   7e-60    



>ref|XP_009627128.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Nicotiana tomentosiformis]
 sp|Q948X8.1|MTNA_TOBAC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nicotiana 
tabacum]
 dbj|BAB63262.1| CIG2 [Nicotiana tabacum]
Length=374

 Score =   336 bits (861),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDV SNKAIGS+GAS L+  L  S+KI+ILTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVTSNKAIGSYGASFLKEHLTDSQKITILTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             T G LERA+CTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV AVIVGAD
Sbjct  196  YTDGVLERAFCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRVKAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY+LAV AMHHG+PFYVAAPLTS+DLSLSSGQ+IVIEERSPKELLHT
Sbjct  256  RVAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLHT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_009781605.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nicotiana 
sylvestris]
Length=374

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDV SNKAIGS+GAS L+  L  S+KI+ILTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVTSNKAIGSYGASFLKEHLTDSQKITILTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             T G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV AVIVGAD
Sbjct  196  YTDGVLERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRVKAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY+LAV A+HHG+PFYVAAPLTS+DLSLSSGQ+IVIEERSPKELLHT
Sbjct  256  RVAANGDTANKIGTYNLAVSAVHHGIPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLHT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_006346696.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Solanum 
tuberosum]
Length=374

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDV SNKAIGS+GAS ++N L  SK I+ILTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVTSNKAIGSYGASFIKNYLTDSKNITILTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
               G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV AVIVGAD
Sbjct  196  YADGALERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRVKAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY+LAV AMHHG+PFYVAAPLTSVDLSLSSGQ+IVIEERSPKELLHT
Sbjct  256  RVAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSVDLSLSSGQEIVIEERSPKELLHT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_004244859.1| PREDICTED: methylthioribose-1-phosphate isomerase [Solanum lycopersicum]
Length=374

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDV SNKAIGS+GAS ++N L  SK I+ILTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVTSNKAIGSYGASFIKNYLTDSKNITILTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
               G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV AVIVGAD
Sbjct  196  YADGALERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRVKAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LAV AMHHG+PFYVAAPLTSVDLSLSSGQ+IVIEERSPKELLHT
Sbjct  256  RIAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSVDLSLSSGQEIVIEERSPKELLHT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI VWNPAFDV
Sbjct  316  RGGLGEQVAASGILVWNPAFDV  337



>gb|KJB82985.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=285

 Score =   328 bits (842),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  43   AAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  102

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGAD
Sbjct  103  HAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGAD  162

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT
Sbjct  163  RVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHT  222

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  223  RGGLGEQVAASGISVWNPAFDV  244



>gb|KHG04432.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=385

 Score =   332 bits (850),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGSHGAS LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  143  AAEIMLDDDVATNKAIGSHGASFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  202

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+AV+VGAD
Sbjct  203  HAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRVDAVVVGAD  262

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT
Sbjct  263  RVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHT  322

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  323  RGGLGEQVAASGISVWNPAFDV  344



>gb|KDP33930.1| hypothetical protein JCGZ_07501 [Jatropha curcas]
Length=382

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIMLEDDVASNKAIGSHGAS ++NQL   +++S+LTHCNTGSLATAGYGTALGVIR++
Sbjct  142  AAEIMLEDDVASNKAIGSHGASFIKNQLKNIERLSVLTHCNTGSLATAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQG+RLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  202  HTDGVLERAYCTETRPFNQGARLTAFELVHDKIPATLIADSAAAALMKDGRVSAVIVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DL LSSG QIVIEERSPKELL+T
Sbjct  262  RVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSIDLCLSSGNQIVIEERSPKELLNT  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGIS+WNPAFDV
Sbjct  322  RGGLGEQVAASGISIWNPAFDV  343



>gb|KJB82983.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=345

 Score =   328 bits (841),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  103  AAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  162

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGAD
Sbjct  163  HAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGAD  222

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT
Sbjct  223  RVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHT  282

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  283  RGGLGEQVAASGISVWNPAFDV  304



>ref|XP_007012613.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY30232.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
Length=424

 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASNKAIGS+GAS LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  185  AAEVMLEDDVASNKAIGSYGASFLQHQQKNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  244

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  245  HAEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRVSAVIVGAD  304

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAM+H +PFYVAAPLTS+DLSLSSGQ+I+IEERS KELLHT
Sbjct  305  RVAANGDTANKIGTYSLAICAMYHHIPFYVAAPLTSIDLSLSSGQEIIIEERSAKELLHT  364

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  365  RGGLGEQVAASGISVWNPAFDV  386



>ref|XP_002516257.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
 sp|B9RR88.1|MTNA_RICCO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ricinus 
communis]
 gb|EEF46259.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
Length=382

 Score =   329 bits (844),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DD+ASNKAIGSHGAS +QNQL   +++SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  142  AAEIMLKDDIASNKAIGSHGASFIQNQLKNPQRLSILTHCNTGSLATAGYGTALGVIRAL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            + AG L RAYCTETRPFNQGSRLTAFELV E IPATL+ADSAAAALMK  +V+AVIVGAD
Sbjct  202  HAAGVLRRAYCTETRPFNQGSRLTAFELVHEKIPATLVADSAAAALMKDDQVSAVIVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTSVDLSLSSG+ IVIEERSPKELL++
Sbjct  262  RVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSVDLSLSSGKHIVIEERSPKELLNS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  322  RGGLGEQVAASGISVWNPAFDV  343



>ref|XP_010412762.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=369

 Score =   329 bits (843),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEDMLEDDVASNKAIGAFGSSLLRQQAKNPDKLSILTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T GFLERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HTQGFLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHT  313

Query  68   HGGLGEQIAASGISVWNPAFD  6
            HGGLGE+IAA GISVWNPAFD
Sbjct  314  HGGLGERIAAPGISVWNPAFD  334



>gb|KJB82981.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=385

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  143  AAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  202

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGAD
Sbjct  203  HAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGAD  262

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT
Sbjct  263  RVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHT  322

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  323  RGGLGEQVAASGISVWNPAFDV  344



>ref|XP_011078119.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sesamum indicum]
Length=374

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASNKAIG++GA+L+Q Q    K IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVASNKAIGNYGATLIQKQQKDPKSISVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK GRVNAVIVGAD
Sbjct  196  HEKGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKDGRVNAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+ AMHHG+PFYVAAPLTS+DLSLSSGQ+IVIEERS KELL++
Sbjct  256  RVAANGDTANKIGTYSLALSAMHHGIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLNS  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>gb|KJB82984.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=367

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  143  AAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  202

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGAD
Sbjct  203  HAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGAD  262

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT
Sbjct  263  RVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHT  322

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  323  RGGLGEQVAASGISVWNPAFDV  344



>gb|EYU28322.1| hypothetical protein MIMGU_mgv1a008441mg [Erythranthe guttata]
Length=374

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASNKAIG +GAS LQ Q    K IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEVMLEDDVASNKAIGHYGASFLQKQQSDPKNISVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALMKAG+V AVIVGAD
Sbjct  196  HEKGVLERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMKAGQVKAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+ AMHHG+PFYVAAPLTS+DLSLSSG++IVIEERS KELLH 
Sbjct  256  RVAANGDTANKIGTYSLAISAMHHGIPFYVAAPLTSIDLSLSSGEEIVIEERSAKELLHA  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_010467106.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelina sativa]
Length=374

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEDMLEDDVASNKAIGAFGSSLLRQQAKNPDKLSILTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  314  HGGLGERIAAPGISVWNPAFDV  335



>ref|XP_007012614.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY30233.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
Length=458

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASNKAIGS+GAS LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  185  AAEVMLEDDVASNKAIGSYGASFLQHQQKNSKRFSVLTHCNTGSLATAGYGTALGVIRAL  244

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  245  HAEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRVSAVIVGAD  304

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAM+H +PFYVAAPLTS+DLSLSSGQ+I+IEERS KELLHT
Sbjct  305  RVAANGDTANKIGTYSLAICAMYHHIPFYVAAPLTSIDLSLSSGQEIIIEERSAKELLHT  364

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  365  RGGLGEQVAASGISVWNPAFDV  386



>ref|XP_010488779.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=374

 Score =   327 bits (837),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ GASLL+ Q     K+SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEDMLEDDVASNKAIGTFGASLLRQQAKNPDKLSILTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LER YCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HTQGILERGYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  314  HGGLGERIAAPGISVWNPAFDV  335



>ref|XP_002883712.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59971.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=369

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q   + K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEDMLEDDVASNKAIGTFGSSLLRQQAKNADKLSVLTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HAQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  314  HGGLGERIAAPGISVWNPAFDV  335



>ref|XP_010666847.1| PREDICTED: methylthioribose-1-phosphate isomerase [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIMLEDDVASNKAIGS+GAS  ++QL  +KKISILTHCNTGSLATAGYGTALGVIRAV
Sbjct  145  AAEIMLEDDVASNKAIGSYGASCFKSQLKDAKKISILTHCNTGSLATAGYGTALGVIRAV  204

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMKAG V  VIVGAD
Sbjct  205  HAQGILERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKAGNVQGVIVGAD  264

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLAV A HHG+PFYVAAPLTSVDLSL SG+ I+IEERSPKELL++
Sbjct  265  RVAANGDTANKIGTYSLAVSAKHHGIPFYVAAPLTSVDLSLPSGEYIIIEERSPKELLNS  324

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  325  RGGLGEQVAASGISVWNPAFDV  346



>ref|XP_007202151.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
 gb|EMJ03350.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
Length=382

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGS+GAS +Q+ L  SK IS+LTHCNTGSLA+AGYGTALGVIR++
Sbjct  142  ASEIMLKDDVASNKAIGSYGASFIQHLLENSKSISMLTHCNTGSLASAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV +NIPATL+ DSAAAALMK GRVNAV+VGAD
Sbjct  202  HTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLVVDSAAAALMKDGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLAV A +H +PF+VAAPLTSVDL+LSSGQ+I+IEERSPKELLH+
Sbjct  262  RVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLALSSGQEIIIEERSPKELLHS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  322  QGGLGEQVAASGISVWNPAFDV  343



>ref|XP_009337200.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=378

 Score =   324 bits (830),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGSHGAS +Q+ L  SK IS+LTHCNTGSLATAGYGTALGVIR++
Sbjct  138  ASEIMLKDDVASNKAIGSHGASFIQHLLGNSKNISMLTHCNTGSLATAGYGTALGVIRSL  197

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTE+RPFNQGSRLTAFELV +NIP TLIADSAAAALMK GRVNAV+VGAD
Sbjct  198  HTEGVLERAYCTESRPFNQGSRLTAFELVHDNIPGTLIADSAAAALMKFGRVNAVVVGAD  257

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYS+AV A HH +PF+VAAPLTS+DLSLSSG++I+IEERSPKELL+T
Sbjct  258  RVAANGDTANKIGTYSVAVSAKHHNIPFFVAAPLTSIDLSLSSGEEIIIEERSPKELLNT  317

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQ+AASGI+VWNPAFDV
Sbjct  318  HGGLGEQVAASGIAVWNPAFDV  339



>ref|XP_008388900.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGSHGA  +Q+ L  SK IS+LTHCNTGSLATAGYGTALGVIR++
Sbjct  142  ASEIMLKDDVASNKAIGSHGAXFIQHLLGNSKNISMLTHCNTGSLATAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV +NIP TLIADSAAAALMK GRVNAV+VGAD
Sbjct  202  HTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPGTLIADSAAAALMKFGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A NGDTANKIGTYSLAV A HH +PF+VAAPLTS+DLSLSSG++I+IEERSPKELL+T
Sbjct  262  RVATNGDTANKIGTYSLAVSAKHHNIPFFVAAPLTSIDLSLSSGEEIIIEERSPKELLNT  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQ+AASGI+VWNPAFDV
Sbjct  322  HGGLGEQVAASGIAVWNPAFDV  343



>ref|XP_006396133.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36912.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=372

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  135  AAENMLEDDVASNKAIGTFGSSLLRQQTKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  194

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  195  HTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  254

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER+PKELL+T
Sbjct  255  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERTPKELLNT  314

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  315  HGGLGERIAAPGISVWNPAFDV  336



>ref|NP_001077883.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05978.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=328

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  88   ASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  147

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  148  HTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  207

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HT
Sbjct  208  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHT  267

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFD+
Sbjct  268  HGGLGERIAAPGISVWNPAFDM  289



>ref|NP_973428.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 ref|NP_001031339.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20446.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AAM91239.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05976.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05977.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=326

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  86   ASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  145

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  146  HTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  205

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HT
Sbjct  206  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHT  265

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFD+
Sbjct  266  HGGLGERIAAPGISVWNPAFDM  287



>ref|XP_008242258.1| PREDICTED: methylthioribose-1-phosphate isomerase [Prunus mume]
Length=382

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGS+GAS +Q+ L  SK IS+LTHCNTGSLA+AGYGTALGVIR++
Sbjct  142  ASEIMLKDDVASNKAIGSYGASFIQHLLENSKSISMLTHCNTGSLASAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+RAYCTETRPFNQGSRLTAFELV +NIPATL+ DSAAAALMK GRVNAV+VGAD
Sbjct  202  HTEGVLKRAYCTETRPFNQGSRLTAFELVHDNIPATLVVDSAAAALMKDGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLAV A +H +PF+VAAPLTSVDL+LSSGQ+I+IEERSPKELLH+
Sbjct  262  RVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLALSSGQEIIIEERSPKELLHS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  322  QGGLGEQVAASGISVWNPAFDV  343



>ref|XP_008337840.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGSHGAS +QN L  SK IS+LTHCNTGSLATAGYGTALGVIR++
Sbjct  142  ASEIMLKDDVASNKAIGSHGASFIQNLLGNSKNISMLTHCNTGSLATAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK  RVNAV+VGA 
Sbjct  202  HTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKFARVNAVVVGAY  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY+LAV A HH +PF+VAAPLTSVDLSLSSG++I+IEERSPKELL+T
Sbjct  262  RVAANGDTANKIGTYNLAVSAKHHNIPFFVAAPLTSVDLSLSSGEEIIIEERSPKELLNT  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQ+AA GISVWNPAFDV
Sbjct  322  HGGLGEQVAAFGISVWNPAFDV  343



>ref|XP_010090181.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
 gb|EXB38978.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
Length=371

 Score =   321 bits (822),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLL-QNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAEIMLEDDVASNKAIGS+GA  L ++   GSKK S+LTHCNTGSLATAG+GTALGVIRA
Sbjct  134  AAEIMLEDDVASNKAIGSYGADFLYRHADDGSKKFSVLTHCNTGSLATAGFGTALGVIRA  193

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGA  252
            ++T G L+RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK GRV+AV+VGA
Sbjct  194  LHTQGVLKRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKDGRVSAVVVGA  253

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+AANGDTANKIGTYSLA+ A HH VPF+VAAPLTS+DLSLSSGQ+IVIEERSPKELLH
Sbjct  254  DRVAANGDTANKIGTYSLALIAKHHNVPFFVAAPLTSIDLSLSSGQEIVIEERSPKELLH  313

Query  71   THGGLGEQIAASGISVWNPAFDV  3
            T GGLGEQ+AASGI+VWNPAFDV
Sbjct  314  TRGGLGEQVAASGIAVWNPAFDV  336



>gb|KFK39882.1| hypothetical protein AALP_AA3G300900 [Arabis alpina]
Length=374

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGV+RA+
Sbjct  134  AAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVLRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  QTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSL+SG++IVIEER+PKELL+T
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLTSGKEIVIEERTPKELLNT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  314  HGGLGERIAAPGISVWNPAFDV  335



>ref|NP_027726.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9ZUG4.2|MTNA_ARATH RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arabidopsis 
thaliana]
 gb|AAC95160.2| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05975.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=374

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  ASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFD+
Sbjct  314  HGGLGERIAAPGISVWNPAFDM  335



>ref|XP_004166700.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cucumis 
sativus]
Length=325

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  86   AAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGTALGVIRAL  145

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRVNAV+VGAD
Sbjct  146  HSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRVNAVVVGAD  205

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++
Sbjct  206  RVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNS  265

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI+VWNPAFDV
Sbjct  266  RGGLGEQVAASGIAVWNPAFDV  287



>gb|AAM65143.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
Length=374

 Score =   319 bits (818),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCN GSLATAGYGTALGVIRA+
Sbjct  134  ASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNXGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  194  HTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  253

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHT
Sbjct  254  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHT  313

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFD+
Sbjct  314  HGGLGERIAAPGISVWNPAFDM  335



>emb|CDP03069.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVASNKAIGS+GA  L +QL    +IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEIMLQDDVASNKAIGSYGAGFLLHQLKDFDRISVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV E IPATL+ DSAAAALMK GRVNAV+VGAD
Sbjct  196  HAEGVLERAYCTETRPFNQGSRLTAFELVYEKIPATLLVDSAAAALMKDGRVNAVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA HH +PF VAAPLTS+DLS++SG++IVIEERSPKE+LH 
Sbjct  256  RVAANGDTANKIGTYSLALCAKHHNIPFLVAAPLTSIDLSITSGEEIVIEERSPKEVLHA  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI+VWNPAFDV
Sbjct  316  RGGLGEQVAASGIAVWNPAFDV  337



>ref|XP_006280656.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
 gb|EOA13554.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
Length=370

 Score =   318 bits (816),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  135  AAENMLEDDVASNKAIGNFGSSLLRQQAQNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  194

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  195  HTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  254

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+T
Sbjct  255  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNT  314

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  315  HGGLGERIAAPGISVWNPAFDV  336



>emb|CDY33397.1| BnaA07g04420D [Brassica napus]
Length=373

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  196  HTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+T
Sbjct  256  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  316  HGGLGERIAAPGISVWNPAFDV  337



>ref|XP_009102357.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brassica rapa]
Length=372

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  135  AAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  194

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ VIVGAD
Sbjct  195  HTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGAD  254

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+T
Sbjct  255  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNT  314

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  315  HGGLGERIAAPGISVWNPAFDV  336



>emb|CDY70356.1| BnaCnng67980D [Brassica napus]
Length=373

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV+ V+VGAD
Sbjct  196  HTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+T
Sbjct  256  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGE+IAA GISVWNPAFDV
Sbjct  316  HGGLGERIAAPGISVWNPAFDV  337



>gb|KHN12290.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=372

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 188/202 (93%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASN+AIGS+GAS++Q Q    +K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  137  AAEVMLEDDVASNRAIGSYGASIIQQQ-TEKQKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG L+RAYCTETRPFNQGSRLTAFELV E IP TLIADSAAAALMKAG V+AV+VGAD
Sbjct  196  HSAGVLKRAYCTETRPFNQGSRLTAFELVHEKIPGTLIADSAAAALMKAGHVDAVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+ A  H VPFYVAAPLTS+DLSLSSGQ+IVIEERSPKELL+T
Sbjct  256  RVASNGDTANKIGTYSVALSAKFHNVPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLNT  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQIAASGISVWNPAFDV
Sbjct  316  HGGLGEQIAASGISVWNPAFDV  337



>ref|XP_008450940.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis melo]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  142  AAEAMLEDDVASNKAIGFYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGTALGVIRAL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRVNAV+VGAD
Sbjct  202  HSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++
Sbjct  262  RVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI+VWNPAFDV
Sbjct  322  RGGLGEQVAASGIAVWNPAFDV  343



>gb|KGN66312.1| hypothetical protein Csa_1G597100 [Cucumis sativus]
Length=381

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  142  AAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGTALGVIRAL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRVNAV+VGAD
Sbjct  202  HSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++
Sbjct  262  RVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI+VWNPAFDV
Sbjct  322  RGGLGEQVAASGIAVWNPAFDV  343



>ref|XP_004144039.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cucumis 
sativus]
Length=395

 Score =   317 bits (813),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  156  AAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGTALGVIRAL  215

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRVNAV+VGAD
Sbjct  216  HSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRVNAVVVGAD  275

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++
Sbjct  276  RVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNS  335

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI+VWNPAFDV
Sbjct  336  RGGLGEQVAASGIAVWNPAFDV  357



>ref|XP_010047466.1| PREDICTED: methylthioribose-1-phosphate isomerase [Eucalyptus 
grandis]
Length=380

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+ML+DDVASNKAIG +GAS L+     SK +S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  142  AAEVMLKDDVASNKAIGGYGASFLKLNQKKSKGLSVLTHCNTGSLATAGYGTALGVIRAL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATL+ADSAAAAL+K GRV+AVIVGAD
Sbjct  202  HTEGALERAYCTETRPFNQGSRLTAFELVHERIPATLLADSAAAALVKEGRVDAVIVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA HH +PFYVAAPLTSVDLSLSSGQ IVIEERS KELL++
Sbjct  262  RVAANGDTANKIGTYSLALCARHHNIPFYVAAPLTSVDLSLSSGQDIVIEERSAKELLNS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  322  RGGLGEQVAASGISVWNPAFDV  343



>ref|XP_004488081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cicer 
arietinum]
Length=372

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 186/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIMLEDDVASNKAIG +GAS +QN      K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAEIMLEDDVASNKAIGIYGASFIQNH-TEKHKLSVLTHCNTGSLATAGYGTALGVIRAL  194

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAAALM+AGRV+AV+VGAD
Sbjct  195  HSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAAALMQAGRVDAVVVGAD  254

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+CA  H VPFYVAAPLTS+DLSLSSG+QIVIEERSPKELL+T
Sbjct  255  RVASNGDTANKIGTYSVALCAKFHNVPFYVAAPLTSIDLSLSSGKQIVIEERSPKELLNT  314

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  315  RGGLGEQVAASGISVWNPAFDV  336



>ref|XP_010261799.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nelumbo nucifera]
Length=377

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVASNKAIG++G+S LQ+QL  S ++SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  142  AAETMLNDDVASNKAIGAYGSSFLQSQLKDSNRLSILTHCNTGSLATAGYGTALGVIRAL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALMK+GRV+AVIVGAD
Sbjct  202  HATGVLERAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMKSGRVDAVIVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA++HG+PFYVAAP+TS+DLSL SGQ++VIEERS KELL++
Sbjct  262  RVASNGDTANKIGTYSLALCALYHGIPFYVAAPVTSIDLSLPSGQEVVIEERSAKELLNS  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  322  RGGLGEQVAASGISVWNPAFDV  343



>ref|XP_009359722.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=382

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+EIML+DDVASNKAIGSHGAS +Q+ L  SK I +LTHCNTGSLATAGYGTALGVIR++
Sbjct  142  ASEIMLKDDVASNKAIGSHGASFIQHLLGNSKNIFMLTHCNTGSLATAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK GRVNAV+VGAD
Sbjct  202  HTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKFGRVNAVVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY+L V A HH +PF+VA PLTSVDLSLSSG++ +I+ERSPKELL+T
Sbjct  262  RVAANGDTANKIGTYNLCVSAKHHNIPFFVAVPLTSVDLSLSSGEERIIDERSPKELLNT  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQ AASGISVWNPAFDV
Sbjct  322  HGGLGEQFAASGISVWNPAFDV  343



>gb|AES65569.2| methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=372

 Score =   316 bits (809),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 186/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIMLEDDVASN+AIG++GAS +QNQ     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  137  AAEIMLEDDVASNRAIGTYGASFIQNQ-TEKLKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             + G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAAALM+AGRV+AV+VGAD
Sbjct  196  YSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAAALMQAGRVDAVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+CA  H VPF+VAAPLTS+DLSLSSGQQIVIEERSPKELL+ 
Sbjct  256  RVASNGDTANKIGTYSVALCAKFHNVPFFVAAPLTSIDLSLSSGQQIVIEERSPKELLNM  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_003595318.1| Methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=382

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 186/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIMLEDDVASN+AIG++GAS +QNQ     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  137  AAEIMLEDDVASNRAIGTYGASFIQNQ-TEKLKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             + G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAAALM+AGRV+AV+VGAD
Sbjct  196  YSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAAALMQAGRVDAVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+CA  H VPF+VAAPLTS+DLSLSSGQQIVIEERSPKELL+ 
Sbjct  256  RVASNGDTANKIGTYSVALCAKFHNVPFFVAAPLTSIDLSLSSGQQIVIEERSPKELLNM  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  316  RGGLGEQVAASGISVWNPAFDV  337



>ref|XP_010541997.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Tarenaya hassleriana]
Length=367

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE MLE+DVASNKAIGS+G+S L+ Q   S K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  135  AAENMLEEDVASNKAIGSYGSSFLRQQAKNSDKLSVLTHCNTGSLATAGYGTALGVIRAL  194

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             + G LERAYCTETRPFNQGSRLTAFELV E  PATLIADSAAAALM  GRV+AVIVGAD
Sbjct  195  QSQGVLERAYCTETRPFNQGSRLTAFELVHETPPATLIADSAAAALMNDGRVDAVIVGAD  254

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTS+DLSLSSG++IVIEERSPKELL+T
Sbjct  255  RVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSIDLSLSSGKEIVIEERSPKELLNT  314

Query  68   HGGLGEQIAASGISVWNPA  12
            HGGLGE+I ASGISVWNPA
Sbjct  315  HGGLGERIGASGISVWNPA  333



>ref|XP_004287647.1| PREDICTED: methylthioribose-1-phosphate isomerase [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E+ML++DV +NKAIGSHGA+ +Q  L  SK+I +LTHCNTGSLATAGYGTALGVIR++
Sbjct  142  ASEVMLKEDVDTNKAIGSHGATFIQRHLENSKRICMLTHCNTGSLATAGYGTALGVIRSL  201

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTA+ELV +NIPATLIADSAAAALMK G+VNA++VGAD
Sbjct  202  HTEGVLERAYCTETRPFNQGSRLTAYELVHDNIPATLIADSAAAALMKDGKVNAIVVGAD  261

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYSLAV A +H +PF+VAAPLTSVDLSLSSG +IVIEERSPKELL+T
Sbjct  262  RVASNGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLSLSSGGEIVIEERSPKELLNT  321

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQ+AASGISVWNPAFDV
Sbjct  322  HGGLGEQVAASGISVWNPAFDV  343



>ref|XP_011019339.1| PREDICTED: methylthioribose-1-phosphate isomerase [Populus euphratica]
Length=380

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML DDVASNKAIGS+GA  +QNQ     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  140  AAEIMLADDVASNKAIGSYGARFIQNQQKDPTKLSVLTHCNTGSLATAGYGTALGVIRAL  199

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  +V+AV+VGAD
Sbjct  200  HSEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDSKVSAVVVGAD  259

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS D SLSSG++I+IEERSPKE+L+ 
Sbjct  260  RVVANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSFDSSLSSGKEIIIEERSPKEMLNA  319

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  320  RGGLGEQVAASGISVWNPAFDV  341



>ref|XP_006452823.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66063.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=358

 Score =   314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  AAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  197  HSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGRVSAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL +
Sbjct  257  RVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>gb|KDO73879.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=358

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  AAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  197  HSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGRVSAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL +
Sbjct  257  RVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>ref|XP_006474713.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Citrus 
sinensis]
 gb|KDO73877.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
 gb|KDO73878.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=373

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  AAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  197  HSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGRVSAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL +
Sbjct  257  RVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>ref|XP_006452822.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66062.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=373

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  AAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  197  HSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGRVSAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL +
Sbjct  257  RVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>gb|KDO73876.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=374

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  AAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GRV+AVIVGAD
Sbjct  197  HSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGRVSAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL +
Sbjct  257  RVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>ref|XP_002308521.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
 sp|B9HCR2.2|MTNA_POPTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Populus 
trichocarpa]
 gb|EEE92044.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
Length=375

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML DDVASNKAIGS+GA  +QNQ     K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  140  AAEIMLADDVASNKAIGSYGARFIQNQQKDPTKLSVLTHCNTGSLATAGYGTALGVIRAL  199

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+RAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  +V+AV+VGAD
Sbjct  200  HGEGVLQRAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDSKVSAVVVGAD  259

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS D SLSSG++I+IEERSPKE+L+ 
Sbjct  260  RVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSFDSSLSSGKEIIIEERSPKEMLNA  319

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  320  RGGLGEQVAASGISVWNPAFDV  341



>ref|XP_004979099.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Setaria 
italica]
Length=367

 Score =   313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGSHGA  LQ QL  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLIDDVADNKAIGSHGAEFLQKQLGNSKNISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGRVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DL+L SG++IVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLAISAKHHGVQFYVAAPVTSIDLTLPSGEEIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>gb|KCW79381.1| hypothetical protein EUGRSUZ_C00793 [Eucalyptus grandis]
Length=461

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+ML+DDVASNKAIG +GAS L+     SK +S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  223  AAEVMLKDDVASNKAIGGYGASFLKLNQKKSKGLSVLTHCNTGSLATAGYGTALGVIRAL  282

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G LERAYCTETRPFNQGSRLTAFELV E IPATL+ADSAAAAL+K GRV+AVIVGAD
Sbjct  283  HTEGALERAYCTETRPFNQGSRLTAFELVHERIPATLLADSAAAALVKEGRVDAVIVGAD  342

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+CA HH +PFYVAAPLTSVDLSLSSGQ IVIEERS KELL++
Sbjct  343  RVAANGDTANKIGTYSLALCARHHNIPFYVAAPLTSVDLSLSSGQDIVIEERSAKELLNS  402

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  403  RGGLGEQVAASGISVWNPAFDV  424



>sp|B6TZD1.1|MTNA_MAIZE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=ZmIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Zea mays]
 gb|ACG42464.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AFW60581.1| methylthioribose-1-phosphate isomerase isoform 1 [Zea mays]
 gb|AFW60582.1| methylthioribose-1-phosphate isomerase isoform 2 [Zea mays]
Length=367

 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HH V FYV+AP+TS+DLSL SG +IVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLAISAKHHSVQFYVSAPVTSIDLSLPSGDEIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>ref|XP_010930603.1| PREDICTED: methylthioribose-1-phosphate isomerase [Elaeis guineensis]
Length=376

 Score =   311 bits (796),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIG HGAS L  QL  S K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAETMLTDDVADNKAIGFHGASFLPCQLKDSGKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRPFNQGSRLTAFELV + IPATLI DSAAAALMKAGRVNAVIVGAD
Sbjct  196  HAGGSLETAFCTETRPFNQGSRLTAFELVHDEIPATLITDSAAAALMKAGRVNAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTYSLAV A +HG+PFYVAAP+TS+DLSLSSGQQIVIEERSPKELL +
Sbjct  256  RIAANGDTANKIGTYSLAVSASYHGIPFYVAAPITSIDLSLSSGQQIVIEERSPKELLCS  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGI+VWNPAFD+
Sbjct  316  DGGLGKQVAASGIAVWNPAFDI  337



>ref|NP_001105275.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AAU86895.1| isopentenyl-diphosphate delta isomerase 2 [Zea mays]
Length=367

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HH V  YVAAP+TS+DLSL SG +IVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLAISAKHHSVQVYVAAPVTSIDLSLPSGDEIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>ref|XP_008786516.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Phoenix dactylifera]
Length=376

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIG HGAS L  QL  S K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  136  AAETMLTDDVADNKAIGFHGASFLPCQLKDSGKLSVLTHCNTGSLATAGYGTALGVIRAL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRPFNQGSRLTAFELV + IPATLI DSAAAALMKAGRVNAVIVGAD
Sbjct  196  HAGGSLEAAFCTETRPFNQGSRLTAFELVHDKIPATLITDSAAAALMKAGRVNAVIVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTYSLAV A +HG+PFYVAAP+TS+DLSLSSG+QIVIEERSPKELL +
Sbjct  256  RIAANGDTANKIGTYSLAVSASYHGIPFYVAAPITSIDLSLSSGRQIVIEERSPKELLCS  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGI+VWNPAFDV
Sbjct  316  DGGLGKQVAASGIAVWNPAFDV  337



>gb|ACG37871.1| methylthioribose-1-phosphate isomerase [Zea mays]
Length=367

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HH V  YVAAP+TS+DLSL SG +IVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLAISAKHHSVQVYVAAPVTSIDLSLPSGDEIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>ref|XP_006662829.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oryza 
brachyantha]
Length=367

 Score =   308 bits (790),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGS+GA  L+ +L  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGSYGAEFLKQKLGNSKHISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV AVIVGAD
Sbjct  191  HSGGILEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKNGRVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG +IVIEERSPKELL+T
Sbjct  251  RIAANGDTANKIGTYNLAISAKHHGVQFYVAAPVTSIDLSLPSGDEIVIEERSPKELLNT  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>sp|Q9AYT7.1|MTNA_HORVU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=HvIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Hordeum vulgare]
 dbj|BAB21393.1| IDI2 [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIG HGA  LQ QL  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGLHGAEFLQRQLGSSKNISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLSIAAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>dbj|BAJ86257.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIG HGA  LQ QL  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAETMLVDDVADNKAIGLHGAEFLQRQLGSSKNISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLSIAAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>ref|XP_007138649.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
 gb|ESW10643.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
Length=373

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E+MLEDDVASN+AIGS+GA+ +Q Q    +K+S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  138  ASEVMLEDDVASNRAIGSYGATCIQQQ-TEKQKLSVLTHCNTGSLATAGYGTALGVIRAL  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMKAG V+AV+VGAD
Sbjct  197  HSGGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKAGSVDAVVVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+ A  H VPFYVAAPLTSVDLSLSSGQ+IVIEERSPKELL+ 
Sbjct  257  RVASNGDTANKIGTYSVALFAKFHNVPFYVAAPLTSVDLSLSSGQEIVIEERSPKELLNA  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGISVWNPAFDV
Sbjct  317  RGGLGEQVAASGISVWNPAFDV  338



>ref|XP_002277806.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 ref|XP_010656105.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 sp|D7TCD0.2|MTNA_VITVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Vitis 
vinifera]
Length=376

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML +DVA+N+AIG +GAS LQ+ +  SK +SILTHCNTGSLATAGYGTALGVIR+V
Sbjct  137  AAEDMLREDVAANRAIGLYGASFLQSHIKDSKNLSILTHCNTGSLATAGYGTALGVIRSV  196

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALM+AGRV+AVIVGAD
Sbjct  197  HAEGILLRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMQAGRVDAVIVGAD  256

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+ A HH +PF+VAAPLTS+DL+LSSGQ+IVIEERSPKELL++
Sbjct  257  RVAANGDTANKIGTYSLALSAKHHHIPFFVAAPLTSIDLTLSSGQEIVIEERSPKELLNS  316

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI VWNPAFDV
Sbjct  317  RGGLGEQVAASGICVWNPAFDV  338



>gb|EMS50123.1| Methylthioribose-1-phosphate isomerase [Triticum urartu]
Length=367

 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIG HGA  LQ QL  S+ IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  131  AAEAMLVDDVADNKAIGLHGAEFLQRQLGSSRNISVLTHCNTGSLATAGYGTALGVIRAL  190

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+V AVIVGAD
Sbjct  191  HSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQVQAVIVGAD  250

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++
Sbjct  251  RIAANGDTANKIGTYNLSISAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNS  310

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  311  EGGLGKQVAASGISVWNPAFDV  332



>emb|CBI27788.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML +DVA+N+AIG +GAS LQ+ +  SK +SILTHCNTGSLATAGYGTALGVIR+V
Sbjct  179  AAEDMLREDVAANRAIGLYGASFLQSHIKDSKNLSILTHCNTGSLATAGYGTALGVIRSV  238

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALM+AGRV+AVIVGAD
Sbjct  239  HAEGILLRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMQAGRVDAVIVGAD  298

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSLA+ A HH +PF+VAAPLTS+DL+LSSGQ+IVIEERSPKELL++
Sbjct  299  RVAANGDTANKIGTYSLALSAKHHHIPFFVAAPLTSIDLTLSSGQEIVIEERSPKELLNS  358

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI VWNPAFDV
Sbjct  359  RGGLGEQVAASGICVWNPAFDV  380



>ref|XP_003577698.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brachypodium 
distachyon]
Length=368

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML DDVA NKAIG HGA  LQ Q+  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  132  ATETMLVDDVADNKAIGLHGAEFLQRQVGRSKNISVLTHCNTGSLATAGYGTALGVIRAL  191

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G++ AVIVGAD
Sbjct  192  HSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQIQAVIVGAD  251

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL+SG+QIVIEERSPKELL++
Sbjct  252  RIAANGDTANKIGTYNLSISAKHHGVEFYVAAPVTSIDLSLASGKQIVIEERSPKELLNS  311

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  312  EGGLGKQVAASGISVWNPAFDV  333



>gb|EMT32201.1| Methylthioribose-1-phosphate isomerase [Aegilops tauschii]
Length=452

 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVA NKAIGSHGA  LQ QL  S+ IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  216  AAEAMLVDDVADNKAIGSHGAEFLQRQLGSSRNISVLTHCNTGSLATAGYGTALGVIRAL  275

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+V AVIVGAD
Sbjct  276  HSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQVQAVIVGAD  335

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+L++ A HHG+ FYVAAP+TS+DLSL SG+QIVIEERSPKELL++
Sbjct  336  RIAANGDTANKIGTYNLSISAKHHGMQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNS  395

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  396  EGGLGKQVAASGISVWNPAFDV  417



>ref|XP_009406483.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDVASNKAIG HGA  L++ L   +KIS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  143  AAETMLIDDVASNKAIGFHGAKHLRSNLDSLEKISVLTHCNTGSLATAGYGTALGVIRAL  202

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
             + GFLE+A+CTETRPFNQGSRLTAFELV + IPATLIADSA AALMKAG VNAVIVGAD
Sbjct  203  RSEGFLEKAFCTETRPFNQGSRLTAFELVHDRIPATLIADSAVAALMKAGCVNAVIVGAD  262

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY++A+ A HHG+ FYVAAP+TS+DLS+SSG+QIVIEERS KELLH+
Sbjct  263  RIAANGDTANKIGTYNVALSAFHHGIQFYVAAPITSIDLSISSGEQIVIEERSAKELLHS  322

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GG G+Q+AASGISVWNPAFDV
Sbjct  323  DGGRGKQVAASGISVWNPAFDV  344



>sp|A2ZCP0.1|MTNA_ORYSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Oryza 
sativa Indica Group]
 gb|EAY80374.1| hypothetical protein OsI_35550 [Oryza sativa Indica Group]
Length=374

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  132  AAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALGVIRAL  191

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK+G + AVIVGAD
Sbjct  192  HSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAVIVGAD  251

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++
Sbjct  252  RIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNS  311

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  312  EGGLGKQVAASGISVWNPAFDV  333



>ref|NP_001067511.1| Os11g0216900 [Oryza sativa Japonica Group]
 sp|Q0ITU1.1|MTNA_ORYSJ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=OsIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF27874.1| Os11g0216900 [Oryza sativa Japonica Group]
 tpd|FAA00313.1| TPA: eukaryotic translation initiation factor 2B-like putative 
methylthioribose-1-phosphate isomerase [Oryza sativa Japonica 
Group]
 gb|EEE51856.1| hypothetical protein OsJ_33377 [Oryza sativa Japonica Group]
Length=374

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  132  AAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALGVIRAL  191

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK+G + AVIVGAD
Sbjct  192  HSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAVIVGAD  251

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++
Sbjct  252  RIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNS  311

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  312  EGGLGKQVAASGISVWNPAFDV  333



>gb|EPS64192.1| methylthioribose-1-phosphate isomerase, partial [Genlisea aurea]
Length=341

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A+E MLEDDVASNKAIG+HGA  L  +     + S+LTHCNTGSLATAGYGTALGVIR++
Sbjct  127  ASEFMLEDDVASNKAIGNHGADFLHEEQKHLHRFSVLTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGSRLTAFELV ++IPATLIADSAAAALM AGRV+ V+VGAD
Sbjct  187  HEKGLLERAYCTETRPFNQGSRLTAFELVHDSIPATLIADSAAAALMNAGRVDVVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTYSL++ A HHG+PFYVAAPLTSVDL L SG++I IEERSP+ELL+ 
Sbjct  247  RVAANGDTANKIGTYSLSLSAAHHGIPFYVAAPLTSVDLLLPSGKEIAIEERSPEELLNA  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGE++AASGISVWNPAFDV
Sbjct  307  RGGLGERVAASGISVWNPAFDV  328



>gb|ABA92066.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA92067.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=508

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  266  AAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALGVIRAL  325

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK+G + AVIVGAD
Sbjct  326  HSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAVIVGAD  385

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++
Sbjct  386  RIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNS  445

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLG+Q+AASGISVWNPAFDV
Sbjct  446  EGGLGKQVAASGISVWNPAFDV  467



>gb|KHG23802.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=215

 Score =   287 bits (735),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 177/202 (88%), Gaps = 4/202 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            ML+DDVASNKAIGS+G+  L++Q     + S+LTHCNTGSLATAGYGTALGVIRA++  G
Sbjct  1    MLDDDVASNKAIGSYGSRFLRDQQKIVPRFSVLTHCNTGSLATAGYGTALGVIRALHAEG  60

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LERAYCTETRPFNQGSRLTAFELV + IPATLIADSAAAALMK  RV+AVIVGADR+AA
Sbjct  61   VLERAYCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMKESRVSAVIVGADRVAA  120

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSG++IVIEERS KELLH+ GGL
Sbjct  121  NGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGEEIVIEERSAKELLHSQGGL  180

Query  56   GEQIAASG----ISVWNPAFDV  3
            GEQ+AASG    I+  N AF++
Sbjct  181  GEQVAASGILGVITKNNDAFNI  202



>gb|ADE77025.1| unknown [Picea sitchensis]
Length=384

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DD+ +NKAIGS+GA  + +Q      + +LTHCNTGSLATAGYGTALGVIRA+
Sbjct  139  AAEGMLIDDIDTNKAIGSNGAKFILSQTQKCHNLHVLTHCNTGSLATAGYGTALGVIRAL  198

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQGSRLTA+EL+ ++IPA LIADSAAAAL K+GRV+A+IVGAD
Sbjct  199  HSEGLLETAFCTETRPYNQGSRLTAYELIHDHIPAVLIADSAAAALQKSGRVDAIIVGAD  258

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIA NGDTANKIGTY+LA+ A HHG+PFYVAAPLTSVDLSLSSG+QI+IEERSPKEL H 
Sbjct  259  RIAENGDTANKIGTYNLALSAFHHGIPFYVAAPLTSVDLSLSSGEQIIIEERSPKELTHA  318

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GG G+Q+A SGISVWNPAFDV
Sbjct  319  LGGQGQQVAPSGISVWNPAFDV  340



>ref|XP_006842716.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
 gb|ERN04391.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
Length=372

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV SNKAIG HGA  + NQ   SKK+SILTHCNTGSLATAGYGTALGVIRA+
Sbjct  140  AAEAMLVDDVRSNKAIGKHGADFIMNQHKDSKKLSILTHCNTGSLATAGYGTALGVIRAL  199

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+ TETRP NQGSRLTA+ELV + IPATLI DSAAAALMKAGRV+AVIVGAD
Sbjct  200  HAEGVLETAFFTETRPVNQGSRLTAYELVHDKIPATLITDSAAAALMKAGRVDAVIVGAD  259

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            RIAANGDTANKIGTYS A+ A +HGVPFYVAAP TS+DLSL+SG QI IEERS KEL H 
Sbjct  260  RIAANGDTANKIGTYSHAISASYHGVPFYVAAPFTSIDLSLTSGDQITIEERSAKELTHA  319

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GG GEQ+  +GIS WNPAFDV
Sbjct  320  RGGQGEQVVVNGISAWNPAFDV  341



>gb|KJB07315.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=298

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVASNKAIGS+G+  LQ+Q     + S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  86   AAEIMLDDDVASNKAIGSYGSRFLQDQRKIVPRFSVLTHCNTGSLATAGYGTALGVIRAL  145

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGS LTAFELV + IPATLIADSAAAALMK  R++AVIVGAD
Sbjct  146  HAEGVLERAYCTETRPFNQGSWLTAFELVHDKIPATLIADSAAAALMKESRLSAVIVGAD  205

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
             +AANGDTANKI TYSLAVCAMHH +PFY+AA L+S+DLSLSSG++IVIEERS KELLH+
Sbjct  206  PVAANGDTANKIRTYSLAVCAMHHHIPFYIAASLSSIDLSLSSGEEIVIEERSSKELLHS  265

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI VWNPAFDV
Sbjct  266  RGGLGEQVAASGILVWNPAFDV  287



>gb|KJB07314.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
 gb|KJB07316.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=325

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAEIML+DDVASNKAIGS+G+  LQ+Q     + S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  86   AAEIMLDDDVASNKAIGSYGSRFLQDQRKIVPRFSVLTHCNTGSLATAGYGTALGVIRAL  145

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERAYCTETRPFNQGS LTAFELV + IPATLIADSAAAALMK  R++AVIVGAD
Sbjct  146  HAEGVLERAYCTETRPFNQGSWLTAFELVHDKIPATLIADSAAAALMKESRLSAVIVGAD  205

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
             +AANGDTANKI TYSLAVCAMHH +PFY+AA L+S+DLSLSSG++IVIEERS KELLH+
Sbjct  206  PVAANGDTANKIRTYSLAVCAMHHHIPFYIAASLSSIDLSLSSGEEIVIEERSSKELLHS  265

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GGLGEQ+AASGI VWNPAFDV
Sbjct  266  RGGLGEQVAASGILVWNPAFDV  287



>ref|XP_002967758.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
 gb|EFJ31105.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
Length=368

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE  LE+DV+SNKAIG +G++ L N    S+K+++LTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEAFLEEDVSSNKAIGDYGSAFLLNGADESRKLAVLTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQ-GSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGA  252
            ++   L  A+CTETRP+NQ GSRLTAFELV +NIPA L+ADSAAA+L  +GRV+AVIVGA
Sbjct  194  HSQNRLHTAFCTETRPYNQQGSRLTAFELVHDNIPAVLVADSAAASLQSSGRVDAVIVGA  253

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+AANGDTANKIGTYSLAV A  HG+PF VAAPLTSVDLS+SSG QI IEERS  EL H
Sbjct  254  DRVAANGDTANKIGTYSLAVSASRHGIPFLVAAPLTSVDLSISSGDQISIEERSALELTH  313

Query  71   THGGLGEQIAASGISVWNPAFDV  3
            T GG G ++AA GISVWNPAFDV
Sbjct  314  TQGGQGHRVAAEGISVWNPAFDV  336



>ref|XP_002992382.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
 gb|EFJ06532.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
Length=368

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE  LE+DV+SNKAIG +G++ L N    S+K+++LTHCNTGSLATAGYGTALGVIRA+
Sbjct  134  AAEAFLEEDVSSNKAIGDYGSAFLLNGADESRKLAVLTHCNTGSLATAGYGTALGVIRAL  193

Query  428  NTAGFLERAYCTETRPFNQ-GSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGA  252
            ++   L  A+CTETRP+NQ GSRLTAFELV +NIPA L+ADSAAA+L  +GRV+AVIVGA
Sbjct  194  HSQNRLHTAFCTETRPYNQQGSRLTAFELVHDNIPAVLVADSAAASLQSSGRVDAVIVGA  253

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+AANGDTANKIGTYSLAV A  HG+PF VAAPLTSVDLS+SSG QI IEERS  EL H
Sbjct  254  DRVAANGDTANKIGTYSLAVSASRHGIPFLVAAPLTSVDLSISSGDQISIEERSALELTH  313

Query  71   THGGLGEQIAASGISVWNPAFDV  3
            T GG G ++AA GISVWNPAFDV
Sbjct  314  TQGGQGHRVAAEGISVWNPAFDV  336



>ref|XP_001754539.1| predicted protein [Physcomitrella patens]
 gb|EDQ80509.1| predicted protein, partial [Physcomitrella patens]
Length=362

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGA-SLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAE ML  DVASNKAIG++GA +LLQ +      + +LTHCNTGSLAT+ YGTALGVIRA
Sbjct  126  AAEKMLAADVASNKAIGAYGAEALLQAKPASGNGMRVLTHCNTGSLATSQYGTALGVIRA  185

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGA  252
            ++  G LE A CTETRP+NQGSRLTAFELV + IPA L+ADSAAA+L   GRV+AV+VGA
Sbjct  186  LHAQGKLETAICTETRPYNQGSRLTAFELVHDKIPAILVADSAAASLQSLGRVDAVVVGA  245

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DRIAANGDTANKIGTYSLA+ A HHGVPFYVA+PLT++D +  SG++I+IEERSPKEL H
Sbjct  246  DRIAANGDTANKIGTYSLALSAFHHGVPFYVASPLTTIDTATKSGKEIIIEERSPKELTH  305

Query  71   THGGLGEQIAASGISVWNPAFDV  3
            +HGG G QIAA G+ VWNPAFDV
Sbjct  306  SHGGQGTQIAADGVGVWNPAFDV  328



>emb|CBV37018.1| 5-methylthioribose-1-phosphate isomerase [Plantago major]
Length=163

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  497  THCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatl  318
            TH NTGSLATAGYGTALGVIR+++  G L RA+CTETRPFNQGSRLTAFELV E IPATL
Sbjct  1    THRNTGSLATAGYGTALGVIRSLHAEGVLLRAFCTETRPFNQGSRLTAFELVHEKIPATL  60

Query  317  iadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSV  138
            IADSAAAALMK G V+AVIVGADR+AANGDTANKIGTY+LA+CAMH  +PFYVAAPLTSV
Sbjct  61   IADSAAAALMKGGHVSAVIVGADRVAANGDTANKIGTYNLALCAMHGHIPFYVAAPLTSV  120

Query  137  DLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAF  9
            DL+LSSGQ+IVIEERSPKELL+  GGLGEQ+AASGISVWNPAF
Sbjct  121  DLTLSSGQEIVIEERSPKELLNAEGGLGEQVAASGISVWNPAF  163



>gb|KHN06061.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=238

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 162/202 (80%), Gaps = 26/202 (13%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE+MLEDDVASN+AIGS+GAS++Q+Q    +K S+LTHCNTGSLATAGYGTALGVIRA+
Sbjct  28   AAEVMLEDDVASNRAIGSYGASIIQHQ-TEKQKFSVLTHCNTGSLATAGYGTALGVIRAL  86

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++AG LERAYC+ETRPFNQGSRLTAFELV E IP TLI+DSAAAALMKAG V+AV+VGAD
Sbjct  87   HSAGVLERAYCSETRPFNQGSRLTAFELVHEKIPGTLISDSAAAALMKAGHVDAVVVGAD  146

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A+NGDTANKIGTYS+A+ A  H VPFY                         KELL+T
Sbjct  147  RVASNGDTANKIGTYSVALSAKFHNVPFY-------------------------KELLNT  181

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            HGGLGEQIAASGI VWNPAFDV
Sbjct  182  HGGLGEQIAASGIFVWNPAFDV  203



>ref|XP_003218379.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
 ref|XP_008104501.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
Length=359

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE ML+ D+  N++IG HGA  L  Q VG  K+ +LTHCNTGSLATAGYGTALGVIR+++
Sbjct  130  AEAMLDQDLKDNRSIGDHGALHLLQQ-VGQDKVIVLTHCNTGSLATAGYGTALGVIRSLH  188

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            T G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADS  +  MK  +++AVIVGADR
Sbjct  189  TMGCLEHVYCTETRPYNQGARLTAYELVYEEIPATLIADSMVSMAMKEKKISAVIVGADR  248

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL  G QI+IEER  +EL   +
Sbjct  249  VVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLEHGGQIIIEERPSQELTDIN  308

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G ++AA GI VWNPAFDV
Sbjct  309  ---GVRVAAPGIGVWNPAFDV  326



>ref|XP_001604505.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nasonia vitripennis]
Length=350

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            MLE DVA NKAIG HGA+ +       K + I+THCNTGSLATAGYGTALGVIR++++ G
Sbjct  130  MLEKDVADNKAIGDHGAAEILKTHPNEKNLRIITHCNTGSLATAGYGTALGVIRSIHSNG  189

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE AYCTETRP+NQG+RLTA+ELV + IP+TLI D   AALMK+  ++AV+VGADR+ A
Sbjct  190  KLEHAYCTETRPYNQGARLTAYELVHDKIPSTLICDDMVAALMKSKNISAVVVGADRVVA  249

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A HH VPFYVAAP T++D S+ +G+ I IEER   EL H +G  
Sbjct  250  NGDTANKIGTYQIAVLAKHHNVPFYVAAPFTTIDFSIPTGEGIKIEERPANELTHVNGT-  308

Query  56   GEQIAASGISVWNPAFDV  3
              +IAA GI+VWNPAFDV
Sbjct  309  --RIAAEGINVWNPAFDV  324



>ref|XP_006621213.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Apis dorsata]
Length=355

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE AYC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKKNSLELAYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEER  +EL H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEERPERELTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    ++IAA GI  WNPAFD+
Sbjct  307  N---DQRIAAPGIQCWNPAFDI  325



>ref|XP_392553.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X4 [Apis mellifera]
Length=355

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE  YC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKKNSLELVYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEER  +EL H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEERPERELTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    ++IAA GI  WNPAFDV
Sbjct  307  N---DQRIAAPGIQCWNPAFDV  325



>ref|XP_003697763.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Apis 
florea]
Length=355

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE AYC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKKNSLELAYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ +G  I+IEER  +EL H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPNGDHIIIEERPERELTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    ++IAA GI  WNPAFDV
Sbjct  307  N---DQRIAAPGIQCWNPAFDV  325



>gb|EPY88013.1| hypothetical protein CB1_000201003 [Camelus ferus]
Length=263

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  34   AEDMLEKDLRDNRSIGDLGARHLLERAAPGGDKVTVLTHCNTGALATAGYGTALGVIRSL  93

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  94   HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  153

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  154  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDV  213

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI++WNPAFDV
Sbjct  214  N---GVRIAAPGIAIWNPAFDV  232



>ref|XP_001742754.1| hypothetical protein [Monosiga brevicollis MX1]
 sp|A9UQ62.1|MTNA_MONBE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Monosiga 
brevicollis]
 gb|EDQ92992.1| predicted protein [Monosiga brevicollis MX1]
Length=361

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E M++ D+A N+AIG  GA  +   L    K+ +LTHCNTGSLATA YGTALGVIR+++ 
Sbjct  128  EGMMQADIADNQAIGKFGAEAILKDLSADVKVKVLTHCNTGSLATARYGTALGVIRSLHE  187

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE A+CTETRP+NQG+RLTA+ELVTE IP TL+ADS  + LMK   ++AV+VGADR+
Sbjct  188  QQRLEHAFCTETRPYNQGARLTAYELVTEGIPGTLVADSMVSLLMKQKGISAVVVGADRV  247

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
             ANGDTANKIGTY +A+ A HHGVPF+VAAPLTSVDL LS G +I IEER  KEL H   
Sbjct  248  VANGDTANKIGTYQIAIAAKHHGVPFFVAAPLTSVDLKLSHGSEITIEERPGKELTHI--  305

Query  62   GLGEQIAASGISVWNPAFDV  3
              G+Q+AA GI  WNPAFDV
Sbjct  306  -FGQQLAAPGIGTWNPAFDV  324



>ref|XP_011052943.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acromyrmex 
echinatior]
 gb|EGI66416.1| Methylthioribose-1-phosphate isomerase [Acromyrmex echinatior]
Length=362

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTA  420
            ML DD+  NKAIG  GA  +L+N   GS  + +LTHCNTGSLATAGYGTALGVIR+++  
Sbjct  134  MLMDDIKDNKAIGKFGADEILRNVPEGSS-VRVLTHCNTGSLATAGYGTALGVIRSLHEM  192

Query  419  GFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIA  240
            G LE  YCTETRP+NQG+RLTA+ELV + IPATLI D   AALMK  ++ AV+VGADR+A
Sbjct  193  GRLEHVYCTETRPYNQGARLTAYELVHDKIPATLICDDMVAALMKTKQITAVVVGADRVA  252

Query  239  ANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGG  60
            ANGDTANKIGTY +A+ A +H VPFYVAAPLTS+DL++S+G QIVIEERS +E+ H +  
Sbjct  253  ANGDTANKIGTYQIAILAKYHDVPFYVAAPLTSIDLNVSNGDQIVIEERSEQEMTHMN--  310

Query  59   LGEQIAASGISVWNPAFDV  3
              ++IAA GI+ WNPAFDV
Sbjct  311  -DKRIAAEGITCWNPAFDV  328



>ref|XP_003760740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sarcophilus 
harrisii]
Length=358

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE DV  N++IG HGA  LL+    G  ++++LTHCNTGSLATAGYGTALGVIR++
Sbjct  129  AEHMLEKDVKDNQSIGDHGAQHLLERVAPGGGQVTVLTHCNTGSLATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP+NQG+RLTA+ELV E IPATLI DS  AA +    V AVIVGAD
Sbjct  189  HALGRLKHVFCTETRPYNQGARLTAYELVYEKIPATLITDSMVAAAIAHKEVGAVIVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVA P++S DLSL +GQ+IVIEER  +EL + 
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVATPVSSCDLSLKTGQEIVIEERPGQELTNL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G +IAA GI VWNPAFDV
Sbjct  309  ---CGTRIAAPGIGVWNPAFDV  327



>ref|XP_006003718.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Latimeria chalumnae]
Length=357

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E MLE DV+ NK IG HGA  + +  V  +K+++LTHCNTGSLATAGYGTALGV+R++  
Sbjct  130  EAMLEKDVSDNKNIGRHGAQHILST-VKKEKVTVLTHCNTGSLATAGYGTALGVVRSLQA  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
             G L   YCTETRP+NQG+RLTA+ELV E+IP+TLIADS  +  MKA  ++AV+VGADR+
Sbjct  189  EGRLAHVYCTETRPYNQGARLTAYELVYEHIPSTLIADSMVSIAMKAKGISAVVVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
             ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DL+L +G+QIVIEERS  EL   + 
Sbjct  249  VANGDTANKIGTYQLAIAAKYHGIPFYVAAPSTSCDLTLENGEQIVIEERSHSELTDVN-  307

Query  62   GLGEQIAASGISVWNPAFDV  3
              G +IAA GI+VWNPAFDV
Sbjct  308  --GMRIAAPGIAVWNPAFDV  325



>ref|XP_005310723.1| PREDICTED: methylthioribose-1-phosphate isomerase [Chrysemys 
picta bellii]
Length=359

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 155/201 (77%), Gaps = 4/201 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE MLE D+  N++IG HGA  L  Q     K+++LTHCNTGSLATAGYGTALGVIR+++
Sbjct  130  AEAMLEKDLRDNRSIGEHGARHLL-QASPQDKVTVLTHCNTGSLATAGYGTALGVIRSLH  188

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G LE  YCTETRP+NQG+RLTA+ELV E+IPATLIADS  +  MK   V+AVIVGADR
Sbjct  189  ALGCLEHVYCTETRPYNQGARLTAYELVYEHIPATLIADSMVSVAMKEKGVSAVIVGADR  248

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL+ G +IVIEER  +EL   +
Sbjct  249  VVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLAEGAEIVIEERPSQELTDVN  308

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  309  ---GVRIAAPGIGVWNPAFDV  326



>ref|XP_004993054.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
 gb|EGD74153.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
Length=378

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E M+  D+A N+AIG HGA  +  +  G  K+ ILTHCNTGSLATA YGTALGVIR ++ 
Sbjct  143  EGMMAADIADNRAIGKHGAEAILAK-TGKDKVRILTHCNTGSLATAQYGTALGVIRCLHE  201

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
             G L+ A+CTETRP+NQG+RLTA+ELVTE IP+TL+ADS  + LMK   ++AV+VGADR+
Sbjct  202  LGSLDHAFCTETRPYNQGARLTAYELVTEKIPSTLVADSMVSVLMKEKDISAVVVGADRV  261

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
             ANGDTANKIGTY +A+ A HHGVPFYVAAP+TSVDL L  G  IVIEER   EL H   
Sbjct  262  VANGDTANKIGTYQIAIAAKHHGVPFYVAAPITSVDLDLPDGSHIVIEERKGDELTHI--  319

Query  62   GLGEQIAASGISVWNPAFDV  3
              G+++AA GI+ WNPAFDV
Sbjct  320  -FGKRLAAPGINTWNPAFDV  338



>ref|XP_003700639.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Megachile 
rotundata]
Length=355

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ DVA NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLDKDVADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE AYC+ETRP+NQG+RLTA+ELV E IPATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKKNSLEHAYCSETRPYNQGARLTAYELVYEKIPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEER  +EL H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEERPERELTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    +++AA GI  WNPAFDV
Sbjct  307  N---NQRVAAPGIQCWNPAFDV  325



>emb|CAD27760.1| putative translation initiation factor [Anopheles gambiae]
Length=348

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D++ N+AIG +GA++L   +   + + +LTHCNTGSLATAGYGTALGVIR+V
Sbjct  124  AIEYMLEKDISDNRAIGDNGANVLVKGV--DRPLKLLTHCNTGSLATAGYGTALGVIRSV  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            N    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AAL+ + +++A+IVGAD
Sbjct  182  NERNLLEHVYCTETRPYNQGARLTAYELVHDKLPATLVTDSMVAALLNSRKIDAIIVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HHGVPFYVAAP TS+D+++  G  I IEER   EL  T
Sbjct  242  RVAANGDTANKIGTYQMAVVAKHHGVPFYVAAPFTSIDVAIEDGSHIKIEERPEHEL--T  299

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            H G G++IAA GI  WNPAFDV
Sbjct  300  HIG-GQRIAAPGIGCWNPAFDV  320



>ref|XP_321518.1| AGAP001589-PA [Anopheles gambiae str. PEST]
 sp|Q7PKS9.1|MTNA_ANOGA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Anopheles 
gambiae]
 gb|EAA43149.1| AGAP001589-PA [Anopheles gambiae str. PEST]
Length=351

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D++ N+AIG +GA++L   +   + + +LTHCNTGSLATAGYGTALGVIR+V
Sbjct  127  AIEYMLEKDISDNRAIGDNGANVLVKGV--DRPLKLLTHCNTGSLATAGYGTALGVIRSV  184

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            N    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AAL+ + +++A+IVGAD
Sbjct  185  NERNLLEHVYCTETRPYNQGARLTAYELVHDKLPATLVTDSMVAALLNSRKIDAIIVGAD  244

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HHGVPFYVAAP TS+D+++  G  I IEER   EL  T
Sbjct  245  RVAANGDTANKIGTYQMAVVAKHHGVPFYVAAPFTSIDVAIEDGSHIKIEERPEHEL--T  302

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            H G G++IAA GI  WNPAFDV
Sbjct  303  HIG-GQRIAAPGIGCWNPAFDV  323



>ref|XP_004530069.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004530070.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004530071.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Ceratitis capitata]
Length=356

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 155/203 (76%), Gaps = 5/203 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ D+A NKAIG +GA  + N       I +LTHCNTGSLATAGYGTALGV+R +
Sbjct  127  ATEAMLQKDIADNKAIGKNGAEAILNTCAKDTAIRVLTHCNTGSLATAGYGTALGVVRKL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A  + AV+VGAD
Sbjct  187  HELKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAKNIAAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH-  305

Query  68   HGGLGE-QIAASGISVWNPAFDV  3
               +GE +IAA GI+ WNPAFDV
Sbjct  306  ---VGEHRIAAPGINCWNPAFDV  325



>ref|XP_006175447.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelus ferus]
Length=358

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERAAPGGDKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI++WNPAFDV
Sbjct  309  N---GVRIAAPGIAIWNPAFDV  327



>ref|XP_010992133.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelus dromedarius]
Length=358

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERAAPGGDKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI++WNPAFDV
Sbjct  309  N---GVRIAAPGIAIWNPAFDV  327



>ref|XP_010952462.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Camelus bactrianus]
 ref|XP_010952463.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Camelus bactrianus]
Length=359

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  130  AEDMLEKDLRDNRSIGDLGARHLLERAAPGGDKVTVLTHCNTGALATAGYGTALGVIRSL  189

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  190  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  249

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  250  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDV  309

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI++WNPAFDV
Sbjct  310  N---GVRIAAPGIAIWNPAFDV  328



>ref|XP_001510432.2| PREDICTED: methylthioribose-1-phosphate isomerase [Ornithorhynchus 
anatinus]
Length=324

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE DV  N+ IG HGA  +L+       K+++LTHCNTGSLATAGYGTALGVIR++
Sbjct  95   AENMLEKDVGDNRKIGDHGARHILERAAPTGGKVTVLTHCNTGSLATAGYGTALGVIRSL  154

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G L+  YCTETRP+NQG+RLTA+ELV E IPATLIADS  +  M    V+AV+VGAD
Sbjct  155  HSLGRLDHVYCTETRPYNQGARLTAYELVYEKIPATLIADSMVSVAMARRGVSAVVVGAD  214

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS D SL SG++IVIEER  +EL   
Sbjct  215  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDPSLPSGREIVIEERPERELTDL  274

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  275  N---GVRIAAPGIGVWNPAFDV  293



>ref|XP_006918814.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pteropus alecto]
 gb|ELK06741.1| Methylthioribose-1-phosphate isomerase [Pteropus alecto]
Length=361

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  130  AEDMLEKDLRDNRSIGDLGAHHLLERAAPKGGKVTVLTHCNTGALATAGYGTALGVIRSL  189

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AVIVGAD
Sbjct  190  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQGVSAVIVGAD  249

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQQIVIEER  +EL   
Sbjct  250  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLETGQQIVIEERPGQELTDV  309

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  310  N---GVRIAAPGIGVWNPAFDV  328



>ref|XP_011380861.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pteropus vampyrus]
Length=361

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  130  AEDMLEKDLRDNRSIGDLGAHHLLERAAPKGGKVTVLTHCNTGALATAGYGTALGVIRSL  189

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AVIVGAD
Sbjct  190  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQGVSAVIVGAD  249

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQQIVIEER  +EL   
Sbjct  250  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLETGQQIVIEERPGQELTDV  309

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  310  N---GVRIAAPGIGVWNPAFDV  328



>ref|XP_003486247.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
impatiens]
Length=355

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE AYC+ETRP+NQG+RLTA+ELV E++PATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKRNSLEHAYCSETRPYNQGARLTAYELVYEDVPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D ++ +G  IVIEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFTIPNGDHIVIEERPEREMTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    ++IAA GI  WNPAFDV
Sbjct  307  N---DQRIAAPGIQCWNPAFDV  325



>ref|XP_003397603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
terrestris]
Length=355

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE AYC+ETRP+NQG+RLTA+ELV E++PATLI D   AALMK+  ++AV+VGAD
Sbjct  187  HKRNSLEHAYCSETRPYNQGARLTAYELVYEDVPATLICDDMVAALMKSRNISAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D ++ +G  IVIEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFTIPNGDHIVIEERPEREMTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +    ++IAA GI  WNPAFDV
Sbjct  307  N---DQRIAAPGIQCWNPAFDV  325



>gb|EHJ70136.1| eIF2B-alpha-like protein [Danaus plexippus]
Length=351

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 154/201 (77%), Gaps = 5/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML  D+  NKAIG +G   +   + G   + ILTHCNTGSLATAGYGTALGVIR++N 
Sbjct  129  ENMLIKDIEDNKAIGKYGCEAILKTIEGDGHVRILTHCNTGSLATAGYGTALGVIRSLNA  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
            A  LE  YCTETRP+NQG+RLTA+ELV E IPATL+ DS  AA+M A  ++AV+VGADR+
Sbjct  189  AKKLEHVYCTETRPYNQGARLTAYELVHEKIPATLVVDSMVAAIMHARNISAVVVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY +A+ A HH VPFYVAAPLTS+D+SL SG +I IEER  +E+ H   
Sbjct  249  AANGDTANKIGTYQIAIVAKHHNVPFYVAAPLTSIDMSLKSGDRIKIEERPDREMTH---  305

Query  62   GLGE-QIAASGISVWNPAFDV  3
             +GE +IAA GI+ WNP+FDV
Sbjct  306  -IGEHRIAAPGINCWNPSFDV  325



>ref|XP_007422307.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Python bivittatus]
 ref|XP_007422308.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Python bivittatus]
Length=359

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE++L+ D+  NK IG HGA  L  Q VG  K+ +LTHCNTGSLATAGYGTALG+IR+++
Sbjct  130  AEMLLQKDLEDNKNIGEHGACHLL-QRVGQGKVRVLTHCNTGSLATAGYGTALGIIRSLH  188

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G LE  YCTETRP+NQG+RLTA+ELV E +P+TLIADS A+  MK  +++AVIVGADR
Sbjct  189  AMGRLEHVYCTETRPYNQGARLTAYELVYEQVPSTLIADSMASLAMKEKKISAVIVGADR  248

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A +HG+PFYVAAP TS DL+L  G QI+IEER  +EL   +
Sbjct  249  VVANGDTANKVGTYQLAIAARYHGIPFYVAAPSTSCDLNLEHGGQIIIEERPTQELTDIN  308

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  309  ---GVRIAAPGIGVWNPAFDV  326



>ref|XP_011143671.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
 ref|XP_011143672.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
Length=361

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            MLE DVA N+AIG++GA  +   +     I ILTHCNTGSLATAGYGTALGVIR++    
Sbjct  131  MLEKDVADNQAIGNYGADEILRSVPRDSFIRILTHCNTGSLATAGYGTALGVIRSLRRRK  190

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             L+  YCTETRP+NQG+RLTA+ELV + IPATLI D   AAL+K+ ++ AV+VGADR+AA
Sbjct  191  KLDHVYCTETRPYNQGARLTAYELVHDKIPATLICDDMVAALLKSKQITAVVVGADRVAA  250

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +A+ A HHGVPFYVAAP TS+D +++SG QIVIEER  +E+ H     
Sbjct  251  NGDTANKIGTYQIAILAKHHGVPFYVAAPRTSIDFAIASGDQIVIEERPEREMTHIK---  307

Query  56   GEQIAASGISVWNPAFDV  3
             ++IAA GI  WNPAFDV
Sbjct  308  NQRIAAPGIQCWNPAFDV  325



>ref|XP_006206282.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vicugna pacos]
Length=358

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERAAPEGDKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI+VWNPAFDV
Sbjct  309  N---GVRIAAPGIAVWNPAFDV  327



>gb|KIW51203.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala xenobiotica]
Length=395

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 162/227 (71%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NKAIG HGA  ++   V  +K        + +LTHCNTGSLATAGYG
Sbjct  137  VAAERMLVDDVSDNKAIGEHGARWIEENTVAGRKRKQEKSQELQVLTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--  282
            TALGVIR++ TA  L RAYC+ETRP+NQGSRLTA+ELV + IPATLI DS A AL+    
Sbjct  197  TALGVIRSLRTADMLTRAYCSETRPYNQGSRLTAYELVHDQIPATLITDSMACALLAKQG  256

Query  281  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             R+ A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T++DL+ +SGQ IVI
Sbjct  257  DRLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRTTIDLATASGQDIVI  316

Query  101  EERSPKELLHTHG-----------GLGEQI---AASGISVWNPAFDV  3
            EER+P+E+    G             G ++   AA GI VWNPAFDV
Sbjct  317  EERAPEEVTRIKGPKVTPEGKILVDEGAEVISTAAIGIEVWNPAFDV  363



>ref|XP_006262838.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
mississippiensis]
Length=387

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 156/201 (78%), Gaps = 3/201 (1%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE MLE D+  N+ IG  GA+ +   +    ++++LTHCNTG+LATAGYGTALGVIRA++
Sbjct  130  AEEMLEKDLQDNRRIGELGATCMMQGVAPQGQVTVLTHCNTGALATAGYGTALGVIRALH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADSAAA  +K   ++A++VGADR
Sbjct  190  ARGCLEHVYCTETRPYNQGARLTAYELVYEGIPATLIADSAAALALKEKGISAIVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ AMHHGVPFYVAAP TS DLSL++G QI+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIAAMHHGVPFYVAAPSTSCDLSLATGDQIIIEERPSQELTDIN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA  I VWNPAFDV
Sbjct  310  ---GIRIAAPDIGVWNPAFDV  327



>emb|CDS04006.1| hypothetical protein LRAMOSA06961 [Absidia idahoensis var. thermophila]
Length=372

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV  NK IG +GA  + + +     IS+LTHCNTGSLATAG+GTALG+IR +
Sbjct  132  AAEKMLVDDVQDNKNIGKYGAEYIVDHVKDKSNISVLTHCNTGSLATAGWGTALGIIRDL  191

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG-RVNAVIVGA  252
            +  G L+ A+CTETRP+NQGSRLTA+ELV E+IPATLI DS A+AL++    V A+IVGA
Sbjct  192  HHNGNLKHAFCTETRPYNQGSRLTAYELVYESIPATLICDSMASALLRLNPSVQAIIVGA  251

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DLS+SSG++IVIEER  KEL+ 
Sbjct  252  DRVAANGDTANKIGTYQLAITAKHHGILFIVAAPSTSIDLSMSSGKEIVIEERPAKELVT  311

Query  71   THGGLGEQ------IAASGISVWNPAFDV  3
            T G L ++       AA GI VWNP+FDV
Sbjct  312  TTGVLDDKSSATVHTAAEGIQVWNPSFDV  340



>ref|XP_006023465.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
sinensis]
Length=387

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 156/201 (78%), Gaps = 3/201 (1%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE MLE D+  N+ IG  GA+ +   +    ++++LTHCNTG+LATAGYGTALGVIRA++
Sbjct  130  AEEMLEKDLQDNRRIGELGATCMMRGVAPQGQVTVLTHCNTGALATAGYGTALGVIRALH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADSAAA  +K   ++A++VGADR
Sbjct  190  ARGCLEHVYCTETRPYNQGARLTAYELVYEGIPATLIADSAAALALKEKGISAIVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ AMHHGVPFYVAAP TS DLSL++G QI+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIAAMHHGVPFYVAAPSTSCDLSLATGDQIIIEERPSQELTDIN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA  I VWNPAFDV
Sbjct  310  ---GIRIAAPDIGVWNPAFDV  327



>ref|XP_002072272.1| GK22419 [Drosophila willistoni]
 sp|B4NG41.1|MTNA_DROWI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
willistoni]
 gb|EDW83258.1| GK22419 [Drosophila willistoni]
Length=365

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 159/212 (75%), Gaps = 14/212 (7%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLV---------GSKKISILTHCNTGSLATAGYG  456
            A E ML+ D+A N+AIG++GA  +  ++          G+  + +LTHCNTGSLATAGYG
Sbjct  127  ATEAMLQKDIADNRAIGANGAQAILKRVATTLGAAGTSGNGSVRVLTHCNTGSLATAGYG  186

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  276
            TALGVIR ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  
Sbjct  187  TALGVIRNLHELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKN  246

Query  275  VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  96
            V AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL + SG  I+IEE
Sbjct  247  VAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLQIPSGDHIIIEE  306

Query  95   RSPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
            R  +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  RPDREMTH----VGEHRIAAPGINCWNPAFDV  334



>gb|KEQ63615.1| Methylthioribose-1-phosphate isomerase [Aureobasidium melanogenum 
CBS 110374]
Length=395

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 161/219 (74%), Gaps = 17/219 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLATAGYGTALGVIR+
Sbjct  132  AAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLATAGYGTALGVIRS  191

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG----RVNAV  264
            V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL++       + A+
Sbjct  192  VHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALLRLKGPTENIAAI  251

Query  263  IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  84
            +VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IVIEER+ K
Sbjct  252  VVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKSGADIVIEERAGK  311

Query  83   ELLHTHGGLGE------------QIAASGISVWNPAFDV  3
            E+    G   +             IAA+GI VWNPAFDV
Sbjct  312  EMTMIKGPCVKGASLDLKQIETVSIAANGIDVWNPAFDV  350



>gb|ETN63911.1| translation initiation factor eif-2b [Anopheles darlingi]
Length=351

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 153/200 (77%), Gaps = 5/200 (3%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E MLE D+  N+AIG +GA++L   +   + + +LTHCNTGSLATAGYGTALGVIR+V+ 
Sbjct  129  EQMLEKDIKDNRAIGDNGANVLLKGI--DRPLKLLTHCNTGSLATAGYGTALGVIRSVHE  186

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AAL+   +++A+IVGADR+
Sbjct  187  RNLLEHVYCTETRPYNQGARLTAYELVHDQLPATLVTDSMVAALLHTRKIDAIIVGADRV  246

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY +AV A HH VPFYVAAP TS+D  +  G +I IEER  KEL  TH 
Sbjct  247  AANGDTANKIGTYQIAVVAKHHQVPFYVAAPFTSIDFDIEDGSRIRIEERPEKEL--THL  304

Query  62   GLGEQIAASGISVWNPAFDV  3
            G G++IAA GI  WNPAFDV
Sbjct  305  G-GQRIAAPGIGCWNPAFDV  323



>gb|KEQ71351.1| Methylthioribose-1-phosphate isomerase [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=395

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 161/219 (74%), Gaps = 17/219 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLATAGYGTALGVIR+
Sbjct  132  AAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLATAGYGTALGVIRS  191

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG----RVNAV  264
            V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL++       + A+
Sbjct  192  VHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALLRLKGPTENIAAI  251

Query  263  IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  84
            +VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IVIEER+ K
Sbjct  252  VVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKSGADIVIEERAGK  311

Query  83   ELLHTHGGLGE------------QIAASGISVWNPAFDV  3
            E+    G   +             IAA+GI VWNPAFDV
Sbjct  312  EMTMIKGPCFKGASLDLEQIETVSIAANGIDVWNPAFDV  350



>ref|XP_002733184.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Saccoglossus 
kowalevskii]
Length=365

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            ML+ DVA NK++G HGA ++ NQ  G+  + ++THCNTGSLATAGYGTA+GVIRA++  G
Sbjct  130  MLKKDVADNKSMGQHGAKVIINQ-CGNDNLHVMTHCNTGSLATAGYGTAIGVIRALHEIG  188

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE AYCTETRP+NQGSRLTA+E+V + IPATLIADSA A  MK   ++AV+VGADR+ A
Sbjct  189  KLEHAYCTETRPYNQGSRLTAYEMVHDKIPATLIADSAVAMTMKTKPISAVVVGADRVVA  248

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +A+ A H G+PF+V +P TS+DL + SG+ IVIEERS  EL       
Sbjct  249  NGDTANKIGTYQMAIVAKHFGIPFFVVSPSTSIDLHIPSGEDIVIEERSHDELTKMK---  305

Query  56   GEQIAASGISVWNPAFDV  3
            G QIAA GI  WNPAFDV
Sbjct  306  GHQIAAPGIGCWNPAFDV  323



>ref|XP_001993776.1| GH21593 [Drosophila grimshawi]
 sp|B4JRX2.1|MTNA_DROGR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
grimshawi]
 gb|EDV94512.1| GH21593 [Drosophila grimshawi]
Length=363

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 157/210 (75%), Gaps = 12/210 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLV-------GSKKISILTHCNTGSLATAGYGTA  450
            A E MLE D+A N+AIGS+GA  +  ++         +  + +LTHCNTGSLATAGYGTA
Sbjct  127  ATEAMLEKDIADNRAIGSNGAKAILERVAEATGSPGSASPVRVLTHCNTGSLATAGYGTA  186

Query  449  LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  270
            LGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS  AAL +   V 
Sbjct  187  LGVVRHLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDSMVAALFRVKNVA  246

Query  269  AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  90
            AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL + SG+ I+IE R 
Sbjct  247  AVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLQIPSGEHIIIEVRP  306

Query  89   PKELLHTHGGLGE-QIAASGISVWNPAFDV  3
             +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  DREMTH----VGEHRIAAPGINCWNPAFDV  332



>ref|XP_001357949.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
 sp|Q29BB3.1|MTNA_DROPS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
pseudoobscura pseudoobscura]
 gb|EAL27085.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
Length=362

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 159/210 (76%), Gaps = 13/210 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK-------ISILTHCNTGSLATAGYGTA  450
            A E ML+ D+A N+AIG+HGA  +  QLV +         + +LTHCNTGSLATAGYGTA
Sbjct  127  ATEAMLKKDIADNRAIGAHGAKAIL-QLVAAAAGAPMAGPVRVLTHCNTGSLATAGYGTA  185

Query  449  LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  270
            LGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V 
Sbjct  186  LGVVRQLSELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNVA  245

Query  269  AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  90
            AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER 
Sbjct  246  AVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLHIPSGDHIIIEERP  305

Query  89   PKELLHTHGGLGE-QIAASGISVWNPAFDV  3
             +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  306  DREMTH----VGEHRIAAPGINCWNPAFDV  331



>ref|XP_003798062.1| PREDICTED: methylthioribose-1-phosphate isomerase [Otolemur garnettii]
Length=364

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL+     S K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLDKDLRDNRSIGDLGAHHLLERVAPSSGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    ++AV+VGAD
Sbjct  189  HNMGCLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMIHKGISAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLQTGQEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI+VWNPAFDV
Sbjct  309  N---GVRIAAPGIAVWNPAFDV  327



>ref|XP_011184740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184741.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184742.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184743.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184744.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
Length=356

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 157/203 (77%), Gaps = 5/203 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ D+A NKAIG++GA+ + +       + +LTHCNTGSLATAGYGTALGV+R +
Sbjct  127  ATEAMLQKDIADNKAIGTNGAAAILDISGKDSSVRVLTHCNTGSLATAGYGTALGVVRKL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A  + AV+VGAD
Sbjct  187  HDLKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAKNIAAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH-  305

Query  68   HGGLGE-QIAASGISVWNPAFDV  3
               +GE +IAA GI+ WNPAFDV
Sbjct  306  ---VGEHRIAAPGINCWNPAFDV  325



>ref|XP_003639811.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Canis lupus familiaris]
Length=369

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HTLGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGKEIVIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_001641945.1| predicted protein [Nematostella vectensis]
 sp|A7RF00.1|MTNA_NEMVE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nematostella 
vectensis]
 gb|EDO49882.1| predicted protein [Nematostella vectensis]
Length=350

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 151/200 (76%), Gaps = 5/200 (3%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML +D+A NKAIG  GA  +   + G   + +LTHCNTGSLATAGYGT LGVIR+++ 
Sbjct  126  EGMLSEDIAQNKAIGKFGAESILGAVGGP--VRMLTHCNTGSLATAGYGTGLGVIRSIHE  183

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE  YCTETRP+NQGSRLTA+ELV E IP+TLIADSA +  MK  +++AV+VGADRI
Sbjct  184  MKQLEHVYCTETRPYNQGSRLTAYELVYEKIPSTLIADSAVSMAMKTKKISAVVVGADRI  243

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            A NGDTANKIGTY LA+ A HH +PFYVAAP+TS+D SL +G  IVIEERSP EL     
Sbjct  244  ACNGDTANKIGTYQLALAAKHHEIPFYVAAPVTSIDFSLVNGDAIVIEERSPLELTSVK-  302

Query  62   GLGEQIAASGISVWNPAFDV  3
              G  +AASGI VWNPAFDV
Sbjct  303  --GIPVAASGIGVWNPAFDV  320



>ref|XP_002023756.1| GL27236 [Drosophila persimilis]
 sp|B4GYU1.1|MTNA_DROPE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
persimilis]
 gb|EDW27959.1| GL27236 [Drosophila persimilis]
Length=362

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 159/210 (76%), Gaps = 13/210 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK-------ISILTHCNTGSLATAGYGTA  450
            A E ML+ D+A N+AIG+HGA  +  QLV +         + +LTHCNTGSLATAGYGTA
Sbjct  127  ATEAMLKKDIADNRAIGAHGAKAIL-QLVAAAAGAPMAGPVRVLTHCNTGSLATAGYGTA  185

Query  449  LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  270
            LGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V 
Sbjct  186  LGVVRQLSELGKLEHIYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNVA  245

Query  269  AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  90
            AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER 
Sbjct  246  AVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLHIPSGDHIIIEERP  305

Query  89   PKELLHTHGGLGE-QIAASGISVWNPAFDV  3
             +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  306  DREMTH----VGEHRIAAPGINCWNPAFDV  331



>ref|XP_005336293.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Ictidomys tridecemlineatus]
Length=397

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  +L+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  168  AEDMLEKDLRDNRSIGDLGAHHILERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  227

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LER +CTETRP+NQG+RLTAFELV E+IPATLI DS AAA M    V+AV+VGAD
Sbjct  228  HNLGRLERTFCTETRPYNQGARLTAFELVYEHIPATLITDSMAAAAMAHRGVSAVVVGAD  287

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  288  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLQTGQEILIEERPGQELTDV  347

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  348  N---GVRIAAPGIEVWNPAFDV  366



>ref|XP_004009303.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Ovis aries]
Length=291

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  51   AEDMLEKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  110

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  111  HNLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGAD  170

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  171  RVVANGDTANKVGTYQLAITAKHHGIPFYVAAPSSSCDLRLETGQEIVIEERPGQELTDI  230

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  231  N---GIRIAAPGIGVWNPAFDV  249



>ref|XP_011210381.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
 ref|XP_011210382.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
Length=356

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 157/203 (77%), Gaps = 5/203 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ D+A NKAIG++GA+ + +       + +LTHCNTGSLATAGYGTALGV+R +
Sbjct  127  ATEAMLQKDIADNKAIGTNGAAAILDISGKDSSVRVLTHCNTGSLATAGYGTALGVVRKL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A  + AV+VGAD
Sbjct  187  HELKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAKNIAAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH-  305

Query  68   HGGLGE-QIAASGISVWNPAFDV  3
               +GE +IAA GI+ WNPAFDV
Sbjct  306  ---VGEHRIAAPGINCWNPAFDV  325



>ref|XP_011166414.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Solenopsis invicta]
Length=287

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            MLE D+  NK+IG  G++ +   +     + +LTHCNTGSLATAGYGTALGVIR+++  G
Sbjct  59   MLELDIKDNKSIGDFGSNEILGNVPKESCVRVLTHCNTGSLATAGYGTALGVIRSLHKTG  118

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE+ YCTETRP+NQG+RLTA+ELV E IPATLI D   AA+MK  +++AV+VGADRIA 
Sbjct  119  KLEQVYCTETRPYNQGARLTAYELVYEKIPATLICDDMVAAVMKTKQLSAVVVGADRIAR  178

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A +H +PFYVAAPLT+VD  + +G +I+IEERS +E+ H +   
Sbjct  179  NGDTANKIGTYQIAVLAKYHNIPFYVAAPLTTVDFQMPNGDKIIIEERSEREMTHIN---  235

Query  56   GEQIAASGISVWNPAFDV  3
             ++IAA GI+ WNPAFDV
Sbjct  236  DKRIAAEGITCWNPAFDV  253



>ref|XP_005615138.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase 1, partial [Equus caballus]
Length=310

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LAT+GYGTALGVIR++
Sbjct  81   AEDMLEKDLRDNRSIGDLGAQHLLEKAAPGGGKVTVLTHCNTGALATSGYGTALGVIRSL  140

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA CTETRP+NQG+RLTAFELV E IPATLIADSAAAA M    V+AV+VGAD
Sbjct  141  HRLGRLERALCTETRPYNQGARLTAFELVYEQIPATLIADSAAAAAMAQRGVSAVVVGAD  200

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  201  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLCLETGREIVIEERPGQELTDV  260

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G ++AA GI VWNPAFDV
Sbjct  261  S---GVRVAAPGIEVWNPAFDV  279



>gb|KEQ84160.1| Methylthioribose-1-phosphate isomerase [Aureobasidium pullulans 
EXF-150]
Length=395

 Score =   237 bits (604),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 160/219 (73%), Gaps = 17/219 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLATAGYGTALGVIR+
Sbjct  132  AAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLATAGYGTALGVIRS  191

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG----RVNAV  264
            V+  G L +A+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL++       + A+
Sbjct  192  VHARGSLRKAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALLRLKGPTENIAAI  251

Query  263  IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  84
            +VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IVIEER+ K
Sbjct  252  VVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLDTKSGADIVIEERAGK  311

Query  83   ELLHTHGGLGE------------QIAASGISVWNPAFDV  3
            E+    G   +             IAA+GI VWNPAFDV
Sbjct  312  EMTMIKGPCYKGSSLDLKQIETVSIAANGIDVWNPAFDV  350



>ref|XP_003123394.2| PREDICTED: methylthioribose-1-phosphate isomerase [Sus scrofa]
Length=397

 Score =   237 bits (604),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D++ N++IG  GA  LL+       K+ +LTHCNTG+LATAGYGTALGVIR++
Sbjct  168  AEDMLEKDLSDNRSIGDLGARHLLERAAPQGGKVIVLTHCNTGALATAGYGTALGVIRSL  227

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E+IPATLI DS AAA M    V+AV+VGAD
Sbjct  228  HSLGRLEHAFCTETRPYNQGARLTAFELVYEHIPATLITDSMAAAAMAHKGVSAVVVGAD  287

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L SGQ+I+IEER  +EL   
Sbjct  288  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLESGQEIIIEERPGQELTDV  347

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  348  N---GVRIAAPGIGVWNPAFDV  366



>ref|XP_006900885.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Elephantulus edwardii]
Length=379

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNQSIGDLGAHHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HRLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMVHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLETGQEIVIEERPGQELTDI  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_006874338.1| PREDICTED: methylthioribose-1-phosphate isomerase [Chrysochloris 
asiatica]
Length=358

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LLQ       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGAQHLLQRAAPEGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HHLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S D  L +GQ+IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAARYHGIPFYVAAPSSSCDFRLKTGQEIVIEERPGQELTDI  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_001953494.1| GF17194 [Drosophila ananassae]
 sp|B3M098.1|MTNA_DROAN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
ananassae]
 gb|EDV42055.1| GF17194 [Drosophila ananassae]
Length=364

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 156/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--------KISILTHCNTGSLATAGYGT  453
            A E MLE D+A N+AIGSHGA  +  ++  +          + +LTHCNTGSLATAGYGT
Sbjct  127  ATEAMLEKDIADNQAIGSHGAQAILKRVAEAAGAQTGTAGPVRVLTHCNTGSLATAGYGT  186

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  273
            ALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V
Sbjct  187  ALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNV  246

Query  272  NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  93
              V+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL++  G  I+IEER
Sbjct  247  AGVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLAIPGGDHIIIEER  306

Query  92   SPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
              +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  PDREMTH----VGEHRIAAPGINCWNPAFDV  333



>gb|KEQ98081.1| hypothetical protein AUEXF2481DRAFT_63242 [Aureobasidium subglaciale 
EXF-2481]
Length=395

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (74%), Gaps = 17/219 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRA  432
            AAE ML DDV+ NKAIG +GA  +L+N   G  ++SILTHCNTGSLATAGYGTALGVIR+
Sbjct  132  AAEQMLVDDVSDNKAIGENGADWILKNAAGGKDQVSILTHCNTGSLATAGYGTALGVIRS  191

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG----RVNAV  264
            V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL++       + A+
Sbjct  192  VHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALLRLKGPTENIAAI  251

Query  263  IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  84
            +VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IVIEER+ K
Sbjct  252  VVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKSGADIVIEERAGK  311

Query  83   ELLHTHGGLGE------------QIAASGISVWNPAFDV  3
            E+    G + +             IAA+GI VWNPAFDV
Sbjct  312  EMTMIKGPVFKGASLDLQQIETVSIAANGIDVWNPAFDV  350



>ref|XP_007098210.1| PREDICTED: methylthioribose-1-phosphate isomerase [Panthera tigris 
altaica]
Length=358

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  L  Q+  G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLEQVAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AVIVGAD
Sbjct  189  HTLGRLDHAFCTETRPYNQGARLTAFELVYERIPATLIADSMAAAAMAHRGVSAVIVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G+ I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLETGRDIIIEERPGRELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIEVWNPAFDV  327



>ref|XP_004399024.1| PREDICTED: methylthioribose-1-phosphate isomerase [Odobenus rosmarus 
divergens]
Length=398

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  169  AEDMLEKDLKDNRSIGDLGARHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  228

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  229  HTLGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGAD  288

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  289  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIVIEERPGQELTDV  348

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  349  N---GVRIAAPGIGVWNPAFDV  367



>ref|XP_007737063.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia epimyces 
CBS 606.96]
 gb|EXJ79275.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia epimyces 
CBS 606.96]
Length=396

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 162/227 (71%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQ------NQLVGSKK--ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NKAIG HGA  ++       Q  G K   + +LTHCNTGSLATAGYG
Sbjct  137  VAAERMLVDDVSDNKAIGEHGARWIEENTAAGRQRRGDKTCGLQVLTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--  282
            TALGVIR++  A  L RAYCTETRP+NQGSRLTA+ELV + +PATLI DS A AL+    
Sbjct  197  TALGVIRSLKAADMLTRAYCTETRPYNQGSRLTAYELVHDEVPATLITDSMACALLAREG  256

Query  281  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             R+ A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T++DL+ +SG+ IVI
Sbjct  257  NRLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRTTIDLTTASGKDIVI  316

Query  101  EERSPKELLHTHGGL----GE----------QIAASGISVWNPAFDV  3
            EER+P+E+    G      GE           IAA+GI VWNPAFDV
Sbjct  317  EERAPEEVTRIKGPKVTVDGEVQVDEAAQVISIAATGIDVWNPAFDV  363



>ref|XP_010740335.1| PREDICTED: methylthioribose-1-phosphate isomerase [Larimichthys 
crocea]
Length=353

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   + AV+VGAD
Sbjct  182  HSLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMDITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIEVWNPAFDV  320



>gb|EFN81802.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Harpegnathos saltator]
Length=363

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 153/200 (77%), Gaps = 5/200 (3%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            MLE DVA N+AIG++GA  +   +     I ILTHCNTGSLATAGYGTALGVIR++    
Sbjct  131  MLEKDVADNQAIGNYGADEILRSVPRDSFIRILTHCNTGSLATAGYGTALGVIRSLRRRK  190

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             L+  YCTETRP+NQG+RLTA+ELV + IPATLI D   AAL+K+ ++ AV+VGADR+AA
Sbjct  191  KLDHVYCTETRPYNQGARLTAYELVHDKIPATLICDDMVAALLKSKQITAVVVGADRVAA  250

Query  236  NGDTANKIGTY--SLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            NGDTANKIGTY  S+A+ A HHGVPFYVAAP TS+D +++SG QIVIEER  +E+ H   
Sbjct  251  NGDTANKIGTYQASIAILAKHHGVPFYVAAPRTSIDFAIASGDQIVIEERPEREMTHIK-  309

Query  62   GLGEQIAASGISVWNPAFDV  3
               ++IAA GI  WNPAFDV
Sbjct  310  --NQRIAAPGIQCWNPAFDV  327



>ref|XP_005336292.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Ictidomys tridecemlineatus]
Length=417

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  +L+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  168  AEDMLEKDLRDNRSIGDLGAHHILERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  227

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LER +CTETRP+NQG+RLTAFELV E+IPATLI DS AAA M    V+AV+VGAD
Sbjct  228  HNLGRLERTFCTETRPYNQGARLTAFELVYEHIPATLITDSMAAAAMAHRGVSAVVVGAD  287

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER  +EL   
Sbjct  288  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLQTGQEILIEERPGQELTDV  347

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  348  N---GVRIAAPGIEVWNPAFDV  366



>ref|XP_003982003.3| PREDICTED: methylthioribose-1-phosphate isomerase [Felis catus]
Length=358

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  L  Q+  G  K+ +LTHCNTG+LATAGYGTALGVIRA+
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLEQVAPGGGKVIVLTHCNTGALATAGYGTALGVIRAL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AVIVGAD
Sbjct  189  HTLGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIADSTAAAAMAHRGVSAVIVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G+ IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLETGRDIVIEERPGRELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_001664017.1| AAEL013828-PA [Aedes aegypti]
 sp|Q16I17.1|MTNA_AEDAE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aedes 
aegypti]
 gb|EAT33907.1| AAEL013828-PA [Aedes aegypti]
Length=360

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 154/203 (76%), Gaps = 5/203 (2%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ D+A N AIG +GA ++ + +     + ILTHCNTGSLATAGYGTALGVIR +
Sbjct  127  AIEDMLDKDIADNMAIGKNGADIILSHIPNGGSVRILTHCNTGSLATAGYGTALGVIRKL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    LE  YCTETRP+NQG+RLTA+ELV + +PATLI D+  A+L K+ RV AV+VGAD
Sbjct  187  HEMNRLEHVYCTETRPYNQGARLTAYELVHDKLPATLILDNMVASLFKSRRVAAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY + V A +H VPFYVAAP TS+DL + SG +IVIEER  +E+ H 
Sbjct  247  RVAANGDTANKIGTYQIGVVAKYHDVPFYVAAPFTSIDLKIPSGDRIVIEERPDREMTH-  305

Query  68   HGGLGE-QIAASGISVWNPAFDV  3
               +GE +IAA GI+ WNPAFDV
Sbjct  306  ---VGEHRIAAPGIACWNPAFDV  325



>emb|CDH49387.1| methylthioribose-1-phosphate isomerase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=398

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML DDV  NK IG +GA  + + +     IS+LTHCNTGSLATAG+GTALG+IR +
Sbjct  158  AAEKMLVDDVQDNKNIGKYGAEYIVDHVKDKSNISVLTHCNTGSLATAGWGTALGIIRDL  217

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG-RVNAVIVGA  252
            +  G L+ A+CTETRP+NQGSRLTA+ELV E+IPATL+ DS A+AL++    V A+IVGA
Sbjct  218  HHNGNLKHAFCTETRPYNQGSRLTAYELVYESIPATLVCDSMASALLRLNPSVQAIIVGA  277

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DLS++SG++IVIEER  KEL+ 
Sbjct  278  DRVAANGDTANKIGTYQLAITAKHHGILFVVAAPSTSIDLSMASGKEIVIEERPAKELVT  337

Query  71   THGGLGEQ------IAASGISVWNPAFDV  3
            T G L ++       AA GI VWNP+FDV
Sbjct  338  TTGVLDDKSSATVRTAAEGIQVWNPSFDV  366



>ref|XP_006779623.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase 1, partial [Myotis davidii]
Length=263

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  23   AEDMLEKDLKDNRSIGDLGAHHLLERAAPTGSKVTVLTHCNTGALATAGYGTALGVIRSL  82

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  83   HNLGRLKHVFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAATMAHRDVSAVVVGAD  142

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L  GQQIVIEER  +EL   
Sbjct  143  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLEMGQQIVIEERPGQELTDV  202

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  203  N---GVRIAAPGIGVWNPAFDV  221



>ref|XP_008505941.1| PREDICTED: methylthioribose-1-phosphate isomerase [Equus przewalskii]
Length=374

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LAT+GYGTALGVIR++
Sbjct  145  AEDMLEKDLRDNRSIGDLGAQHLLEKAAPGGGKVTVLTHCNTGALATSGYGTALGVIRSL  204

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA CTETRP+NQG+RLTAFELV E IPATLIADSAAAA M    V+AV+VGAD
Sbjct  205  HRLGRLERALCTETRPYNQGARLTAFELVYEQIPATLIADSAAAAAMAQRGVSAVVVGAD  264

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  265  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLCLETGREIVIEERPGQELTDV  324

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G ++AA GI VWNPAFDV
Sbjct  325  S---GVRVAAPGIEVWNPAFDV  343



>ref|XP_004389786.1| PREDICTED: methylthioribose-1-phosphate isomerase [Trichechus 
manatus latirostris]
Length=358

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGAHHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AA  M    V+AV+VGAD
Sbjct  189  HRLGRLECAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAATAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQ IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAITAKYHGIPFYVAAPSSSCDLRLETGQDIVIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_005185612.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
 ref|XP_005185613.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
Length=356

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 154/201 (77%), Gaps = 5/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML+ D++ NKAIG++GA  +         + +LTHCNTGSLATAGYGTALGV+R ++ 
Sbjct  129  EAMLQKDISDNKAIGANGAKAVLESAAKDGPVRVLTHCNTGSLATAGYGTALGVVRKLHE  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AAL++A  V AV+VGADR+
Sbjct  189  LKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALLRAKNVAAVVVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IEER  +E+ H   
Sbjct  249  AANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH---  305

Query  62   GLGE-QIAASGISVWNPAFDV  3
             +GE +IAA GI+ WNPAFDV
Sbjct  306  -VGEHRIAAPGINCWNPAFDV  325



>gb|KIX06934.1| S-methyl-5-thioribose-1-phosphate isomerase [Rhinocladiella mackenziei 
CBS 650.93]
Length=395

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 159/226 (70%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYGT  453
            AAE MLEDDV+ NKAIG HGA  ++   V  K+        + +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLEDDVSDNKAIGEHGARWIEENTVAGKRRKLDKEKELKVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPATLI DS A AL+     
Sbjct  198  ALGVIRSLRNADMLTRAYCSETRPYNQGSRLTAYELVHDKIPATLITDSMACALLAREGN  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
            ++ A++VGADR+AANGDTANKIGTYSLAV A HH V F VAAP T++DL+ +SG+ IVIE
Sbjct  258  QLAAIVVGADRVAANGDTANKIGTYSLAVLAKHHSVKFLVAAPRTTIDLATASGEYIVIE  317

Query  98   ERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFDV  3
            ER+P+E              LL   G     IAA GI VWNPAFDV
Sbjct  318  ERAPEEVTRMKGPKVTTDGKLLIDEGSEIISIAAVGIDVWNPAFDV  363



>ref|XP_005682375.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Capra hircus]
Length=346

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  106  AEDMLEKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  165

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  166  HNLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGAD  225

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  226  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIVIEERPGQELTDI  285

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  286  N---GVRIAAPGIGVWNPAFDV  304



>gb|EHH29705.1| Methylthioribose-1-phosphate isomerase [Macaca mulatta]
Length=369

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  189  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPAQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_004748335.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Mustela putorius furo]
 ref|XP_004824205.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Mustela putorius furo]
Length=418

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGAHHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +T G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HTLGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L SG++IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLESGREIVIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_010359906.1| PREDICTED: methylthioribose-1-phosphate isomerase [Rhinopithecus 
roxellana]
Length=369

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  189  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPAQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_008965945.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Pan paniscus]
Length=333

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  94   EDMLEKDLRDNRSIGDLGARHLLERAAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  153

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGADR
Sbjct  154  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGADR  213

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL + +
Sbjct  214  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTNVN  273

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  274  ---GVRIAAPGIGVWNPAFDV  291



>ref|XP_006993155.1| PREDICTED: methylthioribose-1-phosphate isomerase [Peromyscus 
maniculatus bairdii]
Length=368

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N+ IG  GA  LL++      K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRTIGDLGARHLLEHTSPKGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HEMGRLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLHLETGREIVIEERPSQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAQGIRVWNPAFDV  327



>ref|XP_003389526.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Amphimedon 
queenslandica]
Length=352

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            ML++D+++N +IG +GA  +  Q  G   ++ILTHCNTGSLA AGYGTALGVIR++   G
Sbjct  132  MLQEDISTNTSIGRNGAEHILTQYSGGD-VTILTHCNTGSLACAGYGTALGVIRSLQEKG  190

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             L++ YCTETRP+NQGSRLTA+ELVTE IP TLI DS AA LMK   V+AV+VGADR+ A
Sbjct  191  RLKQVYCTETRPYNQGSRLTAYELVTEGIPGTLICDSMAACLMKERHVSAVVVGADRVVA  250

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY LAV A +HG+PFY+AAP T++D S+SSG +IVIEER  +E++      
Sbjct  251  NGDTANKIGTYQLAVVARYHGIPFYIAAPFTTIDFSISSGSEIVIEERKKEEMICFA---  307

Query  56   GEQIAASGISVWNPAFDV  3
            G++IA  GI+ WNPAFDV
Sbjct  308  GKRIAPEGINCWNPAFDV  325



>ref|NP_001010947.1| methylthioribose-1-phosphate isomerase [Rattus norvegicus]
 sp|Q5HZE4.1|MTNA_RAT RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Rattus 
norvegicus]
 gb|AAH89060.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Rattus norvegicus]
 gb|EDL92227.1| similar to hypothetical protein MGC3207, isoform CRA_a [Rattus 
norvegicus]
Length=369

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HEMGRLEHTFCTETRPYNQGARLTAFELVYEKIPATLITDSMAAAAMVHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIVIEERPSQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAQGIRVWNPAFDV  327



>ref|XP_002054225.1| GJ22917 [Drosophila virilis]
 sp|B4LWZ8.1|MTNA_DROVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
virilis]
 gb|EDW67745.1| GJ22917 [Drosophila virilis]
Length=362

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 156/209 (75%), Gaps = 11/209 (5%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSK------KISILTHCNTGSLATAGYGTAL  447
            A E MLE D+A N+AIG++GA  +   +  S        + +LTHCNTGSLATAGYGTAL
Sbjct  127  ATEAMLEKDIADNRAIGANGAKAILEHVAESASAAAAGPVRVLTHCNTGSLATAGYGTAL  186

Query  446  GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  267
            GV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS  AAL++   V A
Sbjct  187  GVVRHLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDSMVAALLRVKNVAA  246

Query  266  VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  87
            V+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTSVDL + SG  I+IE R  
Sbjct  247  VVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSVDLQIPSGDHIIIEVRPD  306

Query  86   KELLHTHGGLGE-QIAASGISVWNPAFDV  3
            +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  REMTH----VGEHRIAAPGINCWNPAFDV  331



>ref|XP_009152452.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY51991.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala dermatitidis 
NIH/UT8656]
Length=396

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 159/226 (70%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYGT  453
            AAE ML DDVA NKAIG+HGA  ++   V  ++        + +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLVDDVADNKAIGAHGARWIEENTVAGRQRRQDKAHELEVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++     L RAYCTETRP+NQGSRLTA+ELV + IPATLI DS A AL+     
Sbjct  198  ALGVIRSLRAGNMLTRAYCTETRPYNQGSRLTAYELVHDEIPATLITDSMACALLAREGK  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
            R+ A++VGADR+AANGDTANKIGTYSLAV A HHG+ F VAAP T++DL   SG+ IVIE
Sbjct  258  RLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGIKFLVAAPRTTIDLRTPSGKDIVIE  317

Query  98   ERSPKELLHTHG------GLGE--------QIAASGISVWNPAFDV  3
            ER+P+E+    G      G  E         IAA+GI VWNPAFDV
Sbjct  318  ERAPEEVTRIRGPRVTAEGKVEVDEAAEVISIAAAGIDVWNPAFDV  363



>ref|NP_080699.3| methylthioribose-1-phosphate isomerase [Mus musculus]
 sp|Q9CQT1.1|MTNA_MOUSE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Mus 
musculus]
 dbj|BAB27014.1| unnamed protein product [Mus musculus]
 dbj|BAB29034.1| unnamed protein product [Mus musculus]
 gb|AAH25049.1| Methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) 
[Mus musculus]
 dbj|BAE37957.1| unnamed protein product [Mus musculus]
 gb|EDL10941.1| RIKEN cDNA 2410018C20, isoform CRA_b [Mus musculus]
Length=369

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HEMGRLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHGVPFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGVPFYVAAPSSSCDLHLETGKEIVIEERPSQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAQGIRVWNPAFDV  327



>ref|XP_005881674.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Myotis brandtii]
Length=305

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  65   AEDMLEKDLKDNRSIGDLGAHHLLERAAPTGSKVTVLTHCNTGALATAGYGTALGVIRSL  124

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  125  HNLGRLKHVFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRDVSAVVVGAD  184

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQQIVIEER  +EL   
Sbjct  185  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLETGQQIVIEERPGQELTDV  244

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  245  N---GVRIAAPGIGVWNPAFDV  263



>ref|XP_004688304.1| PREDICTED: methylthioribose-1-phosphate isomerase [Condylura 
cristata]
Length=358

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 157/203 (77%), Gaps = 6/203 (3%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSK--KISILTHCNTGSLATAGYGTALGVIRA  432
            AE MLE D+  N+ IG  GA  L + LV  +  K+++LTHCNTG+LATAGYGTALGVIR+
Sbjct  129  AEDMLEKDLRDNRRIGDLGARHLLD-LVAPEGGKVTVLTHCNTGALATAGYGTALGVIRS  187

Query  431  VNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGA  252
            ++  G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGA
Sbjct  188  LHKLGRLKHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGA  247

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L SGQ+IVIEER  +EL  
Sbjct  248  DRVVANGDTANKVGTYQLAILAKHHGIPFYVAAPSSSCDLHLDSGQEIVIEERPGQELTD  307

Query  71   THGGLGEQIAASGISVWNPAFDV  3
             H   G +IAA GI VWNPAFDV
Sbjct  308  VH---GIRIAAPGIGVWNPAFDV  327



>ref|XP_002001025.1| GI10562 [Drosophila mojavensis]
 sp|B4K8A4.1|MTNA_DROMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
mojavensis]
 gb|EDW16486.1| GI10562 [Drosophila mojavensis]
Length=362

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 156/209 (75%), Gaps = 11/209 (5%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSK------KISILTHCNTGSLATAGYGTAL  447
            A E MLE D+A N+AIG++GA  +   +  +        + +LTHCNTGSLATAGYGTAL
Sbjct  127  ATEAMLEKDIADNRAIGANGAKAILEHVAEATGVATAGPVRVLTHCNTGSLATAGYGTAL  186

Query  446  GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  267
            GV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS  AAL++   V A
Sbjct  187  GVVRNLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDSMVAALLRVKNVAA  246

Query  266  VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  87
            V+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL + SG  I+IE R  
Sbjct  247  VVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLEIPSGDHIIIEVRPD  306

Query  86   KELLHTHGGLGE-QIAASGISVWNPAFDV  3
            +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  REMTH----VGEHRIAAPGINCWNPAFDV  331



>ref|XP_004672487.1| PREDICTED: methylthioribose-1-phosphate isomerase [Jaculus jaculus]
Length=369

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N+ IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNQNIGDLGARHLLERVAPRGDKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HRLGRLERAFCTETRPYNQGARLTAFELVYEKIPATLIADSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G +IVIEER  +EL H 
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLHLQTGLEIVIEERPGQELTHV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  309  N---GVPIAAPGIGVWNPAFDV  327



>ref|XP_001366752.1| PREDICTED: methylthioribose-1-phosphate isomerase [Monodelphis 
domestica]
Length=355

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  ++++LTHCNTGSLATAGYGTALGVIR++
Sbjct  129  AEHMLEKDIKDNQSIGDLGAQHLLERVAPGGGQVTVLTHCNTGSLATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP NQG+RLTA+ELV ENIPATLI DS  A  M    V AVIVGAD
Sbjct  189  HALGRLKHVFCTETRPNNQGARLTAYELVYENIPATLITDSMGATAMAHKDVKAVIVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP++S DLSL +GQ+IVIEER  +EL  T
Sbjct  249  RVVANGDTANKVGTYQLAITAKYHGIPFYVAAPVSSCDLSLKTGQEIVIEERPSQEL--T  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
              G G +IAA GI VWNP+FDV
Sbjct  307  SLG-GTRIAAPGIGVWNPSFDV  327



>ref|XP_003915067.2| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Papio anubis]
Length=393

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  153  AEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  212

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  213  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGAD  272

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  273  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPAQELTDV  332

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  333  N---GVRIAAPGIGVWNPAFDV  351



>ref|XP_003972078.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Takifugu 
rubripes]
Length=353

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +    L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   ++AV+VGAD
Sbjct  182  HALARLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMNISAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHGVPFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGVPFYVAAPSTSCDLSLESGKDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIEVWNPAFDV  320



>ref|XP_004715550.1| PREDICTED: methylthioribose-1-phosphate isomerase [Echinops telfairi]
Length=358

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 160/202 (79%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+ +N++IG  GA  LL++   G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKNNRSIGDLGAQHLLEHAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HCLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLETGQEIVIEERLGQELTDI  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
             GG+  +IAA GI VWNPAFDV
Sbjct  309  -GGV--RIAAPGIGVWNPAFDV  327



>ref|XP_004066207.1| PREDICTED: methylthioribose-1-phosphate isomerase [Oryzias latipes]
Length=353

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E ML+ DV  NK IG++GA   Q+ L G  +  +S+LTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EEMLQRDVNDNKKIGNYGA---QHILSGVPRDSVSVLTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   ++AV+VGAD
Sbjct  182  HALGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMAISAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GLPIAAPGIEVWNPAFDV  320



>ref|XP_002761866.2| PREDICTED: methylthioribose-1-phosphate isomerase [Callithrix 
jacchus]
Length=374

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSK-KISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  L +Q+  +  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNESIGDFGALFLLDQVAPNGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE  +CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  189  HSLGRLEHVFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAATMAHKGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLHLETGKEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_003455807.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oreochromis 
niloticus]
 ref|XP_004539081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Maylandia 
zebra]
 ref|XP_005735752.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pundamilia 
nyererei]
 ref|XP_005925153.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Haplochromis 
burtoni]
 ref|XP_008278518.1| PREDICTED: methylthioribose-1-phosphate isomerase [Stegastes 
partitus]
Length=353

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 153/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  N+ IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   + AV+VGAD
Sbjct  182  HALGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMDITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIEVWNPAFDV  320



>ref|XP_007993674.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Chlorocebus sabaeus]
Length=403

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  163  AEDMLEKDLRDNRSIGDLGAHHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  222

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  223  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGAD  282

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  283  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPAQELTDV  342

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  343  N---GVRIAAPGIGVWNPAFDV  361



>ref|XP_004060186.1| PREDICTED: methylthioribose-1-phosphate isomerase [Gorilla gorilla 
gorilla]
Length=369

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 155/201 (77%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  130  EDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGADR
Sbjct  190  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPVQELTDVN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  310  ---GVRIAAPGIGVWNPAFDV  327



>gb|AIC57312.1| MRI1, partial [synthetic construct]
Length=369

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 154/201 (77%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  130  EDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V+AV+VGADR
Sbjct  190  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  310  ---GVRIAAPGIGVWNPAFDV  327



>ref|XP_011166413.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Solenopsis invicta]
 gb|EFZ13846.1| hypothetical protein SINV_10550 [Solenopsis invicta]
Length=361

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            MLE D+  NK+IG  G++ +   +     + +LTHCNTGSLATAGYGTALGVIR+++  G
Sbjct  133  MLELDIKDNKSIGDFGSNEILGNVPKESCVRVLTHCNTGSLATAGYGTALGVIRSLHKTG  192

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE+ YCTETRP+NQG+RLTA+ELV E IPATLI D   AA+MK  +++AV+VGADRIA 
Sbjct  193  KLEQVYCTETRPYNQGARLTAYELVYEKIPATLICDDMVAAVMKTKQLSAVVVGADRIAR  252

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A +H +PFYVAAPLT+VD  + +G +I+IEERS +E+ H +   
Sbjct  253  NGDTANKIGTYQIAVLAKYHNIPFYVAAPLTTVDFQMPNGDKIIIEERSEREMTHIN---  309

Query  56   GEQIAASGISVWNPAFDV  3
             ++IAA GI+ WNPAFDV
Sbjct  310  DKRIAAEGITCWNPAFDV  327



>gb|AEE61699.1| unknown [Dendroctonus ponderosae]
 gb|ENN76653.1| hypothetical protein YQE_06832, partial [Dendroctonus ponderosae]
Length=357

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            +LE D+  N++IG +GA  + +++ G  ++ ++THCNTGSLATAGYGTALGVIR+++   
Sbjct  133  LLEKDITDNQSIGDNGAKEILSRVSGDSQVRVVTHCNTGSLATAGYGTALGVIRSLHAMK  192

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE  YCTETRP+NQG+RLTAFEL+ + IP+TLI DS  +ALMK+  ++AV+VGADR+AA
Sbjct  193  RLEHVYCTETRPYNQGARLTAFELIHDKIPSTLICDSMVSALMKSRNISAVVVGADRVAA  252

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A +H VPFYVAAP TS+D  +S+G+ IVIEER  +E+ H    +
Sbjct  253  NGDTANKIGTYQIAVVAKYHAVPFYVAAPFTSIDAKVSTGEHIVIEERPDREMTH----V  308

Query  56   GE-QIAASGISVWNPAFDV  3
            GE +IAA GI  WNPAFDV
Sbjct  309  GEHRIAAKGIPCWNPAFDV  327



>ref|NP_001026897.1| methylthioribose-1-phosphate isomerase isoform 1 [Homo sapiens]
 sp|Q9BV20.1|MTNA_HUMAN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Mediator of RhoA-dependent 
invasion; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation factor 
eIF-2B subunit alpha/beta/delta-like protein [Homo sapiens]
 pdb|4LDQ|A Chain A, Crystal Structure Of The Mediator Of Rho Dependent Invasion
 pdb|4LDQ|B Chain B, Crystal Structure Of The Mediator Of Rho Dependent Invasion
 gb|AAH01703.1| Methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) 
[Homo sapiens]
 gb|AAQ88543.1| TLEA6390 [Homo sapiens]
 gb|EAW84370.1| hypothetical protein MGC3207, isoform CRA_b [Homo sapiens]
 gb|ACE86908.1| hypothetical protein MGC3207 protein [synthetic construct]
 gb|ACE87595.1| hypothetical protein MGC3207 protein [synthetic construct]
 gb|ADQ32721.1| hypothetical protein MGC3207 [synthetic construct]
Length=369

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 154/201 (77%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  130  EDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V+AV+VGADR
Sbjct  190  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  310  ---GVRIAAPGIGVWNPAFDV  327



>ref|XP_008156200.1| PREDICTED: methylthioribose-1-phosphate isomerase [Eptesicus 
fuscus]
Length=359

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  130  AEDMLEKDLKDNRSIGDLGAHHLLERAAPKGSKVTVLTHCNTGALATAGYGTALGVIRSL  189

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  190  HNLGRLKHVFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQDVSAVVVGAD  249

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQQIVIEER  +EL   
Sbjct  250  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLETGQQIVIEERPGQELTDV  309

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G +IAA GI VWNPAFDV
Sbjct  310  S---GVRIAAPGIGVWNPAFDV  328



>ref|XP_009235038.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Pongo abelii]
Length=367

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 155/201 (77%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LLQ       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  127  EDMLEKDLRDNRSIGDLGARHLLQRVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  186

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGADR
Sbjct  187  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGADR  246

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   +
Sbjct  247  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVN  306

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  307  ---GVRIAAPGIGVWNPAFDV  324



>gb|KIW17463.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala spinifera]
Length=395

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 161/226 (71%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKK-------ISILTHCNTGSLATAGYGT  453
            AAE ML DDV+ NKAIG HGA  ++ N + G ++       + +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLIDDVSDNKAIGEHGARWIEENTIAGRRRKQDKSHELKVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV +++PATLI DS A AL+     
Sbjct  198  ALGVIRSLRAADMLSRAYCSETRPYNQGSRLTAYELVHDHVPATLITDSMACALLAKEGD  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
             + A+IVGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T++DLS +SGQ IVIE
Sbjct  258  DLAAIIVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRTTIDLSTASGQDIVIE  317

Query  98   ERSPKELLHTHGGLGE--------------QIAASGISVWNPAFDV  3
            ER+P+E+    G   +                AA+GI VWNPAFDV
Sbjct  318  ERAPEEVTRVKGPKIDPDGRIRVDEDAEVISTAANGIDVWNPAFDV  363



>ref|XP_007780227.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
 gb|EON64910.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
Length=395

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 165/220 (75%), Gaps = 18/220 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYGTALGVIR  435
            AAE ML DDV  N+AIG HGA  +++N  VG S ++S+LTHCNTGSLATAGYGTALGVIR
Sbjct  132  AAEKMLVDDVQDNEAIGKHGAEWVVKNTEVGKSGQVSMLTHCNTGSLATAGYGTALGVIR  191

Query  434  AVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG----RVNA  267
            ++++ G L+ A+CTETRP+NQGSRLTAFELV +NIPATL+ DS AAAL++      R+ A
Sbjct  192  SLHSNGSLKHAFCTETRPYNQGSRLTAFELVHDNIPATLVTDSMAAALLRLKGPSERIAA  251

Query  266  VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  87
            ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG+ IVIEER  
Sbjct  252  IVVGADRVAANGDTANKIGTYSLAIAAKHHGVKFLVAAPRTTIDLDTQSGEGIVIEERPG  311

Query  86   KELL------HTHGGLGEQ------IAASGISVWNPAFDV  3
            KE+       H    L  Q      IAA+GI VWNPAFDV
Sbjct  312  KEVTMIKGPRHDGASLDLQNVETVSIAANGIGVWNPAFDV  351



>ref|XP_006100374.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Myotis lucifugus]
Length=370

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  130  AEDMLEKDLKDNRSIGDLGAHHLLERAAPKGSKVTVLTHCNTGALATAGYGTALGVIRSL  189

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  190  HNLGRLKHVFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRDVSAVVVGAD  249

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQQIVIEER  +EL   
Sbjct  250  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLETGQQIVIEERPGQELTDV  309

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  310  N---GVRIAAPGIGVWNPAFDV  328



>ref|XP_003501976.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Cricetulus griseus]
 gb|EGW00630.1| Methylthioribose-1-phosphate isomerase [Cricetulus griseus]
 gb|ERE78254.1| methylthioribose-1-phosphate isomerase [Cricetulus griseus]
Length=369

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N+ IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRNIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HEMGQLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLQLETGREIVIEERPSQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAQGIQVWNPAFDV  327



>ref|XP_003468199.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cavia porcellus]
Length=362

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL        K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLKKDLRDNRSIGDLGAHHLLDRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LERA+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HQLGRLERAFCTETRPYNQGARLTAFELVYEGIPATLITDSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ I+IEER   EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLCLETGQDIIIEERPGHELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_002921063.2| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Ailuropoda melanoleuca]
Length=400

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGA-SLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  171  AEDMLEKDLKDNRSIGDLGALHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  230

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  231  HALGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGAD  290

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  291  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIIIEERPGQELTDV  350

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  351  N---GVRIAAPGIGVWNPAFDV  369



>ref|XP_008315471.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Cynoglossus semilaevis]
Length=332

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVG--SKKISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G   + ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  104  EDMLERDVNDNKKIGNNGA---QHILSGIPRESVTILTHCNTGSLATAGYGTALGVVRSL  160

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E+V E IPATLI DS AA  M+   ++AV+VGAD
Sbjct  161  HALGRLKRVYCTETRPYNQGSRLTAYEVVAEGIPATLITDSMAALTMREMNISAVVVGAD  220

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R  +EL   
Sbjct  221  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPQEELTSI  280

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  281  N---GVPIAAKGIDVWNPAFDV  299



>ref|XP_003275653.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform 1 [Nomascus 
leucogenys]
Length=369

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G L+ A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V+AV+VGAD
Sbjct  189  HSLGRLKHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_008315470.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Cynoglossus semilaevis]
Length=353

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVG--SKKISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G   + ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNKKIGNNGA---QHILSGIPRESVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E+V E IPATLI DS AA  M+   ++AV+VGAD
Sbjct  182  HALGRLKRVYCTETRPYNQGSRLTAYEVVAEGIPATLITDSMAALTMREMNISAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R  +EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPQEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAKGIDVWNPAFDV  320



>ref|NP_001037650.1| methylthioribose-1-phosphate isomerase [Bombyx mori]
 sp|Q0ZB81.1|MTNA_BOMMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Bombyx 
mori]
 gb|ABG54283.1| eIF2B-alpha-like protein [Bombyx mori]
Length=364

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 153/201 (76%), Gaps = 5/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML  D+  NKAIGS G   +   + G   + +LTHCNTGSLATAGYGTALGVIR+++ 
Sbjct  129  EDMLTKDIHDNKAIGSLGCEAILKNIDGDSPVRVLTHCNTGSLATAGYGTALGVIRSLHA  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE  +CTETRP+NQG+RLTA+ELV E IP+TL+ DS  +ALM   +++AVIVGADR+
Sbjct  189  TKRLEHVFCTETRPYNQGARLTAYELVHEKIPSTLMVDSMVSALMHTRKIHAVIVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANK+GTY +A+ A +H VPFYVAAPLTS+D+SL  G++I IEER  +E+ H   
Sbjct  249  AANGDTANKMGTYQIAIVAKYHDVPFYVAAPLTSIDMSLPYGEKIKIEERPDREMTH---  305

Query  62   GLGE-QIAASGISVWNPAFDV  3
             +GE +IAA GI+ WNP+FDV
Sbjct  306  -IGEHRIAAPGINCWNPSFDV  325



>ref|XP_008853656.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Nannospalax galili]
Length=362

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGACHLLERAAPRGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLIADS  AA +    V+AV+VGAD
Sbjct  189  HKMGHLEHVFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAVAHWGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIIANHHGIPFYVAAPSSSCDLHLETGQEIVIEERPGQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFD+
Sbjct  309  N---GVRIAAPGIGVWNPAFDI  327



>ref|XP_005805132.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Xiphophorus 
maculatus]
Length=353

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  N+ IG++GA   Q+ L G  +  +++LTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTVLTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   + AV+VGAD
Sbjct  182  HGLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMDITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIEVWNPAFDV  320



>ref|XP_009433120.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Pan troglodytes]
Length=369

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E ML+ D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  130  EDMLQKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGADR
Sbjct  190  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL + +
Sbjct  250  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTNVN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  310  ---GVRIAAPGIGVWNPAFDV  327



>ref|XP_969152.1| PREDICTED: methylthioribose-1-phosphate isomerase [Tribolium 
castaneum]
 gb|EFA12349.1| hypothetical protein TcasGA2_TC002054 [Tribolium castaneum]
Length=354

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 151/201 (75%), Gaps = 5/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E MLE D+  NK+IG  GA  + + + G   + ILTHCNTGSLATAGYGTALGVIR ++ 
Sbjct  129  EAMLEKDIHDNKSIGDFGAREILSGVSGDSLVRILTHCNTGSLATAGYGTALGVIRKLHE  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE  YCTETRP+NQG+RLTA+ELV + IPATLI DS  AALMK   V+AV+VGADR+
Sbjct  189  LKRLEHCYCTETRPYNQGARLTAYELVHDKIPATLIVDSMVAALMKHRNVSAVVVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            A+NGDTANKIGTY +AV A  HGVPFYVAAP TS+D+ + SG  IVIEER   E+ H   
Sbjct  249  ASNGDTANKIGTYQIAVLAKFHGVPFYVAAPFTSIDMKIVSGDHIVIEERPDHEMTH---  305

Query  62   GLGE-QIAASGISVWNPAFDV  3
             +GE +IAA GI+ WNPAFDV
Sbjct  306  -VGEHRIAAKGITCWNPAFDV  325



>ref|NP_001039852.1| methylthioribose-1-phosphate isomerase [Bos taurus]
 ref|XP_010853746.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bison bison 
bison]
 sp|Q2NL31.1|MTNA_BOVIN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Bos 
taurus]
 gb|AAI11155.1| Methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) 
[Bos taurus]
 tpg|DAA28089.1| TPA: methylthioribose-1-phosphate isomerase [Bos taurus]
Length=358

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLDKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIVIEERPDQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>dbj|GAA90121.1| translation initiation factor [Aspergillus kawachii IFO 4308]
Length=340

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 154/215 (72%), Gaps = 13/215 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML  D+  NK IG HGA  +    VG  K ++LTHCNTGSLAT+GYGTALGVIRA+
Sbjct  90   AAEEMLVKDIEDNKNIGKHGAQWIMANAVGKPKATVLTHCNTGSLATSGYGTALGVIRAL  149

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG--RVNAVIVG  255
             +   L RAYCTETRP+NQGSRLTAFELV + +PATLI DS AAAL+     +V+A++VG
Sbjct  150  ASTDNLNRAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMAAALLAKSGTQVDAIVVG  209

Query  254  ADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELL  75
            ADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +I+IEER+  E+ 
Sbjct  210  ADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATPSGHEIIIEERAASEVT  269

Query  74   HTHGGLGEQ-----------IAASGISVWNPAFDV  3
               G    +           IAA GI VWNPAFDV
Sbjct  270  TVRGPRANKSTNGIELETVRIAADGIDVWNPAFDV  304



>ref|XP_007570269.1| PREDICTED: methylthioribose-1-phosphate isomerase [Poecilia formosa]
Length=353

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  N+ IG++GA   Q+ L G  +  +++LTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTVLTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   + AV+VGAD
Sbjct  182  HGLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMDITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE R P+EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEVRPPEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIEVWNPAFDV  320



>ref|XP_005370998.1| PREDICTED: methylthioribose-1-phosphate isomerase [Microtus ochrogaster]
Length=369

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N+ IG  GA  LL++      K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRNIGDLGARHLLEHTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HEMGRLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLHLETGKEIVIEERPSQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GIRIAAQGIRVWNPAFDV  327



>ref|XP_010327857.1| PREDICTED: methylthioribose-1-phosphate isomerase, partial [Saimiri 
boliviensis boliviensis]
Length=340

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL        K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  94   AEDMLDKDLRDNQSIGDLGARHLLDRAAPNGGKVAVLTHCNTGALATAGYGTALGVIRSL  153

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AVIVGAD
Sbjct  154  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGVSAVIVGAD  213

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  214  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGREIIIEERPSQELTDV  273

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  274  N---GVRIAAPGIGVWNPAFDV  292



>pdb|4LDR|A Chain A, Structure Of The S283y Mutant Of Mrdi
 pdb|4LDR|B Chain B, Structure Of The S283y Mutant Of Mrdi
Length=369

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 153/201 (76%), Gaps = 4/201 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR+++
Sbjct  130  EDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH  189

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
            + G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V+AV+VGADR
Sbjct  190  SLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADR  249

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANK+GTY LA+ A HHG+PFYVAAP  S DL L +G++I+IEER  +EL   +
Sbjct  250  VVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSYSCDLRLETGKEIIIEERPGQELTDVN  309

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  310  ---GVRIAAPGIGVWNPAFDV  327



>gb|ERL94382.1| hypothetical protein D910_11661, partial [Dendroctonus ponderosae]
Length=424

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            +LE D+  N++IG +GA  + +++ G  ++ ++THCNTGSLATAGYGTALGVIR+++   
Sbjct  133  LLEKDITDNQSIGDNGAKEILSRVSGDSQVRVVTHCNTGSLATAGYGTALGVIRSLHAMK  192

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LE  YCTETRP+NQG+RLTAFEL+ + IP+TLI DS  +ALMK+  ++AV+VGADR+AA
Sbjct  193  RLEHVYCTETRPYNQGARLTAFELIHDKIPSTLICDSMVSALMKSRNISAVVVGADRVAA  252

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A +H VPFYVAAP TS+D  +S+G+ IVIEER  +E+ H    +
Sbjct  253  NGDTANKIGTYQIAVVAKYHAVPFYVAAPFTSIDAKVSTGEHIVIEERPDREMTH----V  308

Query  56   GE-QIAASGISVWNPAFDV  3
            GE +IAA GI  WNPAFDV
Sbjct  309  GEHRIAAKGIPCWNPAFDV  327



>ref|XP_007952565.1| PREDICTED: methylthioribose-1-phosphate isomerase [Orycteropus 
afer afer]
Length=358

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGARHLLERAAPEGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE AYCTETRP+NQG+RLTAFELV E IPATLI+DS AAA M    V+AV+VGAD
Sbjct  189  HHLGRLEHAYCTETRPYNQGARLTAFELVYEQIPATLISDSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A++H +PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAITALYHSIPFYVAAPSSSCDLHLETGQEIVIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_008724306.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
carrionii CBS 160.54]
 gb|ETI26993.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
carrionii CBS 160.54]
Length=395

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 158/227 (70%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NKAIG HGA  ++   V  KK        + +LTHCNTGSLATAGYG
Sbjct  137  LAAEQMLVDDVSDNKAIGEHGARWIEANTVAGKKRKADTSQQLQVLTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--  282
            TALGVIR++ +A  L RAYC+ETRP+NQGSRLTA+ELV + IPATLI DS A ALM    
Sbjct  197  TALGVIRSLRSADMLTRAYCSETRPYNQGSRLTAYELVHDEIPATLITDSMACALMDKEG  256

Query  281  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             R+ AV+VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP T++D   +SG+ IVI
Sbjct  257  DRLAAVVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPRTTIDRDTASGEDIVI  316

Query  101  EERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFDV  3
            EER+P+E              LL   G      AA GI VWNPAFDV
Sbjct  317  EERAPEEVTRIKGPKVTVEGKLLLDEGSEVVSTAAIGIEVWNPAFDV  363



>ref|XP_003726311.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase-like [Strongylocentrotus purpuratus]
Length=376

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 150/201 (75%), Gaps = 5/201 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE M+E DV +NK+IG HGA+       G +   ++THCNTGSLATAGYGTALGVIRA++
Sbjct  149  AENMMEMDVRTNKSIGMHGANHXMISSGGGQ--VVMTHCNTGSLATAGYGTALGVIRALH  206

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G LE  YCTETRP+NQG+RLTA+ELV E IPA+LI DS A+  M    V AV+VGADR
Sbjct  207  EKGNLEHVYCTETRPYNQGARLTAYELVYECIPASLITDSMASFCMLKKGVTAVVVGADR  266

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANKIGTY LA+ A HH +PFYVAAP+TS DLSL+SG +IVIEER   EL   +
Sbjct  267  VVANGDTANKIGTYQLALAARHHNIPFYVAAPVTSCDLSLTSGDEIVIEERDQSELTKIN  326

Query  65   GGLGEQIAASGISVWNPAFDV  3
            G    QIAA GI  WNPAFDV
Sbjct  327  GM---QIAAPGIRGWNPAFDV  344



>gb|EHH59270.1| Methylthioribose-1-phosphate isomerase [Macaca fascicularis]
Length=369

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE  +  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKGLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V+AV+VGAD
Sbjct  189  HSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEERPAQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_008564259.1| PREDICTED: methylthioribose-1-phosphate isomerase [Galeopterus 
variegatus]
Length=356

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+ +LTHCNTG+LATAGYGTALGVIR++
Sbjct  117  AEDMLEKDLRDNRSIGDLGARHLLERVAPRGGKVIVLTHCNTGALATAGYGTALGVIRSL  176

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    ++AVIVGAD
Sbjct  177  HNLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHRGISAVIVGAD  236

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S D  L +GQ+IVIEER  +EL   
Sbjct  237  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDFRLETGQEIVIEERPGQELTDV  296

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  297  N---GVRIAAPGIGVWNPAFDV  315



>ref|NP_001104708.1| methylthioribose-1-phosphate isomerase [Danio rerio]
 sp|A9JRE2.1|MTNA_DANRE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Danio 
rerio]
 gb|AAI55627.1| Zgc:172216 protein [Danio rerio]
 gb|AAI71374.1| Zgc:172216 [Danio rerio]
 gb|AAI71376.1| Zgc:172216 [Danio rerio]
Length=353

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 152/202 (75%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EEMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+R YCTETRP+NQG+RLTA+E V E  PATLI DS AA  M+   + AV+VGAD
Sbjct  182  HMLGRLKRLYCTETRPYNQGARLTAYEAVAEGFPATLITDSMAALAMREKSITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ IVIEER  +EL   
Sbjct  242  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIVIEERPAEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  +AA GI VWNPAFDV
Sbjct  302  N---GVPVAAPGIDVWNPAFDV  320



>ref|XP_010591802.1| PREDICTED: methylthioribose-1-phosphate isomerase [Loxodonta 
africana]
Length=345

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  116  AEDMLEKDLKDNRSIGDLGAHHLLKRAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  175

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPA+LI DS AAA M    V+AV+VGAD
Sbjct  176  HRLGRLEHTFCTETRPYNQGARLTAFELVYEQIPASLITDSMAAAAMAHRGVSAVVVGAD  235

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +H +PFYVAAP +S DL L +GQ+IVIEER  +EL   
Sbjct  236  RVVANGDTANKVGTYQLAIAAKYHDIPFYVAAPSSSCDLRLQTGQEIVIEERPGQELTDV  295

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  296  N---GVRIAAPGIGVWNPAFDV  314



>ref|XP_007753953.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
yegresii CBS 114405]
 gb|EXJ65386.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
yegresii CBS 114405]
Length=395

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 158/227 (70%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NKAIG HGA  ++   V  +K        + +LTHCNTGSLATAGYG
Sbjct  137  LAAEQMLVDDVSDNKAIGEHGARWIEENTVAGRKRKADTSQQLEVLTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--  282
            TALGVIR++ +A  L RAYC+ETRP+NQGSRLTA+ELV + IPATLI DS A ALM    
Sbjct  197  TALGVIRSLRSADMLTRAYCSETRPYNQGSRLTAYELVHDEIPATLITDSMACALMNKEG  256

Query  281  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             R+ AV+VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP T++D   +SG+ IVI
Sbjct  257  DRLAAVVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPRTTIDRDTASGEDIVI  316

Query  101  EERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFDV  3
            EER+P+E              LL   G      AA GI VWNPAFDV
Sbjct  317  EERAPEEVTRIKGPKVTAEGKLLLDEGSEVVSTAAIGIEVWNPAFDV  363



>ref|XP_008546891.1| PREDICTED: methylthioribose-1-phosphate isomerase [Microplitis 
demolitor]
Length=355

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            + M + D+  N+AIG  GA  +   ++ +K + +LTHCNTGSLAT GYGTALG++R++++
Sbjct  129  DYMFKKDIDDNRAIGDFGADEILKSVLDNKLVRVLTHCNTGSLATTGYGTALGIVRSLHS  188

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               LE+ YCTETRP+NQG+RLTA+ELV E IP TLI D   AALMK+ ++NAV+VGADR+
Sbjct  189  RKKLEQVYCTETRPYNQGARLTAYELVHEKIPGTLICDGMVAALMKSRKINAVVVGADRV  248

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY +A+ A HH VPFYVAAP TS+D  + +G +I IEER  +E+ H + 
Sbjct  249  AANGDTANKIGTYQIAILAKHHEVPFYVAAPRTSIDFEIVAGDKIPIEERPEREMTHMN-  307

Query  62   GLGEQIAASGISVWNPAFDV  3
               ++IAA GI  WNPAFDV
Sbjct  308  --DQRIAAKGIQCWNPAFDV  325



>dbj|BAC33016.1| unnamed protein product [Mus musculus]
Length=369

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTH NTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHLNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE  +CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HDMGRLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHGVPFYVAAP +S DL L SG++IVIEER  +EL   
Sbjct  249  RVVANGDTANKIGTYQLAIVAKHHGVPFYVAAPSSSCDLHLESGKEIVIEERPSQELTDL  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAQGIRVWNPAFDV  327



>ref|XP_004616861.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sorex araneus]
Length=358

 Score =   231 bits (589),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N+ IG  GA  LL+      +K+ +LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNQNIGDLGARHLLERAAPDGRKVVVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E+IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HRLGRLEHAFCTETRPYNQGARLTAFELVYEHIPATLIADSMAAAAMAQRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HH +PFYVAAP +S DL L +GQ IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHSIPFYVAAPSSSCDLHLHTGQDIVIEERPGQELTEV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G +IAA GI VWNPAFDV
Sbjct  309  Q---GIRIAAPGIGVWNPAFDV  327



>ref|XP_004635691.1| PREDICTED: methylthioribose-1-phosphate isomerase, partial [Octodon 
degus]
Length=347

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGA-SLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL        K+S+LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLRDNRSIGDLGAYHLLDRAAPQGGKVSVLTHCNTGTLATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HQLGRLEHAFCTETRPYNQGARLTAFELVYEGIPATLIADSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HH +PFYVAAP +S DL L +GQ IVIEER   EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHSIPFYVAAPSSSCDLRLETGQDIVIEERPAHELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIEVWNPAFDV  327



>gb|EHA19257.1| hypothetical protein ASPNIDRAFT_54270 [Aspergillus niger ATCC 
1015]
Length=382

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 150/215 (70%), Gaps = 13/215 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AAE ML+ D+  NK IG HGA  +     G  K ++LTHCNTGSLAT+GYGTALGVIRA+
Sbjct  132  AAEEMLKKDIEDNKNIGKHGAQWIMANAAGKPKATVLTHCNTGSLATSGYGTALGVIRAL  191

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalmkAGRVNAVIVG  255
             +A  L  AYCTETRP+NQGSRLTAFELV + +PAT    + +AA       +V+A++VG
Sbjct  192  ASADNLNHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMAAALLAKSGSKVDAIVVG  251

Query  254  ADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELL  75
            ADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +I+IEER+  E+ 
Sbjct  252  ADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATPSGNEIIIEERAASEVT  311

Query  74   HTHGGLGE-----------QIAASGISVWNPAFDV  3
            +  G               +IAA GI VWNPAFDV
Sbjct  312  NVRGPRASNSTNGIELETVRIAADGIDVWNPAFDV  346



>gb|KIV77933.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala sideris]
Length=395

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 158/227 (70%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NKAIG HGA  ++   V  KK        + +LTHCNTGSLATAGYG
Sbjct  137  VAAERMLVDDVSDNKAIGEHGARWIEANTVAGKKRKQDRSQQLKVLTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  276
            TALGVIR++     L RAYCTETRP+NQGSRLTA+ELV + IPATLI DS A AL+    
Sbjct  197  TALGVIRSLRAGDMLTRAYCTETRPYNQGSRLTAYELVHDEIPATLITDSMACALLAKEG  256

Query  275  VN--AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             N  A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T++DL+ SSGQ I I
Sbjct  257  TNLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRTTIDLATSSGQDIEI  316

Query  101  EERSPKELLHTHG-----------GLGEQI---AASGISVWNPAFDV  3
            E+R+P+E+    G             G ++   AA GI VWNPAFDV
Sbjct  317  EQRAPEEVTRIKGPKVATDGKVLVDEGAELISTAAIGIDVWNPAFDV  363



>ref|XP_001943893.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acyrthosiphon 
pisum]
Length=363

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E MLE D++ N++IG  GA  + N +   +++ ILTHCNTGSLATA +GTALGV+R +
Sbjct  127  AIEAMLEKDISDNRSIGEFGAKAILNNVTDGEQVRILTHCNTGSLATAYFGTALGVVRCL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++A  LE  Y TETRP+NQG+RLTA+ELV + IP+TL+ DS  A LMK  ++NAV+VGAD
Sbjct  187  HSASRLENCYFTETRPYNQGARLTAYELVHDKIPSTLVCDSTVAYLMKTAQINAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+AANGDTANKIGTY +AV A HH VPFYVAAPLTS+D ++++G  IVIEER   E+ H 
Sbjct  247  RVAANGDTANKIGTYQIAVVAKHHEVPFYVAAPLTSIDFNVNTGDNIVIEERPQVEMTHI  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +     +IA+ G++ WNPAFDV
Sbjct  307  NNI---RIASPGVTCWNPAFDV  325



>ref|XP_002037477.1| GM12085 [Drosophila sechellia]
 sp|B4I029.1|MTNA_DROSE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
sechellia]
 gb|EDW53636.1| GM12085 [Drosophila sechellia]
Length=364

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 157/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYGT  453
            A E ML+ D+A N+AIG++GA  +  ++  + K        + +LTHCNTGSLATAGYGT
Sbjct  127  ATEAMLKKDIADNRAIGANGAQAILQRVAKAGKTTAGTTGSVRVLTHCNTGSLATAGYGT  186

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  273
            ALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V
Sbjct  187  ALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNV  246

Query  272  NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  93
             AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++  G  I+IEER
Sbjct  247  AAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIPGGDHIIIEER  306

Query  92   SPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
              +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  PDREMTH----VGEHRIAAPGINCWNPAFDV  333



>ref|XP_010870944.1| PREDICTED: methylthioribose-1-phosphate isomerase [Esox lucius]
Length=353

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 151/202 (75%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EEMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L R YCTETRP+NQG+RLTA+E V E  PATLI DS AA  M+   + AV+VGAD
Sbjct  182  HALGRLRRVYCTETRPYNQGARLTAYEAVAEGFPATLITDSMAALTMRERGITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANKIGTY LA+ A HHG+PFYVAAP TS DLSL SG+ IVIEER  +EL   
Sbjct  242  RVVANGDTANKIGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIVIEERPAEELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  IAA GI VWNPAFDV
Sbjct  302  N---GVPIAAPGIDVWNPAFDV  320



>ref|XP_002105622.1| GD16414 [Drosophila simulans]
 sp|B4QSM8.1|MTNA_DROSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
simulans]
 gb|EDX15125.1| GD16414 [Drosophila simulans]
Length=364

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 157/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYGT  453
            A E ML+ D+A N+AIG++GA  +  ++  + K        + +LTHCNTGSLATAGYGT
Sbjct  127  ATEAMLKKDIADNRAIGANGAQAILQRVAKAGKTPAGSTGSVRVLTHCNTGSLATAGYGT  186

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  273
            ALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V
Sbjct  187  ALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNV  246

Query  272  NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  93
             AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++  G  I+IEER
Sbjct  247  AAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIPGGDHIIIEER  306

Query  92   SPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
              +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  PDREMTH----VGEHRIAAPGINCWNPAFDV  333



>gb|KDR24083.1| Methylthioribose-1-phosphate isomerase [Zootermopsis nevadensis]
Length=359

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 150/202 (74%), Gaps = 3/202 (1%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            A E ML+ D+  N+AIG  GA  + +       + ILTHCNTGSLATAGYGTALGVIR++
Sbjct  127  AIETMLDKDIIDNRAIGDAGAKAILSHCPKDSMVRILTHCNTGSLATAGYGTALGVIRSL  186

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++   LE  YCTETRP+NQG+RLTA+ELV + IPATL+ DS  +ALM+A  + AV+VGAD
Sbjct  187  HSLKRLEHVYCTETRPYNQGARLTAYELVHDKIPATLVCDSMVSALMRARNITAVVVGAD  246

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+A NGDTANKIGTY +AV A HHGV FYVAAP TS+D S+ SG+ I+IEER   E+ H 
Sbjct  247  RVATNGDTANKIGTYQIAVVAKHHGVLFYVAAPFTSIDFSIPSGEHILIEERPEHEMSHV  306

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                  +IAA+GIS WNPAFDV
Sbjct  307  ---ADHRIAATGISCWNPAFDV  325



>ref|XP_011342004.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cerapachys 
biroi]
 gb|EZA61921.1| Methylthioribose-1-phosphate isomerase [Cerapachys biroi]
Length=369

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAG  417
            ML  DVA N AIG  GA  +   +     I ILTHCNTGSLATAGYGTALGVIR+++  G
Sbjct  134  MLRKDVADNIAIGDLGAHDILYNVPKDSVIRILTHCNTGSLATAGYGTALGVIRSLHKMG  193

Query  416  FLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAA  237
             LER YCTETRP+NQG+RLTA+ELV + IPATLI D   AA ++  ++ AV+VGADR+AA
Sbjct  194  KLERVYCTETRPYNQGARLTAYELVHDKIPATLICDDMVAAALRKKQITAVVVGADRVAA  253

Query  236  NGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGL  57
            NGDTANKIGTY +AV A +H +PFYVAAP TS+DL++ SG  +VIEER  +E+ H +   
Sbjct  254  NGDTANKIGTYQIAVLAKYHKIPFYVAAPRTSIDLTMPSGDDMVIEERPVREMTHIN---  310

Query  56   GEQIAASGISVWNPAFDV  3
            G ++AA  I  WNPAFDV
Sbjct  311  GRRVAAKDIDCWNPAFDV  328



>ref|XP_006079940.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bubalus bubalis]
Length=407

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  178  AEDMLEKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  237

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  238  HNLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  297

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  298  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIVIEERPGQELTDI  357

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  358  N---GVRIAAPGIGVWNPAFDV  376



>ref|XP_005888077.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bos mutus]
Length=358

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLDKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLKHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIVIEERPDQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>gb|KFB37657.1| AGAP001589-PA-like protein [Anopheles sinensis]
Length=351

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 154/201 (77%), Gaps = 7/201 (3%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML+ D+  N+AIG +GA+ L   +   + + ++THCNTGSLATAGYGTALGVIR+VN 
Sbjct  129  EKMLQKDINDNRAIGENGANALLKGI--DRPLKLMTHCNTGSLATAGYGTALGVIRSVNE  186

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
               L+  +CTETRP+NQG+RLTA+ELV + +PATLI DS  AAL+ + +++A+IVGADR+
Sbjct  187  RNLLDHVFCTETRPYNQGARLTAYELVHDKLPATLITDSMVAALLNSRKIDAIIVGADRV  246

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY +AV A HH VPFYVAAP TS+D++++ G  I IEER  +EL H   
Sbjct  247  AANGDTANKIGTYQMAVVAKHHQVPFYVAAPFTSIDVAIADGSHIKIEERPERELTH---  303

Query  62   GLGE-QIAASGISVWNPAFDV  3
             +GE +IAA GI  WNPAFDV
Sbjct  304  -IGELRIAAPGIGCWNPAFDV  323



>gb|KIX97693.1| hypothetical protein Z520_06471 [Fonsecaea multimorphosa CBS 
102226]
Length=395

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 158/227 (70%), Gaps = 24/227 (11%)
 Frame = -3

Query  611  MAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYG  456
            +AAE ML DDV+ NK+IG HGA  ++   V  +K        I+ILTHCNTGSLATAGYG
Sbjct  137  VAAERMLVDDVSDNKSIGEHGARWIEENTVAGRKRKADKGQDIAILTHCNTGSLATAGYG  196

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--  282
            TALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPATLI DS A ALM    
Sbjct  197  TALGVIRSLRAADMLTRAYCSETRPYNQGSRLTAYELVHDEIPATLITDSMACALMAREG  256

Query  281  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  102
             R+ A++VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP T++D   +SG+ IVI
Sbjct  257  DRLAAIVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPRTTIDRDTASGKDIVI  316

Query  101  EERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFDV  3
            EER+P+E              LL   G      AA GI VWNPAFDV
Sbjct  317  EERAPEEVTRIKGPRVKADGKLLLDEGSEMVSTAAVGIDVWNPAFDV  363



>gb|ELR62033.1| Methylthioribose-1-phosphate isomerase, partial [Bos mutus]
Length=365

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  136  AEDMLDKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  195

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+ A+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V+AV+VGAD
Sbjct  196  HNLGRLKHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGAD  255

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++IVIEER  +EL   
Sbjct  256  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGREIVIEERPDQELTDV  315

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  316  N---GVRIAAPGIGVWNPAFDV  334



>ref|XP_004595907.1| PREDICTED: methylthioribose-1-phosphate isomerase [Ochotona princeps]
Length=359

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N+ IG  GA  +L     G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEAMLDQDLRDNRRIGDLGAQDVLAKAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    V+AV+VGAD
Sbjct  189  HNLGRLEHAFCTETRPYNQGARLTAFELVYERIPATLITDSMAAAAMAHRGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G  I IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLQTGADITIEERPGQELTDV  308

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  309  N---GVRIAAPGIGVWNPAFDV  327



>ref|XP_005962906.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pantholops 
hodgsonii]
Length=369

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 5/203 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  139  AEDMLEKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSL  198

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFEL-VTENIPatliadsaaaalmkAGRVNAVIVGA  252
            +  G LE A+CTETRP+NQG+RLTAFEL V E IPATLI DS  AA M    V+AVIVGA
Sbjct  199  HKLGRLEHAFCTETRPYNQGARLTAFELLVYEQIPATLITDSMTAAAMAHRGVSAVIVGA  258

Query  251  DRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLH  72
            DR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVIEER  +EL  
Sbjct  259  DRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGQEIVIEERPGQELTD  318

Query  71   THGGLGEQIAASGISVWNPAFDV  3
             +   G +IAA GI VWNPAFDV
Sbjct  319  IN---GVRIAAPGIGVWNPAFDV  338



>ref|XP_010759673.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb18]
 sp|C1G9Q3.1|MTNA_PARBD RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH47905.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb18]
Length=382

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 154/220 (70%), Gaps = 18/220 (8%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLV----GSKKISILTHCNTGSLATAGYGTALGV  441
            AAE MLEDDV  N+ IG  GA  +  Q +    G  K+++LTHCNTGSLATAGYGTALGV
Sbjct  132  AAEKMLEDDVKDNRGIGEFGAKWIMKQAIDGAEGKGKVAVLTHCNTGSLATAGYGTALGV  191

Query  440  IRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalmkAGRVNA  267
            IR+++ A  L+ AYCTETRP+NQGSRLTA+ELV +NIPAT    + +AA    K+  V A
Sbjct  192  IRSLHAANSLKHAYCTETRPYNQGSRLTAYELVHDNIPATLITDSMAAALLAHKSAGVGA  251

Query  266  VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  87
            ++VGADR+AANGDTANKIGTY LAV A HHGV F VAAP T++D++  SG+ I IEER  
Sbjct  252  IVVGADRVAANGDTANKIGTYGLAVLAKHHGVKFLVAAPRTTIDMNTKSGEGIAIEERPR  311

Query  86   KELLHTHG--------GLGEQ----IAASGISVWNPAFDV  3
            +E+    G        GLG      +AA GI VWNPAFDV
Sbjct  312  QEMTRIRGPRVGGEQDGLGAMETITVAADGIDVWNPAFDV  351



>ref|XP_011496297.1| PREDICTED: methylthioribose-1-phosphate isomerase [Ceratosolen 
solmsi marchali]
Length=349

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = -3

Query  596  MLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTA  420
            ML++D+A NKAIG HGA  +++NQ   +K ++ILTHCNTGSLATAGYGTALG+IR++   
Sbjct  130  MLKEDIADNKAIGEHGAKEIIKNQ--NNKSVTILTHCNTGSLATAGYGTALGIIRSLYNN  187

Query  419  GFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIA  240
            G LE  YCTETRP+NQG+RLTA+ELV + IP+TLI D    +LMK   ++AV++GADRI 
Sbjct  188  GNLEHVYCTETRPYNQGARLTAYELVHDRIPSTLICDDMVGSLMKTKNISAVVIGADRIV  247

Query  239  ANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGG  60
            ANGDTANKIGTY +A+ A +H VPFY+AAP T++D SL  G +I IEER   EL   +G 
Sbjct  248  ANGDTANKIGTYQIAILAKYHSVPFYIAAPFTTIDFSLCHGDEIKIEERPQNELTEINGV  307

Query  59   LGEQIAASGISVWNPAFDV  3
               +IAA  I  WNP+FDV
Sbjct  308  ---RIAAENIQCWNPSFDV  323



>ref|NP_001090076.1| methylthioribose-1-phosphate isomerase [Xenopus laevis]
 sp|Q4FZP2.1|MTNA_XENLA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Xenopus 
laevis]
 gb|AAH99301.1| MGC116493 protein [Xenopus laevis]
Length=354

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 150/201 (75%), Gaps = 3/201 (1%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE +L+ DV  N+ IG  GA  +  +   ++K+ +LTHCNTGSLATAGYGTALGV+R+++
Sbjct  128  AESLLKKDVEDNQMIGDFGAKHILEKAGPTEKVCMLTHCNTGSLATAGYGTALGVVRSLH  187

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G L   +CTETRP+NQGSRLTA+ELV E IPATLI DS A+  M+  +V AV+VGADR
Sbjct  188  ALGRLSHVFCTETRPYNQGSRLTAYELVYEKIPATLITDSMASVTMRERKVTAVVVGADR  247

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            + ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DLSL +G  IVIEER   EL   +
Sbjct  248  VVANGDTANKIGTYQLAIIAKYHGIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN  307

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G +IAA GI VWNPAFDV
Sbjct  308  ---GIRIAAPGIDVWNPAFDV  325



>ref|XP_007720298.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia coronata 
CBS 617.96]
 gb|EXJ96069.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia coronata 
CBS 617.96]
Length=396

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 158/226 (70%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLL--------QNQLVGSKKISILTHCNTGSLATAGYGT  453
            AAE ML DDV+ NKAIG HGA  +        Q +   S  + +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLVDDVSDNKAIGEHGARWIEENTAAGRQRKADKSHALQVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++  A  L RAYCTETRP+NQGSRLTA+ELV + IPATLI DS A AL+     
Sbjct  198  ALGVIRSLRAADMLTRAYCTETRPYNQGSRLTAYELVHDAIPATLITDSMACALLAREGD  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
             + AV+VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T++DL+ +SG  IVIE
Sbjct  258  GLAAVVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRTTIDLTTASGNDIVIE  317

Query  98   ERSPKELLHTHG----GLGE----------QIAASGISVWNPAFDV  3
            ER+P+E+    G      G+           IAA+GI VWNPAFDV
Sbjct  318  ERAPEEVTRIKGPKVTAEGKIQVDEAAEIISIAATGIDVWNPAFDV  363



>gb|EFX71518.1| hypothetical protein DAPPUDRAFT_308831 [Daphnia pulex]
Length=352

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNT  423
            E ML +D+A N AIG HGA  +  +     K+ +LTHCNTGSLATAGYGTALGVIR+++ 
Sbjct  131  EAMLANDIADNLAIGEHGARDIAKKCGNKDKLRVLTHCNTGSLATAGYGTALGVIRSLHK  190

Query  422  AGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRI  243
            A  +++ YCTETRP+NQGSRLTAFELV E IPATLI D  AAA MK  +++AVIVGADR+
Sbjct  191  ANLVDQVYCTETRPYNQGSRLTAFELVYEKIPATLICDDMAAAAMKEFKIDAVIVGADRV  250

Query  242  AANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHG  63
            AANGDTANKIGTY LAV A  H + FYVAAP +S+D  + +GQ I IEER   E+ HT G
Sbjct  251  AANGDTANKIGTYQLAVLAKSHNILFYVAAPFSSIDFQIPTGQSIPIEERPHSEMTHT-G  309

Query  62   GLGEQIAASGISVWNPAFDV  3
             +  + AA+GI  WNP FDV
Sbjct  310  SI--RTAAAGIHCWNPGFDV  327



>sp|C0P108.1|MTNA_AJECG RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Histoplasma 
capsulatum G186AR]
 gb|EEH02644.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=392

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 160/231 (69%), Gaps = 29/231 (13%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSK---------KISILTHCNTGSLATAGYG  456
            AAE MLEDDV  N+AIG  GA  +    + +K         K+++LTHCNTGSLATAGYG
Sbjct  132  AAERMLEDDVRDNRAIGESGAKWVLEHAITTKGSMSGTGQAKVAVLTHCNTGSLATAGYG  191

Query  455  TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  276
            TALGVIR+++  G LERAYCTETRP+NQGSRLTAFELV +NIPATLI D+ AAAL+    
Sbjct  192  TALGVIRSLHATGSLERAYCTETRPYNQGSRLTAFELVHDNIPATLITDNMAAALLARQS  251

Query  275  --------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  120
                    V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP T++D++  +
Sbjct  252  AGPAQSVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPRTTIDMNTKT  311

Query  119  GQQIVIEERSPKELLHTHG--------GLGEQ----IAASGISVWNPAFDV  3
            G  IVIEER  KE+    G        GLG      +AA GI VWNPAFDV
Sbjct  312  GADIVIEERPEKEVTKIRGPRVGEEGNGLGAMETITVAADGIGVWNPAFDV  362



>ref|XP_002724279.1| PREDICTED: methylthioribose-1-phosphate isomerase [Oryctolagus 
cuniculus]
Length=365

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE ML+ D+  N+ IG  GA  LL+       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLDRDLRDNRRIGDLGARHLLERAAPEGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            ++ G LERA+CTETRP+NQG+RLTAFELV E IPATLI DSAAAA M  G V+AV+VGAD
Sbjct  189  HSLGRLERAFCTETRPYNQGARLTAFELVHERIPATLITDSAAAAAMARGGVSAVVVGAD  248

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP  S DL L SG  I IEER  +EL   
Sbjct  249  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSCSCDLGLESGGDIEIEERPGQELTD-  307

Query  68   HGGLGEQIAASGISVWNPAFDV  3
                G ++AA G++VWNPAFDV
Sbjct  308  --WCGVRVAAPGVAVWNPAFDV  327



>gb|KEF62771.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala aquamarina 
CBS 119918]
Length=395

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 161/226 (71%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQ--------NQLVGSKKISILTHCNTGSLATAGYGT  453
            AAE ML DDV+ N+AIG HGA  ++         Q   S+++ +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLVDDVSDNEAIGEHGARWIEINTTAGQKRQKDKSQELKVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++     L RAYCTETRP+NQGSRLTA+ELV ++IPATLI DS A ALM     
Sbjct  198  ALGVIRSLRAGNSLTRAYCTETRPYNQGSRLTAYELVHDDIPATLITDSMACALMTKEGD  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
            R+ A++VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP T++DL+ SSG+ I+IE
Sbjct  258  RLAAIVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPRTTIDLATSSGENIIIE  317

Query  98   ERSPKELLHTHGG---------LGE-----QIAASGISVWNPAFDV  3
            ER+P+E+    G          L E       AA GI+VWNPAFDV
Sbjct  318  ERAPEEVTRIKGPKVTPEGKLLLDEGAELISTAADGIAVWNPAFDV  363



>ref|XP_005855554.1| methylthioribose-1-phosphate isomerase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU20803.1| methylthioribose-1-phosphate isomerase [Nannochloropsis gaditana 
CCMP526]
Length=852

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 152/201 (76%), Gaps = 3/201 (1%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVN  426
            AE ML++DV SN+AIG HGA+ +   L+  + + +LTHCNTGSLATAGYGTALGVIR+++
Sbjct  158  AEQMLKEDVESNQAIGDHGAAAILANLLPGQGVKVLTHCNTGSLATAGYGTALGVIRSLH  217

Query  425  TAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADR  246
              G L R +CTETRP+NQG+RLTAFELV + +P TLI DS  + LM    ++A++VGADR
Sbjct  218  KEGRLARVFCTETRPYNQGARLTAFELVQDQLPGTLITDSMVSFLMATQGLDAIVVGADR  277

Query  245  IAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTH  66
            IAANGDTANKIGTY LAV A HHGV FYVAAP TS DLSL+SG QI IEER  +EL    
Sbjct  278  IAANGDTANKIGTYQLAVTAKHHGVAFYVAAPFTSFDLSLASGDQIEIEERPARELTQVQ  337

Query  65   GGLGEQIAASGISVWNPAFDV  3
               G Q+A   I+VWNP FDV
Sbjct  338  ---GIQVAPQEIAVWNPGFDV  355



>ref|NP_651868.1| CG11334, isoform B [Drosophila melanogaster]
 ref|NP_733430.1| CG11334, isoform A [Drosophila melanogaster]
 ref|NP_001263144.1| CG11334, isoform C [Drosophila melanogaster]
 sp|Q9V9X4.1|MTNA_DROME RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
melanogaster]
 gb|AAF57154.1| CG11334, isoform A [Drosophila melanogaster]
 gb|AAF57155.1| CG11334, isoform B [Drosophila melanogaster]
 gb|AAL28212.1| GH08894p [Drosophila melanogaster]
 gb|ACL85874.1| CG11334-PA, partial [synthetic construct]
 gb|AGB96523.1| CG11334, isoform C [Drosophila melanogaster]
Length=364

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTGSLATAGYGT  453
            A E ML+ D+A N+AIG++GA  +   +  + K        + +LTHCNTGSLATAGYGT
Sbjct  127  ATEAMLKKDIADNRAIGANGAQAILQGVAKAGKAPAGSTGSVRVLTHCNTGSLATAGYGT  186

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  273
            ALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V
Sbjct  187  ALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNV  246

Query  272  NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  93
             AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++  G  I+IEER
Sbjct  247  AAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIPGGDHIIIEER  306

Query  92   SPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
              +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  PDREMTH----VGEHRIAAPGINCWNPAFDV  333



>ref|XP_008709946.1| PREDICTED: methylthioribose-1-phosphate isomerase [Ursus maritimus]
Length=348

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 14/202 (7%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  129  AEDMLEKDLKDNRSIGDLGARHLLERAAPGGGKVTVLTHCNTGALATAGYGTALGVIRSL  188

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G L+ A+CTETRP+NQG+RLTAFELV E IPATLI             V+AV+VGAD
Sbjct  189  HALGRLDHAFCTETRPYNQGARLTAFELVYEQIPATLIHRG----------VSAVVVGAD  238

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +G++I+IEER  +EL   
Sbjct  239  RVVANGDTANKVGTYQLAIAAKYHGIPFYVAAPSSSCDLRLETGREIIIEERPGQELTDV  298

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAA GI VWNPAFDV
Sbjct  299  N---GVRIAAPGIGVWNPAFDV  317



>ref|XP_010611767.1| PREDICTED: methylthioribose-1-phosphate isomerase [Fukomys damarensis]
Length=314

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  605  AEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAV  429
            AE MLE D+  N +IG  GA  LLQ       K+++LTHCNTG+LATAGYGTALGVIR++
Sbjct  81   AEDMLEKDLRDNHSIGDLGAHHLLQRAAPKGGKVTVLTHCNTGALATAGYGTALGVIRSL  140

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
            +  G LE A+CTETRP+NQG+RLTAFELV E I ATLIADS AAA M    V+AV+VGAD
Sbjct  141  HRLGRLEHAFCTETRPYNQGARLTAFELVYEGISATLIADSMAAAAMAHRGVSAVVVGAD  200

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G+ IVIEER   EL   
Sbjct  201  RVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLKTGRDIVIEERPGHELTDV  260

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G +IAASGI VWNPAFDV
Sbjct  261  N---GIRIAASGIGVWNPAFDV  279



>ref|XP_002099512.1| GE23315 [Drosophila yakuba]
 sp|B4PNE2.1|MTNA_DROYA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
yakuba]
 gb|EDW99224.1| GE23315 [Drosophila yakuba]
Length=364

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 156/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLLQNQLV--------GSKKISILTHCNTGSLATAGYGT  453
            A E ML+ D+A N+AIG++GA  +  ++          +  + +LTHCNTGSLATAGYGT
Sbjct  127  ATEAMLKKDIADNRAIGANGAKAILQRVAETGAAPAGSTGSVRVLTHCNTGSLATAGYGT  186

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  273
            ALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  AAL++A  V
Sbjct  187  ALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVAALLRAKNV  246

Query  272  NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  93
             AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++  G  I+IEER
Sbjct  247  AAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIPGGDHIIIEER  306

Query  92   SPKELLHTHGGLGE-QIAASGISVWNPAFDV  3
              +E+ H    +GE +IAA GI+ WNPAFDV
Sbjct  307  PDREMTH----VGEHRIAAPGINCWNPAFDV  333



>gb|KIW42782.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala oligosperma]
Length=395

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 159/226 (70%), Gaps = 24/226 (11%)
 Frame = -3

Query  608  AAEIMLEDDVASNKAIGSHGASLL-QNQLVGSKK-------ISILTHCNTGSLATAGYGT  453
            AAE ML DDV+ NKAIG HGA  + QN  VG ++       + +LTHCNTGSLATAGYGT
Sbjct  138  AAERMLIDDVSDNKAIGEHGARWIEQNTTVGRRRKQDKGQELKVLTHCNTGSLATAGYGT  197

Query  452  ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA--G  279
            ALGVIR++  A  L RAYCTETRP+NQGSRLTA+ELV ++IPATLI DS A AL+     
Sbjct  198  ALGVIRSLRAADMLSRAYCTETRPYNQGSRLTAYELVHDHIPATLITDSMACALLAKEGD  257

Query  278  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  99
             + A++VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP T++DL  +SGQ I IE
Sbjct  258  CLAAIVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPRTTIDLGTASGQDITIE  317

Query  98   ERSPKELLHTHGGL------------GEQI--AASGISVWNPAFDV  3
            ER+P+E+    G               E I  AA GI VWNPAFDV
Sbjct  318  ERAPEEVTRIKGPKINPDGRILVDEDAEVISTAADGIDVWNPAFDV  363



>ref|XP_007229603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Astyanax 
mexicanus]
Length=353

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 151/202 (75%), Gaps = 8/202 (4%)
 Frame = -3

Query  602  EIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGTALGVIRAV  429
            E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGTALGV+R++
Sbjct  125  EEMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGTALGVVRSL  181

Query  428  NTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGAD  249
               G L+R YCTETRP+NQG+RLTA+E V+E  PATLI DS AA  M+   + AV+VGAD
Sbjct  182  YALGRLKRMYCTETRPYNQGARLTAYEAVSEGFPATLITDSMAAIAMREKGITAVVVGAD  241

Query  248  RIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHT  69
            R+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ IVIEER   EL   
Sbjct  242  RVVANGDTANKVGTYQLAILAKHHGIPFYVAAPSTSCDLSLESGRDIVIEERPAVELTSI  301

Query  68   HGGLGEQIAASGISVWNPAFDV  3
            +   G  +AA GI VWNPAFDV
Sbjct  302  N---GVPVAAPGIEVWNPAFDV  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660