BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005C11 659 bp,

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADN92993.2|  lipoxygenase LOX1                                       401   4e-131   Ipomoea nil [qian niu]
emb|CDP15504.1|  unnamed protein product                                301   3e-93    Coffea canephora [robusta coffee]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    300   9e-93    Nicotiana sylvestris
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             300   2e-92    Populus trichocarpa [western balsam poplar]
emb|CAA58859.1|  lipoxygenase                                           298   1e-91    Nicotiana tabacum [American tobacco]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    298   1e-91    Nicotiana tomentosiformis
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             297   1e-91    Populus trichocarpa [western balsam poplar]
gb|AGL96414.1|  9-lipoxygenase                                          297   2e-91    Nicotiana benthamiana
gb|KCW61797.1|  hypothetical protein EUGRSUZ_H04495                     284   2e-90    Eucalyptus grandis [rose gum]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    295   2e-90    Populus euphratica
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   4e-90    Populus euphratica
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               291   3e-89    Solanum tuberosum [potatoes]
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    290   6e-89    Solanum lycopersicum
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                     284   2e-88    Eucalyptus grandis [rose gum]
emb|CBI36801.3|  unnamed protein product                                286   3e-88    Vitis vinifera
gb|ACO57136.1|  lipoxygenase 1                                          288   7e-88    Capsicum annuum
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    286   2e-87    Eucalyptus grandis [rose gum]
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 286   3e-87    Vitis vinifera
gb|AGU28274.1|  lipoxygenase 1                                          286   3e-87    Vitis vinifera
ref|NP_001268178.1|  lipoxygenase                                       286   3e-87    Vitis vinifera
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                     281   4e-87    Eucalyptus grandis [rose gum]
emb|CAD10740.1|  lipoxygenase                                           286   4e-87    Corylus avellana [European hazelnut]
emb|CDP20618.1|  unnamed protein product                                285   5e-87    Coffea canephora [robusta coffee]
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   8e-87    Eucalyptus grandis [rose gum]
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    284   2e-86    Eucalyptus grandis [rose gum]
emb|CCD74473.1|  lipoxygenase 1                                         271   4e-86    Arabidopsis halleri subsp. halleri
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   4e-86    Eucalyptus grandis [rose gum]
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    282   7e-86    Eucalyptus grandis [rose gum]
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               283   8e-86    Morus notabilis
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             282   9e-86    Prunus persica
emb|CAB94852.1|  lipoxygenase                                           282   1e-85    Prunus dulcis [sweet almond]
gb|AAG00881.1|AC064840_12  lipoxygenase - partial coding sequence       270   1e-85    Arabidopsis thaliana [mouse-ear cress]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                   275   2e-85    Citrus sinensis [Valencia orange]
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   4e-85    Vitis vinifera
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             280   5e-85    Nicotiana tomentosiformis
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg             275   5e-85    Citrus clementina
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                   275   5e-85    Citrus sinensis [Valencia orange]
emb|CBI36802.3|  unnamed protein product                                281   5e-85    Vitis vinifera
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    280   6e-85    Solanum tuberosum [potatoes]
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   7e-85    Prunus mume [ume]
emb|CAD10779.2|  lipoxygenase                                           280   7e-85    Prunus dulcis [sweet almond]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             280   8e-85    Prunus persica
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg             275   1e-84    Citrus clementina
gb|AGI16378.1|  lipoxygenase                                            279   1e-84    Malus domestica [apple tree]
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   1e-84    Prunus mume [ume]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    279   1e-84    Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    279   2e-84    Glycine max [soybeans]
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    278   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             278   2e-84    Nicotiana sylvestris
gb|ACG56281.1|  lipoxygenase                                            278   3e-84    Olea europaea
gb|AGI16382.1|  lipoxygenase                                            278   3e-84    Malus domestica [apple tree]
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    277   5e-84    Pyrus x bretschneideri [bai li]
gb|ABF19102.2|  9-lipoxygenase                                          277   6e-84    Capsicum annuum
gb|AGI16379.1|  lipoxygenase                                            277   7e-84    Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            277   7e-84    Malus domestica [apple tree]
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             277   7e-84    Prunus persica
gb|AGI16377.1|  lipoxygenase                                            277   8e-84    Malus domestica [apple tree]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    276   1e-83    
gb|ABW75772.2|  lipoxygenase                                            276   1e-83    Camellia sinensis [black tea]
gb|AGI16380.1|  lipoxygenase                                            276   1e-83    Malus domestica [apple tree]
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               276   2e-83    Malus domestica [apple tree]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    276   3e-83    
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    275   5e-83    Glycine max [soybeans]
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    275   5e-83    Nelumbo nucifera [Indian lotus]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    275   5e-83    Glycine soja [wild soybean]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   275   7e-83    Citrus sinensis [Valencia orange]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             275   8e-83    Citrus clementina
ref|XP_006838255.1|  hypothetical protein AMTR_s00103p00053790          258   9e-83    
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         274   1e-82    Jatropha curcas
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        274   1e-82    Solanum tuberosum [potatoes]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    273   2e-82    Solanum lycopersicum
gb|AAP83135.1|  lipoxygenase                                            273   2e-82    Nicotiana attenuata
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        272   3e-82    Camelina sativa [gold-of-pleasure]
gb|AAP83134.1|  lipoxygenase                                            272   4e-82    Nicotiana attenuata
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    272   4e-82    Fragaria vesca subsp. vesca
ref|XP_007030817.1|  Lipoxygenase 1                                     272   6e-82    Theobroma cacao [chocolate]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             272   6e-82    Citrus clementina
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        271   8e-82    Camelina sativa [gold-of-pleasure]
ref|XP_002512386.1|  lipoxygenase, putative                             271   8e-82    Ricinus communis
gb|AEQ30071.1|  lipoxygenase                                            271   1e-81    Litchi chinensis [litchi]
emb|CAA64767.1|  lipoxygenase                                           261   1e-81    Solanum tuberosum [potatoes]
ref|NP_001234098.1|  lipoxygenase                                       270   2e-81    Solanum lycopersicum
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 270   2e-81    
gb|AAO03558.1|  lipoxygenase 1                                          270   2e-81    Brassica napus [oilseed rape]
gb|AAZ04411.1|  lipoxygenase                                            270   2e-81    Adelostemma gracillimum
gb|AFU51542.1|  lipoxygenase 3                                          270   2e-81    Capsicum annuum
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        270   2e-81    Tarenaya hassleriana [spider flower]
ref|XP_002319014.2|  lipoxygenase family protein                        270   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    271   3e-81    Malus domestica [apple tree]
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             270   3e-81    Camelina sativa [gold-of-pleasure]
ref|NP_175900.1|  lipoxygenase 1                                        270   4e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         270   4e-81    Jatropha curcas
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        269   5e-81    Solanum lycopersicum
ref|XP_006850111.1|  hypothetical protein AMTR_s00022p00225700          265   5e-81    
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    268   9e-81    Solanum tuberosum [potatoes]
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    269   9e-81    Populus euphratica
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   268   1e-80    Citrus sinensis [Valencia orange]
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    268   2e-80    Solanum tuberosum [potatoes]
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        267   3e-80    
gb|AAA74393.1|  lipoxygenase                                            267   3e-80    Solanum lycopersicum
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    267   3e-80    Sesamum indicum [beniseed]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             267   3e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    267   3e-80    Nelumbo nucifera [Indian lotus]
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    267   3e-80    Solanum tuberosum [potatoes]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        267   4e-80    Tarenaya hassleriana [spider flower]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             267   4e-80    Brassica rapa
ref|XP_002516771.1|  lipoxygenase, putative                             267   4e-80    
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             266   5e-80    Eutrema salsugineum
ref|XP_002311617.1|  lipoxygenase family protein                        266   1e-79    Populus trichocarpa [western balsam poplar]
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    265   2e-79    Pyrus x bretschneideri [bai li]
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    265   2e-79    Arabis alpina [alpine rockcress]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             264   4e-79    Populus trichocarpa [western balsam poplar]
emb|CDY43490.1|  BnaA01g21450D                                          267   4e-79    Brassica napus [oilseed rape]
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    264   4e-79    Populus euphratica
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             264   4e-79    Phaseolus vulgaris [French bean]
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    265   5e-79    Eucalyptus grandis [rose gum]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        264   6e-79    Morus notabilis
emb|CAA64764.1|  lipoxygenase                                           254   6e-79    Solanum tuberosum [potatoes]
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 263   9e-79    
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 263   1e-78    
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    263   1e-78    Populus euphratica
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    263   2e-78    Pyrus x bretschneideri [bai li]
gb|AHX56187.1|  lipoxygenase                                            262   2e-78    Diospyros kaki [Japanese persimmon]
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             262   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             262   2e-78    Prunus persica
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    262   3e-78    Populus euphratica
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   4e-78    Populus euphratica
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   4e-78    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAD09861.1|  lipoxygenase                                            261   4e-78    Persea americana
dbj|BAH57745.1|  lipoxygenase                                           261   5e-78    Actinidia arguta
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   5e-78    Pyrus x bretschneideri [bai li]
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             261   5e-78    Capsella rubella
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   5e-78    Prunus mume [ume]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38135.1|  hypothetical protein B456_006G238200                    255   5e-78    Gossypium raimondii
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   6e-78    Fragaria vesca subsp. vesca
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   7e-78    Prunus mume [ume]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   7e-78    Prunus mume [ume]
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    260   7e-78    
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    260   1e-77    Arabis alpina [alpine rockcress]
gb|AGI16415.1|  lipoxygenase                                            260   1e-77    Malus domestica [apple tree]
gb|AGI16414.1|  lipoxygenase                                            260   1e-77    Malus domestica [apple tree]
gb|AGK82783.1|  lipoxygenase                                            260   2e-77    Malus domestica [apple tree]
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               260   2e-77    Malus domestica [apple tree]
gb|KJB38136.1|  hypothetical protein B456_006G238200                    255   2e-77    Gossypium raimondii
gb|AGK82776.1|  lipoxygenase                                            259   3e-77    Malus domestica [apple tree]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               259   3e-77    Malus domestica [apple tree]
gb|AGK82774.1|  lipoxygenase                                            259   3e-77    Malus domestica [apple tree]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             258   6e-77    Phaseolus vulgaris [French bean]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          258   6e-77    Solanum tuberosum [potatoes]
ref|NP_001275351.1|  5-lipoxygenase                                     258   6e-77    Solanum tuberosum [potatoes]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    258   6e-77    Solanum tuberosum [potatoes]
gb|AGI16416.1|  lipoxygenase                                            258   6e-77    Malus domestica [apple tree]
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    258   7e-77    Nicotiana tomentosiformis
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    258   7e-77    Solanum tuberosum [potatoes]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    258   7e-77    Cicer arietinum [garbanzo]
gb|AGK82775.1|  lipoxygenase                                            258   7e-77    Malus domestica [apple tree]
emb|CAE17327.1|  lipoxygenase                                           258   8e-77    Fragaria x ananassa
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    258   8e-77    Nicotiana tomentosiformis
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    258   1e-76    Populus euphratica
gb|AIC82456.1|  lipoxygenase                                            257   1e-76    Cocos nucifera
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                257   2e-76    Gossypium hirsutum [American cotton]
gb|AGI16413.1|  lipoxygenase                                            257   2e-76    Malus domestica [apple tree]
ref|XP_002315780.1|  lipoxygenase family protein                        257   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_006607065.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    247   3e-76    
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    256   3e-76    Solanum tuberosum [potatoes]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        256   3e-76    Solanum tuberosum [potatoes]
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   3e-76    Sesamum indicum [beniseed]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   3e-76    Sesamum indicum [beniseed]
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   4e-76    Solanum lycopersicum
gb|KJB28315.1|  hypothetical protein B456_005G041900                    256   4e-76    Gossypium raimondii
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   5e-76    Solanum lycopersicum
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   5e-76    Nicotiana sylvestris
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    255   6e-76    Solanum tuberosum [potatoes]
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   7e-76    Solanum tuberosum [potatoes]
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   7e-76    Nicotiana sylvestris
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    255   7e-76    Elaeis guineensis
gb|KJB38138.1|  hypothetical protein B456_006G238200                    255   7e-76    Gossypium raimondii
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    256   7e-76    Solanum tuberosum [potatoes]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    255   8e-76    Fragaria vesca subsp. vesca
gb|KJB80989.1|  hypothetical protein B456_013G124500                    255   1e-75    Gossypium raimondii
gb|KJB38137.1|  hypothetical protein B456_006G238200                    255   1e-75    Gossypium raimondii
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    254   2e-75    Gossypium arboreum [tree cotton]
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               255   2e-75    Malus domestica [apple tree]
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    254   2e-75    Malus domestica [apple tree]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    254   2e-75    Sesamum indicum [beniseed]
gb|ABF19103.2|  9-lipoxygenase                                          254   3e-75    Capsicum annuum
emb|CAA64765.1|  lipoxygenase                                           253   3e-75    Solanum tuberosum [potatoes]
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    254   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    254   5e-75    Pyrus x bretschneideri [bai li]
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    254   5e-75    Pyrus x bretschneideri [bai li]
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    253   6e-75    Cucumis sativus [cucumbers]
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    253   6e-75    
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    252   9e-75    Phoenix dactylifera
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                252   1e-74    Erythranthe guttata [common monkey flower]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    252   1e-74    
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    251   2e-74    Elaeis guineensis
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    251   3e-74    Sesamum indicum [beniseed]
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    251   3e-74    Fragaria vesca subsp. vesca
gb|AGK82779.1|  lipoxygenase                                            251   4e-74    Malus domestica [apple tree]
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    251   5e-74    
gb|ABF60002.1|  lipoxygenase 2                                          250   6e-74    Actinidia deliciosa [Chinese gooseberry]
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        250   8e-74    Cucumis melo [Oriental melon]
ref|XP_003591120.1|  Lipoxygenase                                       248   4e-73    Medicago truncatula
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              247   8e-73    Glycine soja [wild soybean]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    245   4e-72    
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    244   7e-72    
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    244   9e-72    
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    244   1e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    243   1e-71    Nicotiana sylvestris
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    244   1e-71    Cucumis melo [Oriental melon]
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             244   1e-71    Prunus persica
gb|AEZ50136.1|  lipoxygenase                                            244   2e-71    Diospyros kaki [Japanese persimmon]
gb|AAC61785.1|  lipoxygenase 1                                          243   2e-71    Cucumis sativus [cucumbers]
emb|CAA63483.1|  lipoxygenase                                           243   2e-71    Cucumis sativus [cucumbers]
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        243   2e-71    
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    243   2e-71    Solanum tuberosum [potatoes]
gb|ABV32552.1|  lipoxygenase                                            244   2e-71    Prunus persica
gb|KJB80990.1|  hypothetical protein B456_013G124500                    243   3e-71    Gossypium raimondii
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    243   3e-71    Cucumis sativus [cucumbers]
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    241   3e-71    Tarenaya hassleriana [spider flower]
emb|CDP20619.1|  unnamed protein product                                240   4e-71    Coffea canephora [robusta coffee]
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             242   4e-71    Phaseolus vulgaris [French bean]
gb|ACD43483.1|  lipoxygenase 1                                          242   7e-71    Olea europaea
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    242   7e-71    Cucumis sativus [cucumbers]
gb|ACH91370.1|  lipoxygenase LOX-3                                      242   8e-71    Prunus persica
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    241   2e-70    Prunus mume [ume]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                241   2e-70    Erythranthe guttata [common monkey flower]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    240   2e-70    Solanum tuberosum [potatoes]
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    238   2e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    240   3e-70    Cucumis melo [Oriental melon]
emb|CDO99039.1|  unnamed protein product                                240   4e-70    Coffea canephora [robusta coffee]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    239   5e-70    Cicer arietinum [garbanzo]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    239   6e-70    Solanum lycopersicum
gb|ADL41189.1|  lipoxygenase                                            239   8e-70    Camellia sinensis [black tea]
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             239   9e-70    Phaseolus vulgaris [French bean]
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    238   9e-70    Solanum lycopersicum
gb|AAA79186.1|  lipoxygenase                                            239   9e-70    Cucumis sativus [cucumbers]
ref|XP_007030814.1|  Lipoxygenase 1                                     238   9e-70    Theobroma cacao [chocolate]
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    238   1e-69    
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    238   1e-69    Nicotiana tomentosiformis
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    238   1e-69    Elaeis guineensis
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               238   1e-69    Malus domestica [apple tree]
gb|AAD09202.1|  lipoxygenase                                            238   2e-69    Solanum tuberosum [potatoes]
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    238   2e-69    Malus domestica [apple tree]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    237   3e-69    Sesamum indicum [beniseed]
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    237   4e-69    Tarenaya hassleriana [spider flower]
gb|ABB82552.1|  13S-lipoxygenase                                        237   4e-69    Cucumis melo var. inodorus [casaba melon]
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    237   5e-69    Solanum tuberosum [potatoes]
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    237   5e-69    Sesamum indicum [beniseed]
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    236   5e-69    Nicotiana tomentosiformis
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             236   6e-69    Prunus persica
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    236   7e-69    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ACU81176.1|  13S-lipoxygenase                                        236   9e-69    Cucumis melo var. inodorus [casaba melon]
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        236   9e-69    Cucumis melo [Oriental melon]
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    236   9e-69    Nicotiana sylvestris
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  234   3e-68    Medicago truncatula
gb|AHX56188.1|  lipoxygenase                                            234   3e-68    Diospyros kaki [Japanese persimmon]
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    234   3e-68    Cucumis melo [Oriental melon]
gb|AHI86055.1|  lipoxygenase                                            234   3e-68    Cucumis melo var. makuwa
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    234   4e-68    Cucumis sativus [cucumbers]
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    234   6e-68    Glycine max [soybeans]
gb|ADG03095.1|  lipoxygenase 3                                          233   6e-68    Glycine max [soybeans]
gb|ABX60408.1|  lipoxygenase L-3                                        233   6e-68    Glycine max [soybeans]
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   233   6e-68    Glycine max [soybeans]
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        233   7e-68    Glycine soja [wild soybean]
emb|CAP59449.1|  lipoxygenase                                           233   1e-67    Momordica charantia [balsam pear]
ref|XP_003626279.1|  Chalcone synthase                                  235   2e-67    
ref|XP_007030813.1|  Lipoxygenase 1                                     232   2e-67    Theobroma cacao [chocolate]
gb|AGI37654.1|  lipoxygenase                                            232   2e-67    Cucumis sativus [cucumbers]
emb|CDY46325.1|  BnaC01g31590D                                          232   2e-67    Brassica napus [oilseed rape]
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    233   2e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007030811.1|  Lipoxygenase 1                                     231   4e-67    Theobroma cacao [chocolate]
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        231   4e-67    Phoenix dactylifera
gb|KJB26432.1|  hypothetical protein B456_004G241300                    231   4e-67    Gossypium raimondii
emb|CBI26229.3|  unnamed protein product                                230   4e-67    Vitis vinifera
ref|XP_007030815.1|  Lipoxygenase 1                                     231   6e-67    Theobroma cacao [chocolate]
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             231   6e-67    Capsella rubella
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                231   7e-67    Erythranthe guttata [common monkey flower]
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    231   7e-67    
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          230   9e-67    
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    230   1e-66    
gb|AEO13837.1|  lipoxygenase                                            230   1e-66    
ref|XP_003597559.1|  Seed lipoxygenase-3                                229   2e-66    
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    229   2e-66    
emb|CAA31664.1|  unnamed protein product                                229   2e-66    
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    229   2e-66    
gb|AGH13205.1|  lipoxygenase                                            229   2e-66    
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    229   2e-66    
gb|ACF74339.1|  lipoxygenase 1                                          215   3e-66    
ref|XP_003592410.1|  Lipoxygenase                                       228   5e-66    
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        228   6e-66    
ref|XP_002883361.1|  lipoxygenase                                       228   7e-66    
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    228   8e-66    
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    226   8e-66    
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         228   1e-65    
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    227   2e-65    
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    226   2e-65    
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        227   2e-65    
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    226   2e-65    
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    226   3e-65    
prf||1502333A  lipoxygenase 3                                           226   3e-65 
gb|KJB26433.1|  hypothetical protein B456_004G241400                    224   4e-65    
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    226   4e-65    
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              226   4e-65    
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    226   5e-65    
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    226   5e-65    
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        225   6e-65    
gb|KJB26434.1|  hypothetical protein B456_004G241400                    225   9e-65    
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             224   1e-64    
emb|CDY38326.1|  BnaC05g30190D                                          224   1e-64    
gb|KCW61804.1|  hypothetical protein EUGRSUZ_H04500                     221   2e-64    
ref|NP_188879.2|  lipoxygenase 5                                        224   2e-64    
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    224   2e-64    
dbj|BAB01777.1|  lipoxygenase                                           224   2e-64    
gb|AEI71780.1|  bacterial-induced lipoxygenase                          224   2e-64    
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    223   3e-64    
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    223   4e-64    
emb|CDY64191.1|  BnaA01g36630D                                          223   4e-64    
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        223   4e-64    
gb|AAG61118.1|  lipoxygenase                                            223   5e-64    
ref|NP_001105515.1|  lipoxygenase                                       223   5e-64    
emb|CAC19365.1|  lipoxygenase                                           223   5e-64    
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    222   7e-64    
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    222   7e-64    
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        222   1e-63    
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    220   3e-63    
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    220   3e-63    
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    221   3e-63    
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    220   4e-63    
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    219   7e-63    
emb|CDP20620.1|  unnamed protein product                                219   8e-63    
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    219   9e-63    
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    219   1e-62    
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        219   1e-62    
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    218   2e-62    
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   218   2e-62    
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    218   3e-62    
ref|NP_001051212.1|  Os03g0738600                                       217   4e-62    
gb|EAY91797.1|  hypothetical protein OsI_13441                          217   5e-62    
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        217   6e-62    
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        217   6e-62    
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    217   6e-62    
ref|XP_003597558.1|  Lipoxygenase                                       216   7e-62    
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                             216   9e-62    
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    217   9e-62    
ref|NP_001050993.1|  Os03g0700400                                       216   9e-62    
gb|EPS66745.1|  lipoxygenase                                            213   1e-61    
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    216   1e-61    
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    216   1e-61    
gb|EAY91529.1|  hypothetical protein OsI_13162                          216   1e-61    
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    216   2e-61    
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    215   2e-61    
gb|KHN32712.1|  Linoleate 9S-lipoxygenase-4                             214   2e-61    
gb|ABX60409.1|  lipoxygease L-4                                         215   2e-61    
ref|NP_001238203.1|  lipoxygenase L-5                                   215   3e-61    
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...    215   3e-61    
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    214   3e-61    
gb|KHN32711.1|  Linoleate 9S-lipoxygenase-4                             214   3e-61    
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    214   4e-61    
gb|ACV84249.1|  LOX1                                                    214   4e-61    
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    214   4e-61    
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050          214   4e-61    
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    214   5e-61    
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    214   5e-61    
gb|EAZ28267.1|  hypothetical protein OsJ_12238                          216   6e-61    
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          214   7e-61    
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             214   8e-61    
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        213   1e-60    
emb|CAA45738.1|  lipoxygenase                                           213   2e-60    
gb|AAY87056.1|  13-lipoxygenase                                         212   2e-60    
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    212   3e-60    
ref|XP_003627174.1|  Lipoxygenase                                       212   3e-60    
emb|CAA55318.1|  lipoxygenase                                           211   4e-60    
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    211   4e-60    
ref|XP_007150488.1|  hypothetical protein PHAVU_005G1568000g            204   5e-60    
gb|ADG03092.1|  lipoxygenase 2                                          211   7e-60    
gb|AAY87057.1|  13-lipoxygenase                                         211   8e-60    
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               211   8e-60    
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   211   8e-60    
gb|ABX60407.1|  lipoxygease L-2                                         211   8e-60    
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like          211   8e-60    
gb|ADG03091.1|  lipoxygenase 2                                          211   8e-60    
gb|AFK32352.1|  lipoxygenase-2                                          211   9e-60    
ref|NP_001235250.1|  lipoxygenase                                       211   1e-59    
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    211   1e-59    
gb|ADG03094.1|  mutant lipoxygenase 1                                   206   2e-59    
gb|ABQ10187.1|  lipoxygenase                                            210   2e-59    
gb|AGS94394.3|  lipoxygenase                                            210   2e-59    
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    209   2e-59    
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               209   3e-59    
emb|CAA53730.1|  lipoxygenase                                           209   3e-59    
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             209   3e-59    
ref|XP_008359964.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    200   3e-59    
gb|AEU04516.1|  lipoxygenase 1                                          209   3e-59    
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    209   4e-59    
ref|XP_003627181.1|  Lipoxygenase                                       209   5e-59    
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    208   7e-59    
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        208   7e-59    
ref|NP_001237338.1|  lipoxygenase-10                                    208   7e-59    
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               208   8e-59    
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             207   1e-58    
ref|NP_001238692.1|  lipoxygenase                                       207   1e-58    
gb|ACJ83328.1|  unknown                                                 196   1e-58    
ref|XP_003627173.1|  Seed lipoxygenase-3                                207   2e-58    
ref|XP_002521992.1|  lipoxygenase, putative                             207   2e-58    
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1             207   2e-58    
ref|XP_009604140.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    195   2e-58    
gb|EMT25349.1|  Lipoxygenase 2                                          207   2e-58    
gb|ACS34908.1|  lipoxygenase 2                                          206   3e-58    
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450          206   3e-58    
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        206   3e-58    
ref|XP_004970879.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        206   3e-58    
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    209   5e-58    
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        206   5e-58    
gb|ADR71858.1|  lipoxygenase-1                                          205   6e-58    
gb|EMT18292.1|  Putative lipoxygenase 3                                 205   9e-58    
ref|XP_003627185.1|  Lipoxygenase                                       205   1e-57    
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    205   1e-57    
ref|XP_003627310.1|  Lipoxygenase                                       204   1e-57    
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    204   1e-57    
gb|ADR71859.1|  lipoxygenase-1                                          204   2e-57    
gb|AEB70991.1|  lipoxygenase 4                                          204   2e-57    
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          204   3e-57    
tpg|DAA56392.1|  TPA: lipoxygenase1                                     204   3e-57    
gb|AHG59316.1|  lipoxygenase                                            204   3e-57    
gb|AEB70990.1|  lipoxygenase 3                                          204   3e-57    
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    204   3e-57    
gb|AHG59315.1|  lipoxygenase                                            203   3e-57    
ref|XP_003627187.1|  Lipoxygenase                                       203   3e-57    
ref|NP_001105973.1|  lipoxygenase                                       203   4e-57    
tpg|DAA56391.1|  TPA: lipoxygenase1                                     203   4e-57    
gb|ADR71856.1|  lipoxygenase-1                                          203   4e-57    
gb|ACS34909.1|  lipoxygenase 1                                          203   4e-57    
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant        202   5e-57    
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like          203   5e-57    
gb|ADR71857.1|  lipoxygenase-1                                          203   6e-57    
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant             202   6e-57    
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant              202   6e-57    
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant              202   6e-57    
gb|AAB70865.1|  lipoxygenase 2                                          202   6e-57    
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement             202   6e-57    
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant              202   6e-57    
gb|ADG03093.1|  lipoxygenase 1                                          202   6e-57    
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant     202   7e-57    
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                  202   7e-57    
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant     202   8e-57    
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant     202   8e-57    
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant     202   8e-57    
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant     202   8e-57    
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant     202   8e-57    
gb|ADP02185.1|  putative lipoxygenase                                   202   9e-57    
gb|AAF15296.2|AF204210_1  lipoxygenase                                  202   1e-56    
gb|EAY91532.1|  hypothetical protein OsI_13165                          202   1e-56    
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    202   1e-56    
dbj|BAJ91632.1|  predicted protein                                      202   1e-56    
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             202   1e-56    
emb|CAG44503.1|  lipoxygenase LOXN3                                     202   1e-56    
emb|CAG44501.1|  lipoxygenase LOXN3                                     202   1e-56    
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    201   1e-56    
ref|NP_001237323.1|  lipoxygenase-9                                     202   1e-56    
gb|EPS73035.1|  hypothetical protein M569_01717                         205   1e-56    
emb|CAA97845.1|  lipoxygenase                                           201   1e-56    
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             201   2e-56    
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    201   2e-56    
gb|AEL03787.1|  lipoxygenase                                            201   3e-56    
gb|ABD47523.1|  dual positional specificity lipoxygenase                201   3e-56    
ref|NP_001105003.1|  lipoxygenase                                       201   3e-56    
gb|ACL53478.1|  unknown                                                 201   3e-56    
ref|XP_003627196.1|  Lipoxygenase                                       201   3e-56    
gb|ACG43480.1|  lipoxygenase 2                                          200   4e-56    
dbj|BAJ87153.1|  predicted protein                                      200   5e-56    
gb|AAF60270.1|  lipoxygenase 1                                          199   1e-55    
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                          199   1e-55    
sp|P38414.1|LOX1_LENCU  RecName: Full=Linoleate 9S-lipoxygenase; ...    199   2e-55    
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          199   2e-55    
ref|XP_004151736.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    195   2e-55    
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        198   2e-55    
ref|XP_003612346.1|  Seed lipoxygenase                                  195   2e-55    
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             198   2e-55    
gb|AET01658.2|  seed linoleate 9S-lipoxygenase                          198   3e-55    
ref|XP_004510411.1|  PREDICTED: linoleate 9S-lipoxygenase-like          198   3e-55    
gb|AAG42354.1|  lipoxygenase                                            197   5e-55    
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     197   5e-55    
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    196   1e-54    
ref|XP_003627201.1|  Seed lipoxygenase                                  199   2e-54    
ref|NP_001235189.1|  lipoxygenase                                       195   2e-54    
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    195   3e-54    
ref|XP_003627202.1|  Seed lipoxygenase                                  198   3e-54    
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     195   3e-54    
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                          195   3e-54    
gb|AFW67907.1|  hypothetical protein ZEAMMB73_739462                    192   3e-54    
ref|XP_003612345.1|  Seed lipoxygenase                                  195   3e-54    
gb|ABX60410.1|  lipoxygenase L-5                                        194   4e-54    
gb|AIL90390.1|  lipoxygenase                                            195   4e-54    
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             194   6e-54    
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    193   1e-53    
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    194   1e-53    
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        194   1e-53    
ref|XP_003627177.1|  Lipoxygenase                                       187   1e-53    



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   401 bits (1030),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -2

Query  610  ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK  431
            ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK
Sbjct  9    ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK  68

Query  430  RSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDV  251
            RS+AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVP AFIIKNNHPNEFYLKTLTLEDV
Sbjct  69   RSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPGAFIIKNNHPNEFYLKTLTLEDV  128

Query  250  PNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGEL  71
            PNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTP  LK YR+EEL++LRGTGTGE 
Sbjct  129  PNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPDLLKTYREEELLNLRGTGTGER  188

Query  70   KEWDRVYDYAYYNDLGDPDKGAE  2
            KEWDRVYDYAYYNDLGDPD+GAE
Sbjct  189  KEWDRVYDYAYYNDLGDPDRGAE  211



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLD NDFNAS +D + + LGQKVSL+L+S+V  D G  LKGK  +AA
Sbjct  14   KKIKGTVVLMKKNVLDLNDFNASFLDGIHELLGQKVSLQLISAVNVDQGT-LKGKLGKAA  72

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+  NT LA+GE+A  I F+W ED G+P AFIIKNNHP +FYLKTLTLE+VP HG 
Sbjct  73   YLEDWITTNTFLAAGETAADITFDWDEDQGIPGAFIIKNNHPTQFYLKTLTLEEVPGHGR  132

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA+KY  +R+FFSNQAYLPS TP PL++YR EELV+LRG GTGELKEWDR
Sbjct  133  VHFVCNSWVYPAAKYKKDRVFFSNQAYLPSDTPEPLRQYRAEELVNLRGDGTGELKEWDR  192

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLGDPDKG E
Sbjct  193  VYDYAYYNDLGDPDKGKE  210



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   300 bits (769),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRS+AA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHADPANGLQGKRSKAA  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+  NT +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNNTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA KY   RIFF+NQAYLPS+TP PL+K R+ ELV LRG GTG+L+EWD
Sbjct  137  KVHFVCNSWVYPAKKYKSPRIFFANQAYLPSETPEPLRKCRENELVTLRGDGTGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  197  RVYDYAYYNDLGDPDKGKE  215



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 166/200 (83%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSE  422
             KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ+VSL+LVS+V +D   N LKGK  E
Sbjct  21   VKKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQRVSLQLVSAVNSDPSENDLKGKLGE  80

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  81   PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  140

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SW+YP ++YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  141  GRVHFVCNSWIYPTTRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  200

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKGA+
Sbjct  201  DRVYDYAYYNDLGDPDKGAK  220



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRS+AA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA+KY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  137  KVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPDTLRKYRENELVTLRGDGTGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG +
Sbjct  197  RVYDYAYYNDLGDPDKGQD  215



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRS+AA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPEAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA+KY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  137  KVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPETLRKYRENELVTLRGDGTGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG +
Sbjct  197  RVYDYAYYNDLGDPDKGQD  215



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSE  422
             KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ VSL+LVS+V +D   N LKGK  E
Sbjct  2    VKKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQGVSLQLVSAVNSDPSENDLKGKLGE  61

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  62   PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  121

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SW+YP  +YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  122  GRVHFVCNSWIYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  181

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKGA+
Sbjct  182  DRVYDYAYYNDLGDPDKGAK  201



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV  D  NGL+GKRS+AA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHVDPANGLQGKRSKAA  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNKTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA+KY   RIFF+NQAYLPS+TP PL+K R+ ELV LRG GTG+L+EWD
Sbjct  137  KVHFVCNSWVYPANKYKSPRIFFANQAYLPSETPEPLRKCRENELVTLRGDGTGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  197  RVYDYAYYNDLGDPDKGKE  215



>gb|KCW61797.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=443

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  + 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141  QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLG+PDK
Sbjct  201  RVYDYAYYNDLGNPDK  216



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSE  422
             KKIKG VVLM+KNVL FNDF+ASI+D + + LGQ+VSL+L+S+V +D   N LKGK  E
Sbjct  26   CKKIKGTVVLMKKNVLSFNDFHASILDRVHELLGQRVSLQLISAVNSDRSENDLKGKLGE  85

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ WV   T L +GE+AFK+ F+W E+ GVP AF+I+NNH NEFYL+T+TLE VP H
Sbjct  86   PAYLEEWVTTVTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLNEFYLRTVTLEGVPGH  145

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SW+YPA +YN +R+FF+NQ +LP +TPAPL+KYR+EELVHLRG G GELKEW
Sbjct  146  GRVHFVCNSWIYPAKRYNKDRVFFTNQTFLPHETPAPLRKYREEELVHLRGNGEGELKEW  205

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKG E
Sbjct  206  DRVYDYAYYNDLGDPDKGPE  225



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSE  422
             KKIKG VVLM+KNVLDFNDFNAS++D + + LG  VSL+LVS+V +D   N LKGK  E
Sbjct  21   VKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGHGVSLQLVSAVNSDPSENDLKGKLGE  80

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  81   PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  140

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SWVYP  +YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  141  GRVHFVCNSWVYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  200

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKGA+
Sbjct  201  DRVYDYAYYNDLGDPDKGAK  220



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG +VLM+KNVLDFND NAS++D + +FLG++VSL+L+S V AD GN L+GKRS  A
Sbjct  19   KKVKGTIVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISVVHADPGNSLQGKRSNPA  78

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAF + F+W ED GVP AFII N H NEFYLK+LTLEDVPNHG 
Sbjct  79   YLEKWLTTGTSLVAGESAFDVTFDWDEDIGVPGAFIINNFHFNEFYLKSLTLEDVPNHGN  138

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA KY  ERIFF+NQAYLP +TP PL+ YR++ELV+LRG G G+L+EWDR
Sbjct  139  VHFVCNSWVYPAKKYKSERIFFANQAYLPGETPEPLRNYREKELVNLRGNGNGKLEEWDR  198

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA YNDLGDP+KG +
Sbjct  199  VYDYALYNDLGDPEKGKQ  216



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
             KK+KG VVLM+KNVLDFND NAS++D + +FLG++VSL+L+S+V AD GN L+GKRS  
Sbjct  17   VKKVKGTVVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISAVHADPGNTLQGKRSNP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +GESAF + F+W +D GVP AFII N H NEFYLK+LTLEDVPNHG
Sbjct  77   AYLEKWLTTGTSLVAGESAFDVTFDWDDDIGVPGAFIINNFHFNEFYLKSLTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA +Y  ERIFF+NQAYLP +TP PL+ YR++ELV+LRG G G+L+EWD
Sbjct  137  SVHFVCNSWVYPAKRYKSERIFFANQAYLPGETPEPLRNYREKELVNLRGDGNGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLGDP+KG +
Sbjct  197  RVYDYALYNDLGDPEKGKQ  215



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  + 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141  QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLG+PDK
Sbjct  201  RVYDYAYYNDLGNPDK  216



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136  IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG PD+
Sbjct  196  VYDYAYYNDLGKPDR  210



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KN LDFND NAS +D + +FLG++VSL+L+SSV  D  NGL+GKRS+ A
Sbjct  18   KKMKGTVVLMKKNALDFNDVNASFLDGVLEFLGKRVSLQLISSVHGDPANGLQGKRSKPA  77

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++W+   T L +GESAF + F+W ED GVP AFII N H NEF+LK+LTLEDVPNHG+
Sbjct  78   YLENWLTTRTPLVAGESAFDVTFDWDEDIGVPGAFIINNLHFNEFFLKSLTLEDVPNHGK  137

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y  ERIFF+NQAYLP +TP PL++YR++ELV LRG G G+L+EWDR
Sbjct  138  IHFVCNSWVYPAKRYKSERIFFANQAYLPHETPEPLREYREKELVTLRGDGNGKLEEWDR  197

Query  55   VYDYAYYNDLGDPDKG  8
            VYDYA+YNDLGDP++G
Sbjct  198  VYDYAFYNDLGDPERG  213



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+K VLDFNDFNAS++DN+++ LG+KVSL LVS+V  D   GL+GK  + 
Sbjct  27   SKKVKGTVVLMKKYVLDFNDFNASVLDNVAELLGKKVSLRLVSAVHGDPEKGLRGKLGKP  86

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T LA+G+SAFK+ F+W E+ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AYLEEWITTITPLAAGDSAFKVTFDWDEEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA++Y  +R+FFSN+ YLPSQTPAPL KYR+EELV+LRG GT EL+EWD
Sbjct  147  RVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTAELQEWD  206

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLGDPDK
Sbjct  207  RVYDYAYYNDLGDPDK  222



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136  IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG PD+
Sbjct  196  VYDYAYYNDLGKPDR  210



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136  IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG+PD+
Sbjct  196  VYDYAYYNDLGNPDR  210



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   286 bits (731),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136  IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG+PD+
Sbjct  196  VYDYAYYNDLGNPDR  210



>gb|KCW44986.1| hypothetical protein EUGRSUZ_L01433 [Eucalyptus grandis]
Length=636

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  + 
Sbjct  21   SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141  RVHFVCNSWVYPADRYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDK A+
Sbjct  201  RVYDYAYYNDLGNPDKDAK  219



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   286 bits (731),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  610  ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKG  434
            A    +KI+G VVLM+KNVLDFNDFNAS++D + + LGQKVSL+L+S+V AD   NGL+G
Sbjct  25   AAEKCRKIEGSVVLMKKNVLDFNDFNASVLDRVHELLGQKVSLQLISAVNADPSANGLQG  84

Query  433  KRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  254
            K    AYL+HW+   T L +GESAFK+ F+W ED  +P AF+I+NNH +EFYLK+LTLED
Sbjct  85   KLGNLAYLEHWISTITPLIAGESAFKVTFDWDEDIAIPGAFLIRNNHHSEFYLKSLTLED  144

Query  253  VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  74
            VP  G +HF C SWVYPA +Y  +R+FFSN+ +LP++TP PL KYR+EELV+LRG GTGE
Sbjct  145  VPGQGRIHFVCNSWVYPADQYKKDRVFFSNKTFLPNETPGPLLKYREEELVNLRGDGTGE  204

Query  73   LKEWDRVYDYAYYNDLGDPDKG  8
            L+EWDRVYDYAYYNDLG+PDKG
Sbjct  205  LQEWDRVYDYAYYNDLGNPDKG  226



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   285 bits (730),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVLDF DFNASI D + + LG+KVSL+LVSSV  D   G +GK    A
Sbjct  14   KKIKGTVVLMKKNVLDFTDFNASIADEVHELLGKKVSLQLVSSVNGDPEKGQQGKLGSPA  73

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+  N  L  GES F I F+W E+  VP AFIIKN+H +EF+LKT+TLEDVP HG 
Sbjct  74   YLEGWITTNHRLTVGESVFNITFDWEEEVEVPGAFIIKNHHHSEFFLKTVTLEDVPGHGR  133

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA KYN  RIFFSNQAYLPS TP PL++YR+EEL+ LRG GTGEL+EWDR
Sbjct  134  IHFVCNSWVYPAKKYNQNRIFFSNQAYLPSDTPEPLRRYREEELLTLRGDGTGELQEWDR  193

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDL DPDKG++
Sbjct  194  VYDYAYYNDLADPDKGSD  211



>ref|XP_010040715.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=656

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  + 
Sbjct  21   SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141  RVHFVCNSWVYPADRYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDK A+
Sbjct  201  RVYDYAYYNDLGNPDKDAK  219



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  + 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141  QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLG+PDK
Sbjct  201  RVYDYAYYNDLGNPDK  216



>emb|CCD74473.1| lipoxygenase 1, partial [Arabidopsis halleri subsp. halleri]
Length=381

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  +A
Sbjct  16   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKLGKA  75

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+IKN+H +EF+L++LTLEDVP HG
Sbjct  76   AHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIKNSHFSEFFLRSLTLEDVPGHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWD
Sbjct  136  RVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKEWD  195

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLG P K
Sbjct  196  RVYDYAYYNDLGAPPK  211



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VVLM+K VLDFNDFNAS++DN+ + LG+KVSL LVS V  D  N L+GK  + 
Sbjct  27   SKKVKGTVVLMKKYVLDFNDFNASVLDNVDELLGKKVSLRLVSVVHGDPENCLRGKLGKP  86

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A+L+ W+   T L +G+SAFK+ F W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA++Y  +R+FFSN+ YLPSQTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  147  RVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTGELQEWD  206

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG++
Sbjct  207  RVYDYAYYNDLGDPDKGSK  225



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   282 bits (722),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+ G VVLM+K VLDFNDFNAS++D + + LG+KVSL LVS+V +D  NGL+GK  + 
Sbjct  27   SKKVIGTVVLMKKYVLDFNDFNASVLDTIHELLGEKVSLRLVSAVHSDPENGLQGKLGKP  86

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SAFK+ F+W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AYLEKWITTITPLTAGDSAFKVTFDWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA +Y  +R+FFSN+ YLP +TPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  147  RVHFVCNSWVYPADRYKKDRVFFSNKTYLPRETPAPLVKYREEELVNLRGDGTGELQEWD  206

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG +
Sbjct  207  RVYDYAYYNDLGDPDKGTK  225



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   283 bits (723),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            K IKG VVLM+KNVLDFNDF+ASI+D + + LGQ+VSL+L+S+V AD  NGLKG   +AA
Sbjct  21   KIIKGSVVLMKKNVLDFNDFHASILDRVHELLGQRVSLQLISAVNADRANGLKGMLGKAA  80

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+     L  G+SAFK+ FEW ++ GVP AF+I+NNH +EFYLKTLTLEDVP  G 
Sbjct  81   YLEDWITTIAPLTPGDSAFKVSFEWEDEIGVPGAFLIRNNHHSEFYLKTLTLEDVPGEGR  140

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPASKY  +R+FFSN+ Y PS+TP+ L KYR+EEL  LRG G GELKEWDR
Sbjct  141  VHFVCNSWVYPASKYQTDRVFFSNKTYFPSETPSSLIKYREEELEILRGNGKGELKEWDR  200

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PD G E
Sbjct  201  VYDYAYYNDLGNPDDGQE  218



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  E 
Sbjct  19   SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139  RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWD  198

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDKG +
Sbjct  199  RVYDYAYYNDLGNPDKGPK  217



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  E 
Sbjct  19   SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTIGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139  RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWD  198

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDKG +
Sbjct  199  RVYDYAYYNDLGNPDKGPK  217



>gb|AAG00881.1|AC064840_12 lipoxygenase - partial coding sequence [Arabidopsis thaliana]
Length=391

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  
Sbjct  16   TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLG  75

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP 
Sbjct  76   KAAHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPG  135

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  136  HGRVHYICNSWIYPAKHYTTDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKE  195

Query  64   WDRVYDYAYYNDLGDPDK  11
            WDRVYDYAYYNDLG P K
Sbjct  196  WDRVYDYAYYNDLGVPPK  213



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   280 bits (717),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  32   KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  91

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  92   YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  151

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDR
Sbjct  152  IHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDR  211

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG+PD+
Sbjct  212  VYDYAYYNDLGNPDR  226



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +GESA+ + F+W E+FGVP AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLEKWLTTITPLTAGESAYSVTFDWEEEFGVPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPASKY  +RIFF N+ YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WD
Sbjct  137  KVHFVCNSWVYPASKYKSDRIFFVNKTYLPSETPAPLRKYRENELLTLRGGGTGKLEAWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA+YNDLGDPD+GA+
Sbjct  197  RVYDYAFYNDLGDPDQGAQ  215



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  + A
Sbjct  57   KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  116

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  117  YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  176

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDR
Sbjct  177  IHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDR  236

Query  55   VYDYAYYNDLGDPDK  11
            VYDYAYYNDLG+PD+
Sbjct  237  VYDYAYYNDLGNPDR  251



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVLM+KNVLDF D NASIVD + DFLG++VS +L+S+   D  NGL+GK S+ A
Sbjct  17   KKVKGTVVLMKKNVLDFTDVNASIVDGVLDFLGRRVSFQLISNSVHD-ANGLEGKLSKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T + +GES F + FEW  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76   YLENWITNITPVVAGESTFSVTFEWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPASKY   RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136  KIHFVCNSWVYPASKYKSNRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEEWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  196  RVYDYAYYNDLGDPDKGEE  214



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =   280 bits (715),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            ++KIKG +VLM+KNVLDFNDFNAS++D + + LGQ+VSL+L+S+   D  NG KGK  E 
Sbjct  19   SRKIKGTLVLMKKNVLDFNDFNASVLDGVHELLGQRVSLQLISADHGDSENGFKGKLGEP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139  RVHFVCNSWVYPAEKYTKDRVFFLNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWD  198

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDYAYYNDLG+PD G
Sbjct  199  RVYDYAYYNDLGNPDMG  215



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   280 bits (715),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  E A
Sbjct  20   RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L  G+SA+ + F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80   YLEDWITTITPLTVGDSAYNVTFDWEEEIGVPGAILIKNNHHSEFFLKTVTLEDVPREGR  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  140  VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWDR  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG++
Sbjct  200  VYDYAYYNDLGNPDKGSK  217



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   280 bits (715),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  N  KGK  E A
Sbjct  20   RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENRFKGKLGEPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80   YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  140  VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG++
Sbjct  200  VYDYAYYNDLGNPDKGSK  217



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G G+L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            ++KIKG VVL++KNVLDFND NAS++D + + LGQ+VSL+L+S+   D  NG KGK  E 
Sbjct  72   SRKIKGTVVLIKKNVLDFNDINASVLDRVHELLGQRVSLQLISADHGDSENGFKGKLGEP  131

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  132  AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  191

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  192  RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWD  251

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDKG++
Sbjct  252  RVYDYAYYNDLGNPDKGSK  270



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            I+G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG+KGK  + AYL
Sbjct  16   IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  409  DHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            + W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+LTLE+VP HG 
Sbjct  76   EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G L+EWDR
Sbjct  136  IHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRGDGKGTLQEWDR  195

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLGDPDKGA+
Sbjct  196  VYDYAYYNDLGDPDKGAQ  213



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            I+G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG+KGK  + AYL
Sbjct  16   IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  409  DHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            + W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+LTLE+VP HG 
Sbjct  76   EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G L+EWDR
Sbjct  136  IHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRGDGKGTLQEWDR  195

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLGDPDKGA+
Sbjct  196  VYDYAYYNDLGDPDKGAQ  213



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEAA  416
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V+AD   NGLKGK  + A
Sbjct  20   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVRADDSENGLKGKLGKPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80   YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGH  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EW+R
Sbjct  140  VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLQKYREEELVHLRGDGKGELQEWER  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG PDKGA+
Sbjct  200  VYDYAYYNDLGKPDKGAK  217



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WD
Sbjct  137  KVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLRKYRENELLTLRGDGTGKLEAWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA+YNDLGDPD+GA+
Sbjct  197  RVYDYAFYNDLGDPDQGAQ  215



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 160/200 (80%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKGKVVLM+KNVLDFNDF  S++D + + LGQKVSL+L+SS+  D  N LKGK   AA
Sbjct  19   KKIKGKVVLMKKNVLDFNDFGGSVLDRVHELLGQKVSLQLISSINGDPENKLKGKLGRAA  78

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVP-NH  242
            YL+ W+   T L  G+SAF + F+W E+  G+P AFII+N H  EFYLKTLTLEDVP +H
Sbjct  79   YLEDWITTFTSLTPGDSAFHVTFDWEEEEIGIPGAFIIQNFHHTEFYLKTLTLEDVPGHH  138

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYPA KY  +R+FF+N+ YLPS+TP PL KYR+EELV+LRG G+G+L+EW
Sbjct  139  GPIHFVCNSWVYPAEKYKTDRVFFTNKTYLPSETPEPLVKYREEELVNLRGNGSGQLEEW  198

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKG++
Sbjct  199  DRVYDYAYYNDLGDPDKGSD  218



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VPN G V
Sbjct  82   LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPNEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G  +L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   277 bits (709),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKGK  + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGKLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWISTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G  +L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +K+KG+VVLM+KNVLDF D  AS++D + +FLGQ+VS EL+S+   D  NGL+GKRS+ A
Sbjct  17   EKVKGRVVLMKKNVLDFTDVTASVLDGVLEFLGQRVSFELISTSLHD-ENGLEGKRSKPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+HW+   T +A+GESAF + F+W  E+ GVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76   YLEHWLTNITPIAAGESAFSVTFDWDHEELGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPASKY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136  KIHFVCDSWVYPASKYKSDRIFFANQAYLPSETPEALRKYRENELVTLRGDGTGKLEEWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG PD G E
Sbjct  196  RVYDYAYYNDLGYPDNGEE  214



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA  Y  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G G+L+EWDRV
Sbjct  142  HFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA  Y  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G G+L+EWDRV
Sbjct  142  HFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ D   G +GK    A
Sbjct  15   KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGDPEKGFQGKLGNPA  74

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  75   YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  134

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  135  VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  194

Query  55   VYDYAYYNDLGDPDKG  8
            VYDYAYYNDLG+PDKG
Sbjct  195  VYDYAYYNDLGNPDKG  210



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   277 bits (708),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFKI F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTITPLTAGESAFKITFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGHV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G  +L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G  +L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEA  419
            KKIKG VVLM+KNVLDFNDFNASI+D + + LGQKVSL+L+S+V ADL   GLKGK  + 
Sbjct  17   KKIKGTVVLMKKNVLDFNDFNASILDRVHELLGQKVSLQLISAVNADLTVKGLKGKLGKP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SA+ + F+W E+ GVP AFII+N H +EFYLK+LTL+ VP HG
Sbjct  77   AYLEDWITTITPLTAGDSAYDVTFDWDEEIGVPGAFIIRNFHHSEFYLKSLTLDHVPGHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA  Y  +R+FFSNQ YL S+TPAPL +YR +ELV+LRG G G+L+EWD
Sbjct  137  RVHFVCNSWVYPAKNYKTDRVFFSNQTYLLSETPAPLIEYRKQELVNLRGDGKGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG++
Sbjct  197  RVYDYAYYNDLGDPDKGSK  215



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  NGLKG   + AY
Sbjct  22   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+TL++VP+ G V
Sbjct  82   LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG G  +L+EWDRV
Sbjct  142  HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG+E
Sbjct  202  YDYAYYNDLGDPDKGSE  218



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEAA  416
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD   NGLKGK  + A
Sbjct  20   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHADDSENGLKGKLGQPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80   YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP  KY  +R+FF N+ YLPS+TP PL+KY +EELVHLRG G GEL+EW+R
Sbjct  140  VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLRKYIEEELVHLRGDGKGELQEWER  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG PDKGA+
Sbjct  200  VYDYAYYNDLGKPDKGAK  217



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ +   G +GK  + A
Sbjct  105  KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGEPEKGFQGKLGKPA  164

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  165  YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  224

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  225  VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  284

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG +
Sbjct  285  VYDYAYYNDLGNPDKGPK  302



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 158/202 (78%), Gaps = 2/202 (1%)
 Frame = -2

Query  601  PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  428
            P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19   PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  427  SEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  248
             + AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79   GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  247  NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELK  68
              G + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+
Sbjct  139  GQGVIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQ  198

Query  67   EWDRVYDYAYYNDLGDPDKGAE  2
            EWDRVYDYA YNDLG+PDKG +
Sbjct  199  EWDRVYDYALYNDLGNPDKGPQ  220



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   275 bits (703),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KI+G VVLM+KN+LDFND +AS++D   + LG+ V+L+L+SSV AD  NG++GK  +AAY
Sbjct  27   KIRGTVVLMKKNLLDFNDLHASVLDRFDELLGEGVALQLISSVNADPVNGMRGKVGKAAY  86

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +G S+FK+ F+W  D GVP AFIIKN H +EF+LKT+TLEDVP  G +
Sbjct  87   LEEWITTVTPLTAGASSFKVTFDWDADIGVPGAFIIKNFHHSEFFLKTVTLEDVPGVGRL  146

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SW+YPA +Y  +R+FF+NQ+YLP++TP PL+KYR+EELV+LRG GT EL+EWDRV
Sbjct  147  HFLCNSWIYPAKRYKNDRVFFTNQSYLPAKTPEPLRKYREEELVNLRGDGTEELQEWDRV  206

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLGDPDKG E
Sbjct  207  YDYAYYNDLGDPDKGPE  223



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 158/202 (78%), Gaps = 2/202 (1%)
 Frame = -2

Query  601  PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  428
            P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19   PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  427  SEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  248
             + AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79   GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  247  NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELK  68
              G + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+
Sbjct  139  GQGVIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQ  198

Query  67   EWDRVYDYAYYNDLGDPDKGAE  2
            EWDRVYDYA YNDLG+PDKG +
Sbjct  199  EWDRVYDYALYNDLGNPDKGPQ  220



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   275 bits (702),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   275 bits (702),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  + AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA+YNDLG+PDKG E
Sbjct  216  YDYAFYNDLGNPDKGPE  232



>ref|XP_006838255.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
 gb|ERN00824.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
Length=259

 Score =   258 bits (659),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            +KG VVL +KNVLDFNDF+ S +D+L +FLG++VSL LVS+  AD   GLKGK  +AAYL
Sbjct  22   MKGSVVLQKKNVLDFNDFHVSFLDSLHEFLGKRVSLHLVSATHADPERGLKGKLGKAAYL  81

Query  409  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  230
            + W  K   LA GE+ F ++FEW E FG P AF+I+N H  +FYLK+LTL  VP  G VH
Sbjct  82   EEWGKKQVGLAVGEAQFTVDFEWDESFGTPGAFVIRNEHHGQFYLKSLTLHHVPGKGRVH  141

Query  229  FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVY  50
            F C SWVYP+ KY  +RIFFSN++YLP +TP  LK  R+EEL++LRG G GELKEWDRVY
Sbjct  142  FVCNSWVYPSKKYTSDRIFFSNESYLPGETPLALKNLREEELLNLRGNGVGELKEWDRVY  201

Query  49   DYAYYNDLGDPDKGAE  2
            DYAYYNDLG PD G +
Sbjct  202  DYAYYNDLGKPDDGPD  217



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
             KKI G VVLM+KNVLDFNDF+AS++D + +  G  VSL+L+SSV ++  NGL+GK  E 
Sbjct  26   CKKITGSVVLMKKNVLDFNDFHASLLDRVHELFGHGVSLQLISSVTSESENGLQGKVGEP  85

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+     L  G+SAFK+ F+W+E+ G+P AFIIKNNH +EFYLKTLTLEDVP  G
Sbjct  86   AYLEDWITTIAPLTPGDSAFKVTFDWNEEIGIPGAFIIKNNHHSEFYLKTLTLEDVPGQG  145

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SWVYPA  Y  +RIFF+N+ +LP +TP PL+KYR+EEL +LRG G GEL+EWD
Sbjct  146  RIHFVCNSWVYPAKHYKKDRIFFANKTFLPHETPMPLRKYREEELENLRGDGKGELQEWD  205

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDYAYYNDLGDP KG
Sbjct  206  RVYDYAYYNDLGDPKKG  222



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 163/200 (82%), Gaps = 5/200 (3%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSEA  419
            +K+KG+V+LM+KNVLDF D +AS+VD ++D LGQKVS++L+S SV AD   GL+GKRS+ 
Sbjct  17   EKVKGRVILMKKNVLDFTDISASVVDGVADLLGQKVSIQLISGSVNAD---GLEGKRSKP  73

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL+ W+   T + +GES F + F+W  ++FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  74   AYLESWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNH  133

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYP+ +Y  +RIFF+NQAYLPS+TP PL+ YR+ ELV LRG GTG+L+EW
Sbjct  134  GNIHFVCNSWVYPSFRYKSDRIFFANQAYLPSETPEPLRNYRENELVVLRGDGTGKLEEW  193

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYA YNDLGDPDKG E
Sbjct  194  DRVYDYACYNDLGDPDKGEE  213



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 159/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S    +  +GL+GK S  AY
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISG-SVNYADGLEGKLSNPAY  76

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T + +GES F + F+W ++FGVP AFIIKN H NEF+LK+LTLEDVPN+G++
Sbjct  77   LESWLTDITPITAGESTFSVTFDWDDEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNYGKI  136

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRV
Sbjct  137  HFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWDRV  196

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA YNDLGDPDKG E
Sbjct  197  YDYACYNDLGDPDKGEE  213



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNL  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WD
Sbjct  137  TVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEAWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLGDPD+GA+
Sbjct  197  RVYDYALYNDLGDPDQGAQ  215



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17   TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AA+L+ W+ + T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77   KAAHLEDWITRITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137  HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVDLRGTGEGELKE  196

Query  64   WDRVYDYAYYNDLGDPDK  11
            WDRVYDYAYYNDLG P K
Sbjct  197  WDRVYDYAYYNDLGVPPK  214



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   ++VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGAVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WD
Sbjct  137  TVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEAWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLGDPD+GA+
Sbjct  197  RVYDYALYNDLGDPDQGAQ  215



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TK+I G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD  NGLKGK  + 
Sbjct  19   TKQITGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVNADSDNGLKGKLGKP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +G+SA+K+ F+W ++ GVP A +IKNNH ++FYLKT+TLE+VP  G
Sbjct  79   AYLEDWISTITPLTAGDSAYKVTFDWDDEIGVPGAILIKNNHHSQFYLKTITLENVPGEG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA K   +RIFF N+ YL S TP PL++YR EELVHLRG G GEL+E+D
Sbjct  139  TVHFVCNSWVYPAEKNTKDRIFFVNKTYLLSDTPLPLQQYRKEELVHLRGDGKGELQEYD  198

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG+PDKG++
Sbjct  199  RVYDYAYYNDLGNPDKGSD  217



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 154/201 (77%), Gaps = 0/201 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            S + KIKG VVLM+KNVLDFNDF AS++D + + LG++VSL+L+S+ + D  NGL+GK  
Sbjct  20   SSSGKIKGTVVLMKKNVLDFNDFQASVLDGVHELLGKRVSLQLISAEKGDAANGLQGKLG  79

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + AYLD+W L +    +GES F + F+W E+ G P   +IKNNH +EFYLKT++LE VP+
Sbjct  80   KPAYLDNWTLTDASPVAGESKFSVNFDWDEEIGTPGGLLIKNNHHSEFYLKTVSLEHVPD  139

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VHF C SWVYP  KY  +RIFFSN+ YLP + P PL+KYR+EEL  LRG G GEL+E
Sbjct  140  HGPVHFVCNSWVYPGKKYEKDRIFFSNKTYLPHEMPEPLRKYREEELRALRGNGEGELQE  199

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVYDYAYYNDLG+PDKG E
Sbjct  200  WDRVYDYAYYNDLGNPDKGPE  220



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRS  425
             KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  
Sbjct  32   CKKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIG  91

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP 
Sbjct  92   KLAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPG  151

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
             G VHF C SWVYPA  YN +RIFF+N+ YLP+QTP PL+ YR++ELV+LRG GT EL+E
Sbjct  152  EGRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDGTTELQE  211

Query  64   WDRVYDYAYYNDLGDPDKG  8
             DRVYDYAYYNDLGDP KG
Sbjct  212  HDRVYDYAYYNDLGDPKKG  230



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17   TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77   KAAHLEDWITPITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137  HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKE  196

Query  64   WDRVYDYAYYNDLGDPDK  11
            WDRVYDYAYYNDLG P K
Sbjct  197  WDRVYDYAYYNDLGVPPK  214



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
             KKIKG VVLM+KNVLDFNDFNAS +D + +  G  VSL+L+SSV ++  NGL+GK  E 
Sbjct  26   CKKIKGTVVLMKKNVLDFNDFNASFLDGIHELAGHGVSLQLISSVNSEPENGLQGKVGEP  85

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A L+ W+   T    G+SAF++ F+W ++ G+P AFII+NNH +EFYLKTLTLEDVP  G
Sbjct  86   ALLEDWITTFTPATPGDSAFRVTFDWDDEIGIPGAFIIRNNHHSEFYLKTLTLEDVPGQG  145

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SWVYPA +Y  +R+FF+N+AYLP +TP PL+KYR+EELV LRG G  ELKEWD
Sbjct  146  RIHFVCNSWVYPAKRYKKDRVFFTNKAYLPHETPMPLRKYREEELVSLRGDGKAELKEWD  205

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDL DPDKG +
Sbjct  206  RVYDYACYNDLADPDKGPK  224



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKR  428
            S ++KI+G VVLM+KNVLDFNDF+AS++D + + LG+ VSL+LVS+V AD   NGL GK 
Sbjct  25   SQSRKIQGTVVLMKKNVLDFNDFHASLLDRVHELLGKGVSLQLVSAVHADSQANGLGGKV  84

Query  427  SEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  248
             E AYL  W+ K T LA+GESAFK+ F+  E+ GVP AFI+KNNH +EFYLKTLTL+DVP
Sbjct  85   GEPAYLKDWITKITPLAAGESAFKVTFDADEEIGVPGAFIVKNNHHSEFYLKTLTLDDVP  144

Query  247  NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG-EL  71
             HG +HF C SWVYPA  Y Y+R+FF+NQ YLPS+ P PL+ YR++EL++LRG G+  EL
Sbjct  145  RHGRMHFVCNSWVYPAKYYKYDRVFFTNQTYLPSEMPPPLRYYREQELLNLRGDGSDEEL  204

Query  70   KEWDRVYDYAYYNDLGDPDKGAE  2
             E+DRVYDYAYYNDLG+PDKGA+
Sbjct  205  NEYDRVYDYAYYNDLGNPDKGAK  227



>emb|CAA64767.1| lipoxygenase [Solanum tuberosum]
Length=454

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 156/200 (78%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ D  NGL+GK+S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKMFEVLGQKVSFQLISSVQGDPTNGLQGKQSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDEGKE  215



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 159/199 (80%), Gaps = 2/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17   EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T + +GES F + F+W +D FGVP AFIIKN H +EF+LK+LTLE VPNHG
Sbjct  76   YLENWITNITPVVAGESTFSVTFDWDDDEFGVPGAFIIKNLHFSEFFLKSLTLEHVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPASKY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136  KVHFVCNSWVYPASKYKSDRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEEWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  196  RVYDYAYYNDLGDPDKGQE  214



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17   EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  76   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  136  KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  196  RVYDYAYYNDLGDPDKGEE  214



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  +AA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA +Y  +R+FFSN+ YLP +TP PL KYR+EELV LRGTG GELKEWDRV
Sbjct  138  HYICNSWVYPAKRYTKDRVFFSNKTYLPRETPEPLLKYREEELVSLRGTGEGELKEWDRV  197

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLG P K
Sbjct  198  YDYAYYNDLGVPPK  211



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD---LGNGLKGKRS  425
            KKIKG+VVLM+KNVLDFNDF+A+I+D + +  GQKVSL+LV++V  D      GL+G+  
Sbjct  17   KKIKGRVVLMKKNVLDFNDFHANILDGVHELFGQKVSLQLVTAVHGDGHHPDKGLEGRLG  76

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
              AYL+ WV   T+L +GESAF +EF+W E+ GVP AFI+KN H +EFYLKTLT+E VP 
Sbjct  77   NPAYLEDWVRTGTILDAGESAFDVEFDWDEELGVPGAFIVKNFHHSEFYLKTLTIEHVPG  136

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VHF C SWVYP  KY  +R+FF NQ YLPS+TP  L+KYR+EELV LRG G GELKE
Sbjct  137  HGRVHFICNSWVYPTDKYKKDRVFFVNQTYLPSETPTALRKYREEELVELRGDGNGELKE  196

Query  64   WDRVYDYAYYNDLGDPDKGA  5
            WDRVYDYA YNDLG PD G+
Sbjct  197  WDRVYDYALYNDLGVPDLGS  216



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D L + LGQKVSL+L+SSVQ D  NGL+GK S  
Sbjct  15   SKKVKGTVVMMKKNALDFTDLAGSLTDKLFEALGQKVSLQLISSVQGDPANGLQGKHSNP  74

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++++   T L +GESAF + F+W+E+FGVP AF IKN+H NEF+LK+L LEDVPNHG
Sbjct  75   AYLENFLFTPTRLTAGESAFGVTFDWNEEFGVPGAFTIKNSHINEFFLKSLILEDVPNHG  134

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP PL+KYR+ EL  LRG GTG+L+ W+
Sbjct  135  KVHFVCNSWVYPSFRYKTDRIFFANQPYLPSETPEPLRKYRESELKTLRGDGTGKLEAWN  194

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDY  YNDLG+PD+G E
Sbjct  195  RVYDYDVYNDLGNPDQGPE  213



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L++FLG KV+L L+SS  AD GNG KGK  + A+
Sbjct  20   KVKGTVVLMKKNVLDFNDFNASFLDRLTEFLGNKVTLRLISSDVADSGNGSKGKLGKPAH  79

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++   FG P AF I+N+H +EFYLK+LTLEDVP HG V
Sbjct  80   LEEWITTITPLTAGESAFKVTFDYENGFGFPGAFAIRNDHFSEFYLKSLTLEDVPGHGRV  139

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+  Y  +R+FFSN+ YLPSQTP PL +YR++ELV LRGTG GELKE DRV
Sbjct  140  HFLCNSWVYPSHTYEKDRVFFSNKTYLPSQTPEPLVQYREKELVSLRGTGKGELKEGDRV  199

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLGDP K
Sbjct  200  YDYAYYNDLGDPPK  213



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = -2

Query  568  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEAAYLDHWVLK  392
            M+KNVL FNDF+AS++D + + LGQ+VSL+L+S+V +D   N LKGK  E AYL+ WV  
Sbjct  1    MKKNVLGFNDFHASVLDRVHELLGQRVSLQLISAVNSDRSDNDLKGKLGEPAYLEEWVTT  60

Query  391  NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  212
             T L +GE+AFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLE VP HG VHF C SW
Sbjct  61   VTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLSEFYLKTVTLEGVPGHGRVHFVCNSW  120

Query  211  VYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYN  32
            +Y A +YN +R+FF+NQ ++P +TP PL+KYR+EELVHLRG G GELKEWDRVYDYAYYN
Sbjct  121  IYHAKRYNKDRVFFTNQTFMPHETPTPLRKYREEELVHLRGNGEGELKEWDRVYDYAYYN  180

Query  31   DLGDPDKG  8
            DLGDPDKG
Sbjct  181  DLGDPDKG  188



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSEAA  416
            KI G VVLM+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + A
Sbjct  121  KINGTVVLMKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPA  180

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  181  YLEDWITTITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  240

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VH  C SWVYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  241  VHIVCNSWVYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  300

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG PD+GA+
Sbjct  301  VYDYAYYNDLGKPDEGAK  318



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17   TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77   KTAHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137  HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKE  196

Query  64   WDRVYDYAYYNDLGDPDK  11
            WDRVYDYAYYNDLG P K
Sbjct  197  WDRVYDYAYYNDLGVPPK  214



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  
Sbjct  16   TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLG  75

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP 
Sbjct  76   KAAHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPG  135

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  136  HGRVHYICNSWIYPAKHYTTDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKE  195

Query  64   WDRVYDYAYYNDLGDPDK  11
            WDRVYDYAYYNDLG P K
Sbjct  196  WDRVYDYAYYNDLGVPPK  213



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKGKVVLM+KNVLDFND  AS  D + +  G+ VS++L+S+V  D  N L+GK  + A+
Sbjct  21   KIKGKVVLMKKNVLDFNDVTASCFDRIHELFGKGVSIQLISAVNPDPENDLRGKHGKVAF  80

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ WV K T +A+ E+ F I F+W E   VP AFII+N+H ++ YLKT+TLEDVP HG V
Sbjct  81   LESWVKKITPMAAQETEFNITFDWDESMAVPGAFIIRNHHHSQLYLKTVTLEDVPGHGRV  140

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA +Y Y+R+FFSN+ YLP QTP  L+KYR+EEL++LRG G GELKEWDRV
Sbjct  141  HFVCNSWVYPAHRYKYDRVFFSNKTYLPCQTPESLRKYREEELINLRGNGKGELKEWDRV  200

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLG PDKG E
Sbjct  201  YDYAYYNDLGSPDKGKE  217



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++++L  T LA+GE+AF + F+W+E+FGVP AF+IKN H NEF+LK+LTLEDVPNHG
Sbjct  76   AYLENFLLTLTPLAAGETAFGVTFDWNEEFGVPGAFVIKNMHINEFFLKSLTLEDVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ ELV LRG GTG+ + WD
Sbjct  136  KVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELVTLRGDGTGKREAWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            R+YDY  YNDLG+PD+G E
Sbjct  196  RIYDYDVYNDLGNPDQGKE  214



>ref|XP_006850111.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
 gb|ERN11692.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
Length=618

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 151/197 (77%), Gaps = 0/197 (0%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            S T  I+G +VL +KNVLDFNDF+ S +DNL +FLG++VSL+LVS+  AD   GLKGK  
Sbjct  21   SSTTMIEGWLVLKKKNVLDFNDFHLSFLDNLDEFLGKRVSLQLVSATHADPERGLKGKLG  80

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AAYL+ W  K+  LA GE+ F + FEW E FG+P  FII+N H  EFYLK LTL  VP 
Sbjct  81   KAAYLEEWSKKHDGLAVGEAQFIVNFEWDESFGIPGGFIIRNEHHAEFYLKALTLHHVPG  140

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
             G VHF C SWVYPA KYN +R+FFSN++YLPS+TP  LKK R+EEL++LRG G GELKE
Sbjct  141  KGRVHFVCNSWVYPAKKYNSDRVFFSNESYLPSETPLALKKLREEELLNLRGNGVGELKE  200

Query  64   WDRVYDYAYYNDLGDPD  14
            WDRVYDYAYYNDLG+PD
Sbjct  201  WDRVYDYAYYNDLGNPD  217



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   268 bits (686),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSEA  419
            K +KG+++LM+K  LDF D NAS+ D + DFLG+KVS++L+S S+  D  NG++GKRS  
Sbjct  17   KNVKGRIILMKKIFLDFTDINASVGDEVVDFLGEKVSIQLISGSIHDDPENGVEGKRSNP  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL+ W+   T + +GES F + F+W  ++FGVP AFII N H NEF+LK+LTLEDVPN 
Sbjct  77   AYLEDWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIINNFHLNEFFLKSLTLEDVPNR  136

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EW
Sbjct  137  GNIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPEPLRKYRENELVTLRGDGTGKLEEW  196

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLGDPDKG E
Sbjct  197  DRVYDYAYYNDLGDPDKGEE  216



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  + A
Sbjct  34   RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQDPADGLRGKLGKVA  93

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  94   YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  153

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP  +Y Y+R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  154  VHFICNSWVYPTHRYKYDRVFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  213

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY YYNDLG PDKG E
Sbjct  214  VYDYDYYNDLGSPDKGEE  231



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRS  425
             KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  
Sbjct  32   CKKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIG  91

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP 
Sbjct  92   KLAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPG  151

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
             G VHF C SWVYPA  YN +RIFF+N+ YLP+QTP PL+ YR++ELV+LRG  T EL+E
Sbjct  152  EGRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDVTTELQE  211

Query  64   WDRVYDYAYYNDLGDPDKG  8
             DRVYDYAYYNDLGDP KG
Sbjct  212  HDRVYDYAYYNDLGDPKKG  230



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  76   AYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + WD
Sbjct  136  KVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAWD  195

Query  58   RVYDYAYYNDLGDPDKGAE  2
            R+YDY  YNDLG+PD+G E
Sbjct  196  RIYDYDVYNDLGNPDQGKE  214



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 159/199 (80%), Gaps = 5/199 (3%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSEAA  416
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75   YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWD
Sbjct  135  KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWD  194

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLG+PDKG E
Sbjct  195  RVYDYACYNDLGEPDKGEE  213



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 159/199 (80%), Gaps = 5/199 (3%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSEAA  416
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75   YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWD
Sbjct  135  KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWD  194

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLG+PDKG E
Sbjct  195  RVYDYACYNDLGEPDKGEE  213



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            + IKG+VVLM+KNVLDFND  AS++D   + +G KVSL+L+SSV  D  N +KGK  +AA
Sbjct  23   RIIKGRVVLMKKNVLDFNDLAASVLDRFHELVGHKVSLQLISSVNTDSENRVKGKVGKAA  82

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH-G  239
            YL+ W+   T L  G+SAF + F+W E+ GVP AFII N H +EFYLKTLTLE VP H G
Sbjct  83   YLEKWITTFTSLTPGDSAFDVSFDWEEEVGVPGAFIINNLHHSEFYLKTLTLEHVPGHSG  142

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SW+YPA KY   R+FF+N++YLPS+TPAPL  YR+EELV+LRG G+G+L+EWD
Sbjct  143  PLHFVCNSWIYPADKYKTHRVFFTNKSYLPSETPAPLLPYREEELVNLRGDGSGQLEEWD  202

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG +
Sbjct  203  RVYDYAYYNDLGDPDKGQD  221



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  +A
Sbjct  16   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKLGKA  75

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A+L+ W+   T L +GESAFK+ F++  +FG P AF+IKN+H +EF L++LTLEDVP HG
Sbjct  76   AHLEDWITTITSLTAGESAFKVTFDYESNFGYPGAFLIKNSHFSEFLLRSLTLEDVPGHG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWD
Sbjct  136  RVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKEWD  195

Query  58   RVYDYAYYNDLGDPDK  11
            RVYDYAYYNDLG P K
Sbjct  196  RVYDYAYYNDLGVPPK  211



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -2

Query  577  VVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYLDHWV  398
            VVLM+KNVLDFND +AS++D + + +G+ V+L+L+SSV  D  NGL+GK  + AYL+ W+
Sbjct  43   VVLMKKNVLDFNDLHASVLDRVHELVGKGVALQLISSVNTDPANGLRGKLGKEAYLEEWI  102

Query  397  LKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACF  218
               T L++GES+F I F+W E  GVP AFII+N H ++F+LKT+TLEDVP  G VHF C 
Sbjct  103  TTITPLSAGESSFNITFDWDEGIGVPGAFIIRNFHHSQFFLKTVTLEDVPGVGRVHFICN  162

Query  217  SWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAY  38
            SWVYP   Y Y+R+FFSNQ YLP+ TP PL+KYR+EE+V+LRG GTGEL+EWDRVYDYAY
Sbjct  163  SWVYPTKHYKYDRVFFSNQTYLPANTPEPLRKYREEEIVNLRGDGTGELQEWDRVYDYAY  222

Query  37   YNDLGDPDKGAE  2
            YNDLG+PDKG +
Sbjct  223  YNDLGNPDKGPD  234



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  13   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  72

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  73   AYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHG  132

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + WD
Sbjct  133  KVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAWD  192

Query  58   RVYDYAYYNDLGDPDKGAE  2
            R+YDY  YNDLG+PD+G +
Sbjct  193  RIYDYDVYNDLGNPDQGEQ  211



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D+L +FLG KV+L L+SS  AD  NG KGK  + A+
Sbjct  20   KVKGMVVLMKKNVLDFNDFNASFLDHLHEFLGNKVTLRLISSDVADSENGSKGKLGKPAH  79

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L  GESAFK+ F+    FG P AF I+NNH +EFYLK+LTLEDVP HG V
Sbjct  80   LEDWITTVTPLTVGESAFKVTFDCENGFGFPGAFTIRNNHFSEFYLKSLTLEDVPGHGTV  139

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA  Y  +R+FF N+ YLPSQTP PL  YR+EELV LRGTG GELKEWDRV
Sbjct  140  HFVCNSWVYPAKNYKKDRVFFCNKTYLPSQTPEPLLTYREEELVALRGTGEGELKEWDRV  199

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLG P K
Sbjct  200  YDYAYYNDLGVPPK  213



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  +AA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA +Y  +R+FFSN+ YLP +TP  L KYR+EELV LRGTG GELKEWDRV
Sbjct  138  HYICNSWVYPAKRYTKDRVFFSNKTYLPHETPEALLKYREEELVSLRGTGEGELKEWDRV  197

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLG P K
Sbjct  198  YDYAYYNDLGVPPK  211



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 0/197 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++L+S+V  D  N L+GK  + AY
Sbjct  22   KIKGTVVLMKKNVLDFSDIKASFLDRVHELLGKGVSMQLISAVHHDPANKLRGKLGKVAY  81

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ WV   T + + ++ F I F+W E  GVP AFII+N+H ++ YLKT+TL+DVP HG V
Sbjct  82   LEKWVRSITPITAVDTVFNITFDWDESMGVPGAFIIRNHHHSQLYLKTVTLDDVPGHGRV  141

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA  YNY+R+FFSN+ YLP QTP PL+KYR+EEL++LRG G G+L+EWDRV
Sbjct  142  HFVCNSWVYPAHCYNYDRVFFSNKTYLPCQTPKPLRKYREEELINLRGNGKGKLEEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLG PDKG E
Sbjct  202  YDYAYYNDLGSPDKGKE  218



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG +V+L+L+SS  +D  NG KGK  +AA+
Sbjct  17   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNRVTLQLISSDLSDPENGAKGKLGKAAH  76

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77   LEDWITTITSLTAGESAFKVTFDYDKDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA  Y  +R+FFSN+ YLP +TP  L KYR+EEL+ LRGTG GELKEWDRV
Sbjct  137  HYVCNSWVYPAKNYTKDRVFFSNKTYLPHETPEGLLKYREEELLSLRGTGEGELKEWDRV  196

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLG P K
Sbjct  197  YDYAYYNDLGVPPK  210



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDFND  AS +D + + LG+ VS++LVS+V  D  +GL+GK  + A
Sbjct  34   RKIKGTVVLMKKNVLDFNDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P HG 
Sbjct  93   YLEKWVTTITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGHGR  152

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP  +Y Y+R FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153  VHFICNSWVYPTHRYKYDRAFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  212

Query  55   VYDYAYYNDLGDPDKG  8
            VYDY YYNDLG PDKG
Sbjct  213  VYDYDYYNDLGSPDKG  228



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 158/205 (77%), Gaps = 3/205 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  437
            +S   +I+GK+VLM+KNVLDFND  AS+VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  27   VSGGNRIRGKLVLMKKNVLDFNDLKASVVDRIHELLGKGVSMQLISATHPEPAANGLKSR  86

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  E AYL+ WV   T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  87   GKLGEVAYLEKWVTTTTSLSAGEASFSISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  146

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPS+TP  L  YR++ELV+LRG+G+G
Sbjct  147  DVPGHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSKTPELLHPYREDELVNLRGSGSG  206

Query  76   ELKEWDRVYDYAYYNDLGDPDKGAE  2
            ELKEWDRVYDYAYYNDLG PDKG E
Sbjct  207  ELKEWDRVYDYAYYNDLGSPDKGPE  231



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  +A +
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTDPADGSKGKLGKAGH  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWDRV
Sbjct  138  HYLCNSWVYPAKNYAKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGKGELKEWDRV  197

Query  52   YDYAYYNDLGDP  17
            YDYAYYNDLG P
Sbjct  198  YDYAYYNDLGVP  209



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEAA  416
            KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  + A
Sbjct  20   KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGTAKSDPPENGLKEKLGKPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
             L++W+     L +GE+ FK+ F+W E+ G+P A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80   NLENWITTIDPLIAGETEFKVTFDWDEEIGIPVALLIRNNHHSEFYLKTVTLEDVPGQGR  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SW+YPA +YNY+R+FF+N+ +LP   PAPL+KYR+EELV LRG G GELKEWDR
Sbjct  140  VHFVCNSWIYPAKRYNYDRVFFTNKTHLPQDAPAPLRKYREEELVKLRGDGKGELKEWDR  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLGDPD+GA+
Sbjct  200  VYDYAYYNDLGDPDEGAK  217



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  +AA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA +Y  +R+FFSN+ YLP +TP  L KYR+EELV LRGTG GELKEWDRV
Sbjct  138  HYICNSWVYPAKRYTKDRVFFSNKTYLPHETPEALLKYREEELVSLRGTGEGELKEWDRV  197

Query  52   YDYAYYNDLGDPDK  11
            YDYAYYNDLG P K
Sbjct  198  YDYAYYNDLGVPPK  211


 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = -2

Query  493  KVSLELVSSVQADLG-NGLKGKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPA  317
            ++     S +  DL  NG  GK  +AA+L+ W+   T L +GESAFK+  ++ +DFG P 
Sbjct  396  RIHTSFNSLIHCDLAENGSNGKLGKAAHLEDWITTITSLTAGESAFKVRIDYDQDFGYPG  455

Query  316  AFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTP  137
            AF+I+N+H +EFYLK+LTLEDVP HG VH+ C SWVYPA +Y  +R+FFSN+ YLP +TP
Sbjct  456  AFLIRNSHFSEFYLKSLTLEDVPGHGRVHYICNSWVYPAKRYTKDRVFFSNKTYLPHETP  515

Query  136  APLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             PL KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K
Sbjct  516  EPLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPK  557



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  + A
Sbjct  34   RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  93   YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  152

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP  +Y Y+R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153  VHFICNSWVYPTHRYKYDRVFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  212

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY YYNDLG PDKG E
Sbjct  213  VYDYDYYNDLGSPDKGEE  230



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG--NGLKGKRSEA  419
            ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVS+V  D G  NGLKGK  + 
Sbjct  18   RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSAVNVDSGDSNGLKGKLGKP  77

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A+L+ W+     L  GE+AFK+ FEW E+   P AFII+NNH +EFYLK+LTLEDVP  G
Sbjct  78   AHLEDWITTIAPLTVGETAFKVTFEWDEEIRTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  137

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+EWD
Sbjct  138  VIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQEWD  197

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDY  YNDLG+PDKG +
Sbjct  198  RVYDYDLYNDLGNPDKGPQ  216



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G V LM+KNVLD ND  AS++D + +  G+ VSL+LVS+V +D  NG +GK  + A
Sbjct  51   KKIRGTVKLMKKNVLDMNDMKASLLDRIHELFGKGVSLQLVSAVHSDPSNGSRGKLGKVA  110

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L +GE+ F + F+W +  G+P AFII+N+H ++FYLKT+TLEDVP HG 
Sbjct  111  YLEKWIRKITSLTAGEAEFGVTFDWDKSMGIPGAFIIRNHHHSQFYLKTVTLEDVPGHGP  170

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            V F C SWVYP+ +Y Y+R+FFSN+ YLP QTP  L KYR+EELV+L+G+G+GELKEWDR
Sbjct  171  VKFVCNSWVYPSHRYMYDRVFFSNKTYLPCQTPLALLKYREEELVNLQGSGSGELKEWDR  230

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG PDKG +
Sbjct  231  VYDYAYYNDLGSPDKGPD  248



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TKKIKG VVLM+KNVLDFND  AS++D + +  G+ VS++++SSV  D  NG +GK  + 
Sbjct  36   TKKIKGTVVLMKKNVLDFNDIKASLLDRIHELFGKVVSMQIISSVLPDPENGFRGKLGKV  95

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   +  A+ E+ F + FEW E  G+P AFIIKN+H ++F+LKT+TLEDVP HG
Sbjct  96   AYLEKWISTISPTAARETQFTVTFEWGETMGLPGAFIIKNHHHSQFFLKTVTLEDVPGHG  155

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYP  +Y Y R+FFS++ YLP QTP  L+ YR+EEL +LRG GTGELKEWD
Sbjct  156  RVHFVCNSWVYPTHRYKYNRVFFSSKTYLPCQTPDLLRYYREEELKNLRGNGTGELKEWD  215

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG PDKG +
Sbjct  216  RVYDYAYYNDLGSPDKGPD  234



>emb|CAA64764.1| lipoxygenase [Solanum tuberosum]
Length=447

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQA   NGL+GK S  
Sbjct  12   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQA---NGLQGKHSNP  68

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  69   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  128

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  129  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  188

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  189  DRIYDYDIYNDLGNPDQGKE  208



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 5/199 (3%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11   KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFDD----RGKLSNPA  66

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  67   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  126

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  127  KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  186

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  187  RVYDYAYYNDLGDPDKGEE  205



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 4/199 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11   KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFD---DREGKLSNPA  67

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  68   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  127

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  128  KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  187

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG E
Sbjct  188  RVYDYAYYNDLGDPDKGEE  206



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSEA  419
            KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N LKGK  + 
Sbjct  19   KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDLKGKLGKP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +GE+AF++ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79   AYLEKWITTVTPLTAGETAFQVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SW+YPA  Y+  RIFF+N+ YLP +TPAPL+KYR+EEL HLRG G GELKEWD
Sbjct  139  RVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGELKEWD  198

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDY +YNDLG   KG+E
Sbjct  199  RVYDYDFYNDLGSSKKGSE  217



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 153/200 (77%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV   T L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTITPLTAGEAAFDVTFDWDKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGTE  223



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 155/200 (78%), Gaps = 5/200 (3%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD---LGNGLKGKRS  425
            KKIKG+VVL RK+ LDF  F+ SI+DN+ + LGQKVSL+L+S+V  D    G GL+GK  
Sbjct  28   KKIKGRVVLTRKSELDF--FSDSILDNVHELLGQKVSLQLISAVNGDPPAAGKGLRGKLG  85

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +AAYL+ W+   T+   G+SAF + F+W ++ G+P AF+I+N H  EFYLKTLTL DVP 
Sbjct  86   KAAYLEDWITTITLPGHGDSAFDVAFDWEDEVGLPGAFLIRNLHHTEFYLKTLTLHDVPG  145

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG +HF C SWVYPA +Y  +R+FF+NQ YLP +TPAPL  YR+EELV LRG G+GEL+E
Sbjct  146  HGRLHFVCNSWVYPAHRYKTDRVFFANQTYLPLETPAPLIPYREEELVSLRGDGSGELEE  205

Query  64   WDRVYDYAYYNDLGDPDKGA  5
            WDRVYDYAYYNDLGDPDKG+
Sbjct  206  WDRVYDYAYYNDLGDPDKGS  225



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSEA  419
            KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N  KGK  + 
Sbjct  19   KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDFKGKLGKP  78

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T L +GE+AFK+ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79   AYLEKWITTVTPLTAGETAFKVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SW+YPA  Y+  RIFF+N+ YLP +TPAPL+KYR+EEL HLRG G GELKEWD
Sbjct  139  RVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGELKEWD  198

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDY +YNDLG   KG+E
Sbjct  199  RVYDYDFYNDLGSSKKGSE  217



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 154/201 (77%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  + A
Sbjct  34   KKIKGRVVLMKKNVLDLNDLTASVLDRVDELVGKAVSLQLISSVNGDPEKGSPGKVGKPA  93

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  94   YLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  153

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            +HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+E
Sbjct  154  IHFVCNSWVYPADKYKKDRIFFTNKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQE  213

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVYDYAYYNDLG+PDKG E
Sbjct  214  WDRVYDYAYYNDLGNPDKGQE  234



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   + A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPADSLRGTLGKVA  93

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  94   YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  153

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            + F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  154  LLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  213

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY YYNDLG+PDKG E
Sbjct  214  VYDYDYYNDLGNPDKGEE  231



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSEAA  416
            KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  + A
Sbjct  20   KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGAAKSDPPENGLKEKLGKPA  79

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
             L++W+     L +GE+AFK+ F+W E+ GVP A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80   NLENWITTIDPLIAGETAFKVTFDWDEEIGVPVALLIRNNHHSEFYLKTVTLEDVPGEGR  139

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SW+YPA +Y+Y+R+FF+N+ +LP  +PAPL+KYR+ ELV LRG G GELKEWDR
Sbjct  140  VHFVCNSWIYPAKRYDYDRVFFTNKTHLPQDSPAPLRKYREAELVKLRGDGKGELKEWDR  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLGDPD+G +
Sbjct  200  VYDYAYYNDLGDPDEGTK  217



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            K+IKG+VVLM+K VLDFNDF ASI+D   + LG+KVS +L S+V AD  N  KGK  + +
Sbjct  17   KEIKGRVVLMKKYVLDFNDFTASILDRFDELLGKKVSFQLASAVNADPENESKGKLGKPS  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP-NHG  239
            YL  W+   T L  GESAF I F W ED GVP A +I+N H N+FYLK++TLED P N G
Sbjct  77   YLGDWLTNFTGLTPGESAFSITFAWDEDIGVPGAIVIRNEHQNQFYLKSVTLEDTPDNIG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++HF C SW+YP  +Y  +RIFFSN+ YLP QTPAPL+KYR+EEL  LRG G G+L+EWD
Sbjct  137  KIHFVCNSWIYPTQRYTKDRIFFSNKTYLPHQTPAPLRKYREEELEILRGNGEGKLEEWD  196

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLGDPDKG +
Sbjct  197  RVYDYAYYNDLGDPDKGPK  215



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 144/195 (74%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            +IKG VVLM+KNVLDFNDF AS +D + +FLG+ VS +LVS+   D  NG +GK  EAAY
Sbjct  18   QIKGSVVLMKKNVLDFNDFQASFLDRVHEFLGKGVSFQLVSAEHGDPDNGNRGKVGEAAY  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T + +GES F + F W   FG P A I+KN H +EF+LKTLTLED P    +
Sbjct  78   LEDWITTLTSIQAGESVFNVTFNWDMSFGTPGAVIVKNFHHSEFFLKTLTLEDFPAKDRI  137

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP S Y Y+RIFF N+ YL S  P PL+KYR+EELVHLRG G GELKEWDRV
Sbjct  138  HFVCNSWVYPTSNYKYDRIFFVNKTYLSSDMPEPLRKYREEELVHLRGDGEGELKEWDRV  197

Query  52   YDYAYYNDLGDPDKG  8
            YDYA+YNDLGDPDKG
Sbjct  198  YDYAFYNDLGDPDKG  212



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG+VVLM+KNVLD N   ASI+D + + LG+ VS++L+S+ + D  NG +GK  + A
Sbjct  38   RKIKGRVVLMKKNVLDMNHLGASILDRVHEVLGKGVSIQLISANRGDPANGKRGKLGKTA  97

Query  415  YLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL++W+   T +A+ + A F + FEW E  G+P AFIIKN+H  E YLKT+TLEDVP HG
Sbjct  98   YLENWIATITSVATADDASFNVSFEWDEAMGIPGAFIIKNHHHYEVYLKTVTLEDVPRHG  157

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +VHF C SWVYPA +Y Y+RIFF+N+ YLP QTP PL+ YR++ELV+LRG G+GELK+WD
Sbjct  158  QVHFVCNSWVYPAHRYKYDRIFFTNKTYLPGQTPEPLRDYREQELVNLRGNGSGELKKWD  217

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYN+LG P+KG E
Sbjct  218  RVYDYAYYNNLGMPNKGKE  236



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  37   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEPAANGLKSR  96

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  97   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  156

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  157  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  216

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  217  ELKEWDRVYDYAYYNDLGSPDKG  239



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK+KG VVL++KNVLDFNDFNAS +D L +FL  K++L L+SS   D  NG KGK  +AA
Sbjct  19   KKVKGTVVLIKKNVLDFNDFNASFLDRLHEFLNNKITLRLISSDVTDSANGSKGKLGKAA  78

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP HG 
Sbjct  79   HLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHGR  138

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VH+ C SW+YP+  Y  +R+FFSN+ YLP +TPA L KYR+EEL+ LRGTG GELKEWDR
Sbjct  139  VHYICNSWIYPSKHYTKDRVFFSNKTYLPHETPATLLKYREEELLDLRGTGEGELKEWDR  198

Query  55   VYDYAYYNDLGDP  17
            VYDYAYYNDLG P
Sbjct  199  VYDYAYYNDLGVP  211



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  + AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  62
            HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199  HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  259  DRVYDYAYYNDLGNPDKGQE  278



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +  +KG V+LM+KNVLDFNDFNAS++D L +FLG+ VS +LVS+  AD  NG KGK    
Sbjct  23   STTVKGSVLLMKKNVLDFNDFNASLLDGLHEFLGKGVSFQLVSATVADPHNGNKGKIGPP  82

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+   T +A+GE+ F + F W E  GVP A I+KNNH + FYLKT+TLE VPN  
Sbjct  83   AYLEEWITTMTSVATGETKFTVHFSWDESQGVPGAIIVKNNHHSAFYLKTITLEGVPNKE  142

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEW  62
             +HF C SWVYP  KY Y+RIFF+N  YLPS+TP PLK+YR+EELVHLRG   TGELKE 
Sbjct  143  HIHFVCNSWVYPVDKYKYDRIFFANNTYLPSKTPEPLKRYREEELVHLRGDDVTGELKEH  202

Query  61   DRVYDYAYYNDLGDPDKG  8
            DR+Y+YAYYNDLG+PDKG
Sbjct  203  DRIYNYAYYNDLGNPDKG  220



>gb|KJB38135.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=570

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  + A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  52   YDYAYYNDLGDPDKG  8
            YDY +YNDL  PD+G
Sbjct  234  YDYDFYNDLAMPDRG  248



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  437
            +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VS++L+S+   +       L+
Sbjct  30   VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSMQLISATHPEPAANRLVLR  89

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90   GKPGKIAYLEKWITTVTSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG VHF C SWVYPA +Y Y RIFFSN+AYLPSQTP  L  YR+EEL +LRG G+G
Sbjct  150  DVPGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSG  209

Query  76   ELKEWDRVYDYAYYNDLGDPDKGAE  2
            ELKEWDRVYDYAYYNDLG PDKG E
Sbjct  210  ELKEWDRVYDYAYYNDLGSPDKGPE  234



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   261 bits (668),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  + AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  62
            HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199  HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  259  DRVYDYAYYNDLGNPDKGQE  278



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   261 bits (668),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  + AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  62
            HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199  HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  259  DRVYDYAYYNDLGNPDKGQE  278



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = -2

Query  568  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSEAAYLDHWVLK  392
            M+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + AYL+ W+  
Sbjct  1    MKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPAYLEDWITT  60

Query  391  NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  212
             T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G VH  C SW
Sbjct  61   ITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGRVHIVCNSW  120

Query  211  VYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYN  32
            VYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYN
Sbjct  121  VYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYN  180

Query  31   DLGDPDKGAE  2
            DLG PD+GA+
Sbjct  181  DLGKPDEGAK  190



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  +A +
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTD-PDGSKGKLGKAGH  76

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77   LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            H+ C SWVYPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWDRV
Sbjct  137  HYLCNSWVYPAKNYAKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGKGELKEWDRV  196

Query  52   YDYAYYNDLGDP  17
            YDYAYYNDLG P
Sbjct  197  YDYAYYNDLGVP  208



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGPE  223



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGPE  223



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  202  ELKEWDRVYDYAYYNDLGSPDKG  224



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGPE  223



>gb|KJB38136.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=645

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  + A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  52   YDYAYYNDLGDPDKG  8
            YDY +YNDL  PD+G
Sbjct  234  YDYDFYNDLAMPDRG  248



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  202  ELKEWDRVYDYAYYNDLGSPDKG  224



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKSR  81

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F +  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTVSLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  202  ELKEWDRVYDYAYYNDLGSPDKG  224



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  202  ELKEWDRVYDYAYYNDLGSPDKG  224



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            +++G V+LM+KNVLDFND ++S++D L +F+G++VSL+L+S+ Q D GN +KGK  + AY
Sbjct  19   RMRGTVILMKKNVLDFNDLSSSLLDRLHEFMGKRVSLQLISAFQTDSGNEMKGKLGKPAY  78

Query  412  LDHWVLKNTVLASGESAFKIEFEWSE---DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            L+ W+   T L +GESAF + F+W +     G P AF+I+N+H +EFYLK++TLE VP H
Sbjct  79   LEDWITTITPLTAGESAFGVTFDWDDDDDSIGTPQAFLIRNHHHSEFYLKSMTLESVPGH  138

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SWVYPA KY  +RIFFSN+AYLPS+TP PL KYR+EEL  LRG G G L+EW
Sbjct  139  GVVHFNCNSWVYPAHKYKKDRIFFSNKAYLPSETPEPLLKYREEELESLRGDGRGTLQEW  198

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDL DPDKGA+
Sbjct  199  DRVYDYAYYNDLSDPDKGAQ  218



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDQGKE  215



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 154/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M+KN LDF D   S+ D   D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  19   SKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  78

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  79   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  138

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  139  GKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYRENELLTLRGDGTGKREAW  198

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  199  DRIYDYDIYNDLGNPDQGKE  218



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDQGKE  215



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKVVSLRLISSVNGDPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ Y+ S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYISSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGPE  223



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  + A
Sbjct  30   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  89

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  90   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  149

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++LRG+G+G LKEWDR
Sbjct  150  LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  209

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG E
Sbjct  210  VYDYAFYNDLGFPDKGPE  227



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDQGKE  215



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            I+GKVVLM+KNVLDFND +AS +D+L +F+G++VSL+LVS+V+ D GN +KGK  +A YL
Sbjct  22   IRGKVVLMKKNVLDFNDLSASFLDDLHEFVGKRVSLQLVSAVKVDPGNDMKGKVGKAEYL  81

Query  409  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  230
            + W+  +T L +GES F + F+W ED G P AFIIKNNH +EFYLK+ TLE+VP+ G +H
Sbjct  82   EDWITTSTPLIAGESTFSVTFDWDEDIGTPGAFIIKNNHHSEFYLKSFTLENVPSQGVIH  141

Query  229  FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT-GTGELKEWDRV  53
            F C SWVYPA KY  +RIFFSN+ Y+ S+TP PL +YR EEL  LRG     +L+EWDRV
Sbjct  142  FICNSWVYPAHKYEKDRIFFSNRTYILSETPKPLLEYRKEELESLRGIRNNQQLQEWDRV  201

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA YNDLGDPDKG +
Sbjct  202  YDYANYNDLGDPDKGPQ  218



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  437
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISANHPEAAANGLKSR  81

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  76   ELKEWDRVYDYAYYNDLGDPDKG  8
            ELKEWDRVYDYAYYNDLG PDKG
Sbjct  202  ELKEWDRVYDYAYYNDLGSPDKG  224



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 152/205 (74%), Gaps = 3/205 (1%)
 Frame = -2

Query  607  LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  437
            +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VSL+L+S+   +       L+
Sbjct  30   VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSLQLISATHPEPAANRLVLR  89

Query  436  GKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  257
            GK  + AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90   GKPGKIAYLEKWITTATSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  256  DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  77
            DV  HG VHF C SWVYPA +Y Y RIFFSN+AYLPSQTP  L  YR+EEL +LRG G+G
Sbjct  150  DVLGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSG  209

Query  76   ELKEWDRVYDYAYYNDLGDPDKGAE  2
            ELKEWDRVYDYAYYNDLG PDKG E
Sbjct  210  ELKEWDRVYDYAYYNDLGSPDKGPE  234



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  + A
Sbjct  40   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  99

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  100  FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  159

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++LRG+G+G LKEWDR
Sbjct  160  LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  219

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG E
Sbjct  220  VYDYAFYNDLGFPDKGPE  237



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   + A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGTLGKVA  92

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93   YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            + F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153  LLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  212

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY YYNDLG+PDKG E
Sbjct  213  VYDYDYYNDLGNPDKGEE  230



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            ++KG V+LM+KNVLDF DF+AS+ D L +FLG+ VS +LVSS  AD  NG KGK  E  Y
Sbjct  5    RVKGTVILMKKNVLDFTDFHASLHDRLDEFLGKGVSFQLVSSTIADPNNGNKGKVGEPGY  64

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            ++ W+ K T +A+GES F++ F+W E  G+P A I++N+H +EFYLKTLTLE  P +G +
Sbjct  65   IEEWITKITSIAAGESKFQVTFQWDESEGIPGAVIVRNHHHSEFYLKTLTLEHFPGNGRI  124

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  56
            HF C SWVYP   Y Y+RIFF+N  YLP  TPAPL+ YR+EELVHLRG   TGELKE+ R
Sbjct  125  HFVCNSWVYPVDYYTYDRIFFANHTYLPINTPAPLQAYRNEELVHLRGDNITGELKEFQR  184

Query  55   VYDYAYYNDLGDPDKGA  5
            +YDYAYYNDLGDPD G+
Sbjct  185  IYDYAYYNDLGDPDNGS  201



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 148/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+GK  + A
Sbjct  22   EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQGKLGKEA  81

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE VP HG 
Sbjct  82   YLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGHGR  141

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
             HF C SWVYP  KY+  R+FF+N+ YLP   P PL +YR++EL+ LRG G GEL+EWDR
Sbjct  142  FHFVCNSWVYPDKKYDNPRVFFTNKTYLPHDMPKPLLQYREQELMALRGNGQGELQEWDR  201

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG E
Sbjct  202  VYDYAYYNDLGNPDKGPE  219



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV     N LKGK  + A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGAPENELKGKVGKPA  83

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144  VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  204  DRVYDYAYYNDLGNPDKGPE  223



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+GK  + A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGKLGKVA  92

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
             ++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93   DVEKWVTTRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            V F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153  VLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  212

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY YYNDLG+PDKG E
Sbjct  213  VYDYDYYNDLGNPDKGEE  230



>ref|XP_006607065.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like, partial 
[Glycine max]
Length=436

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 153/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  + 
Sbjct  4    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62   AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G V+F C SW+YPA +Y ++R+FF+N+AYLP QTP PL+K+R++EL+ LRG G G+L EW
Sbjct  122  GPVNFVCNSWIYPAHRYAHDRVFFANKAYLPYQTPEPLRKFREQELIALRGKGFGKLNEW  181

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG PD G +
Sbjct  182  DRVYDYAYYNDLGLPDDGPD  201



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDQGKE  215



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KN LDF D   S+ D   +FLGQ VS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKLKGTVVMMNKNALDFTDLAGSLTDKAFEFLGQTVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+ +Y  +RIFF NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSFRYKSDRIFFVNQPYLPSKTPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDEGKE  215



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  + A
Sbjct  33   KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  92

Query  415  YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  93   YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  152

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA  Y Y+R+FF+N+AYLPS TP PL+ YR++EL++L+G G+G LKEWD
Sbjct  153  PVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGSGMLKEWD  212

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG P+KG +
Sbjct  213  RVYDYAYYNDLGSPEKGKD  231



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  + A
Sbjct  22   KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  81

Query  415  YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  82   YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  141

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYPA  Y Y+R+FF+N+AYLPS TP PL+ YR++EL++L+G G+G LKEWD
Sbjct  142  PVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGSGMLKEWD  201

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYAYYNDLG P+KG +
Sbjct  202  RVYDYAYYNDLGSPEKGKD  220



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  45   QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  104

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  105  FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  164

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYP  +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  165  LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  224

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG +
Sbjct  225  VYDYAFYNDLGFPDKGPD  242



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -2

Query  583  GKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYLDH  404
            G +VLM+KNVLD +D  +S++D + + LG+ VSL+L+S+V  D  NGL+GK  +  YL+ 
Sbjct  32   GALVLMKKNVLDVSDLKSSLLDRVHELLGKGVSLQLISAVHTDPANGLRGKLGKPVYLEK  91

Query  403  WVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFA  224
            WV  NT L +GE+   +EFEW E  GVP AF+IKNNH ++FYL TLTLEDVP HG + F 
Sbjct  92   WVTTNTPLTAGETKLDVEFEWDESMGVPGAFMIKNNHHSQFYLGTLTLEDVPGHGRLQFV  151

Query  223  CFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT--GTGELKEWDRVY  50
            C SWVYPA +YN+ R+FFSN+ YLP QTP PL+KYR+EELV+LRG   G G+L EWDRVY
Sbjct  152  CNSWVYPAHRYNHHRVFFSNKTYLPCQTPEPLRKYREEELVNLRGNGKGKGKLNEWDRVY  211

Query  49   DYAYYNDLGDPDKGA  5
            DY YYNDLG P++G 
Sbjct  212  DYDYYNDLGMPERGV  226



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  28   QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  87

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  88   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  147

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYP  +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  148  LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  207

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG +
Sbjct  208  VYDYAFYNDLGFPDKGPD  225



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  + A
Sbjct  27   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  86

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  87   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  146

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++L G+G+G LKEWDR
Sbjct  147  LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  206

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG E
Sbjct  207  VYDYAFYNDLGFPDKGPE  224



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G+VHF C SWVYP+  Y  +RIFF+NQ YLPS TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136  GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKREAW  195

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DR+YDY  YNDLG+PD+G E
Sbjct  196  DRIYDYDIYNDLGNPDQGKE  215



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  31   KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  90

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  91   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  150

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y+R+FF+N+ YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  151  LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  210

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG +
Sbjct  211  VYDYAFYNDLGFPDKGPD  228



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  + A
Sbjct  37   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  96

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  97   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  156

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++L G+G+G LKEWDR
Sbjct  157  LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  216

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG E
Sbjct  217  VYDYAFYNDLGFPDKGPE  234



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   255 bits (652),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND +AS++D + + LGQ V+ +LVS+ + D  NG +GK    AY
Sbjct  19   KIKGTVVLMKKNVLDFNDLHASLLDRMHEILGQGVTFQLVSATEGDPNNGKRGKVGPPAY  78

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L++GES F + F W E  G+P A I+KN+H +EF+LK+LTLE VP  G +
Sbjct  79   LEEWITTLTSLSAGESRFNVTFNWDESQGIPGAVIVKNSHHSEFFLKSLTLEGVPRKGRI  138

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  56
            HF C SWVYP  KY Y+R+FF+N  YLPS+TP PL+ YR EEL+HLRG   TGEL+E DR
Sbjct  139  HFVCNSWVYPVDKYTYDRVFFANHTYLPSKTPEPLRPYRLEELLHLRGDDVTGELQEHDR  198

Query  55   VYDYAYYNDLGDPDKGAE  2
            VY YAYYNDLGDPDKGAE
Sbjct  199  VYAYAYYNDLGDPDKGAE  216



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   255 bits (652),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  + A 
Sbjct  23   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  82

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  83   LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  142

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  143  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  202

Query  52   YDYAYYNDLGDPDKG  8
            YDY +YNDL  PD+G
Sbjct  203  YDYDFYNDLAMPDRG  217



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  41   KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  100

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  101  FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  160

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y+R+FF+N+ YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  161  LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  220

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG +
Sbjct  221  VYDYAFYNDLGFPDKGPD  238



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+ NVLDFNDF+AS++D + +FLGQ VSL+L+S    D   G +GK  + A
Sbjct  19   KKIKGTVVLMKNNVLDFNDFHASVLDRVHEFLGQGVSLQLIS---GDSSTGSQGKLGKVA  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++W+     + +GE+ FK+ F+   D GVP AF+I+NNH ++F+LKT+TLEDVP+ G 
Sbjct  76   YLENWIGTLGPVTAGETTFKVTFDVEGDIGVPGAFVIRNNHHSQFFLKTVTLEDVPSAGH  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            + F C SWVYPASKY  +R+FF+N+ YLPS TP PL+KYR +EL  LRG GTGEL+EWDR
Sbjct  136  ILFVCNSWVYPASKYKKDRVFFANKTYLPSDTPLPLRKYRQQELEQLRGNGTGELEEWDR  195

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA YNDLGDPDKG++
Sbjct  196  VYDYACYNDLGDPDKGSK  213



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 148/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+GK  + A
Sbjct  22   EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQGKLGKEA  81

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE VP HG 
Sbjct  82   YLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGHGR  141

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYP  KY+  R+FF+N+  LP   P PL +YR++EL+ LRG G GEL+EWDR
Sbjct  142  LHFVCNSWVYPDKKYDNPRVFFTNKTCLPHDMPKPLLQYREQELMALRGNGQGELQEWDR  201

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG E
Sbjct  202  VYDYAYYNDLGNPDKGPE  219



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  + A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174  HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  52   YDYAYYNDLGDPDKG  8
            YDY +YNDL  PD+G
Sbjct  234  YDYDFYNDLAMPDRG  248



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 144/195 (74%), Gaps = 0/195 (0%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNV+D ND  AS +D + +  G+ VSL+L+S+V  D  N ++GK  + A 
Sbjct  27   KIKGTVVLMKKNVMDMNDLTASFLDRVYELFGRGVSLQLISAVYTDPANEMRGKLGKPAN  86

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  87   LEKWITKITPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  146

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y+R+FFSN+ YLPSQ   PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  147  HFVCNSWVYPTHRYKYDRVFFSNKTYLPSQMAVPLRKYREEELVNLRGDGKGCLKEWDRV  206

Query  52   YDYAYYNDLGDPDKG  8
            YDY +YNDL  P++G
Sbjct  207  YDYDFYNDLAMPERG  221



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  +AA
Sbjct  88   KKIKGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  147

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  148  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  207

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  208  VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  267

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYYNDLG PDKG E
Sbjct  268  WDRVYGYAYYNDLGKPDKGPE  288



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 149/200 (75%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV +D  N   GK  + A
Sbjct  78   KKIKGRVVLMKKIVLDLNDLKASILDRVHELLGKAVSLRLISSVNSDPENESTGKVGKPA  137

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL++WV   T L +GE+AF + F+W E+ GVP AFI++N H +EFYLKT+TLEDVP  G 
Sbjct  138  YLENWVTTITPLTAGETAFDVTFDWDEEIGVPGAFIVRNYHHSEFYLKTVTLEDVPGEGR  197

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  62
            VHF C SWVYPA KY  +R+FF N  YLP  TP  L+K+R+EELV+LRG     GEL+EW
Sbjct  198  VHFVCNSWVYPADKYKKDRVFFXNXTYLPGDTPKSLQKFREEELVNLRGDDEERGELQEW  257

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG+PDKG E
Sbjct  258  DRVYDYAYYNDLGNPDKGPE  277



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA---DLGNGLKGKRSE  422
            K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A   D     +GK  +
Sbjct  22   KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAESYRGKVGK  81

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ W+ K + L +G++A+ + FEW+ + GVP AF I N H NEFYLKTLTLEDVP H
Sbjct  82   KAYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGH  141

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SWVYP+  Y  +RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EW
Sbjct  142  GRVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEW  201

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDY  YNDLGDPDKG E
Sbjct  202  DRVYDYDIYNDLGDPDKGPE  221



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  + A
Sbjct  30   KKVRGTVVLMKKNVLDLTDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  89

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            ++++WV   T +++G++ F + F+W E  G P AFIIKN H ++ YL+T+ LEDVP HG+
Sbjct  90   FMENWVSTLTSISAGDATFNVTFDWDESMGFPGAFIIKNYHHSQLYLRTVVLEDVPGHGQ  149

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y R+FF+N+ YLPS TP PL+ YR+EEL+ LRG+G+G LKEWDR
Sbjct  150  LHFVCNSWVYPAHRYKYNRVFFANKTYLPSNTPEPLRPYREEELLSLRGSGSGMLKEWDR  209

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYA+YNDLG PDKG E
Sbjct  210  VYDYAFYNDLGFPDKGPE  227



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            K+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  AY
Sbjct  1    KVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAY  60

Query  412  LDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            L++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNHG+
Sbjct  61   LENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNHGK  120

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP+  Y  +RIFF+NQ YLPS TP  L+KYR+ EL+ LRG GTG+ + WDR
Sbjct  121  VHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKREAWDR  180

Query  55   VYDYAYYNDLGDPDKGAE  2
            +YDY  YNDLG+PD+G E
Sbjct  181  IYDYDIYNDLGNPDQGKE  198



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  +AA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206  VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYYNDLG PDKG E
Sbjct  266  WDRVYGYAYYNDLGKPDKGPE  286



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  +AA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206  VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYYNDLG PDKG E
Sbjct  266  WDRVYGYAYYNDLGKPDKGPE  286



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  +AA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206  VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYYNDLG PDKG E
Sbjct  266  WDRVYGYAYYNDLGKPDKGPE  286



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI G VVL+R NVLDFNDF ++++DNL + LG  VSL+LVS+   D   G KGK  EAA
Sbjct  18   KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  415  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            YL++W+  NT++   +GE+AF I F+W E+ GVP AF I N H +EF+LK+LTLEDVP H
Sbjct  78   YLENWI-GNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGH  136

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYPA KY   RIFF+NQAYLP++ P PL KYR +EL++LRG G GE KEW
Sbjct  137  GRLHFDCNSWVYPADKYKTPRIFFANQAYLPNEMPKPLVKYRADELLNLRGNGKGERKEW  196

Query  61   DRVYDYAYYNDLGDPD  14
            DR+YDY  YND+GDPD
Sbjct  197  DRIYDYDVYNDIGDPD  212



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI G VVL+R NVLDFNDF ++++DNL + LG  VSL+LVS+   D   G KGK  EAA
Sbjct  18   KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  415  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            YL++W+  NT++   +GE+AF I F+W E+ GVP AF I N H +EF+LK+LTLEDVP H
Sbjct  78   YLENWI-GNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGH  136

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYPA KY   RIFF+NQAYLP++ P PL KYR +EL++LRG G GE KEW
Sbjct  137  GRLHFDCNSWVYPADKYKTPRIFFANQAYLPNEMPKPLVKYRADELLNLRGNGKGERKEW  196

Query  61   DRVYDYAYYNDLGDPD  14
            DR+YDY  YND+GDPD
Sbjct  197  DRIYDYDVYNDIGDPD  212



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVLDFND +AS++D + + LG+ +S +LVS+   D  NG +GK   AAY
Sbjct  20   KIKGTVVLMKKNVLDFNDLHASLLDRMHEVLGKGISFQLVSATVGDPNNGKRGKVGPAAY  79

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+   T L++GES F + F+W E  G+P A I+KN+H +EFYLK+LTL+ VP  G +
Sbjct  80   LEEWITTLTSLSAGESRFNVTFDWDESQGIPGAVIVKNSHHSEFYLKSLTLDGVPRKGSI  139

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG-TGTGELKEWDR  56
            HF C SWVYP  KY Y+RIFF+N  YLPS+TP PL+ YR EEL+HLRG   +GEL+E DR
Sbjct  140  HFVCNSWVYPVDKYKYDRIFFANTTYLPSKTPEPLRPYRQEELLHLRGDDDSGELQEHDR  199

Query  55   VYDYAYYNDLGDPDKGAE  2
            VY YAYYNDLG+PDKGAE
Sbjct  200  VYAYAYYNDLGNPDKGAE  217



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 151/198 (76%), Gaps = 2/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELV--SSVQADLGNGLKGKRSE  422
            K +KG VVLM+KN+L+ ND  AS+VD++ + LG+KV+ +L+  SS+  D    LKGK  +
Sbjct  19   KTMKGVVVLMKKNLLEVNDIAASVVDSVDEILGRKVAFQLITTSSLDHDSEENLKGKPGK  78

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+ W+ K   L +G++ + + FEW+++ GVP AF + N H +EFYLKTLTLEDVP H
Sbjct  79   IAYLEDWITKIGPLTAGDATYTVTFEWTKEMGVPGAFTVTNFHHSEFYLKTLTLEDVPGH  138

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SWVYPA  Y  +R+FF+NQ YLP+QTPAPL++YR+EEL +LRG GTG+L+EW
Sbjct  139  GRVHFVCNSWVYPAQYYETDRVFFANQTYLPNQTPAPLRRYREEELQNLRGNGTGKLEEW  198

Query  61   DRVYDYAYYNDLGDPDKG  8
            DRVYDY  YNDLGDPDKG
Sbjct  199  DRVYDYDIYNDLGDPDKG  216



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 153/200 (77%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI G+VVLM+ NVLDF+DFNAS++D L +F+G++VSL+LVS++  D  N L+GK  E A
Sbjct  8    KKILGEVVLMKSNVLDFDDFNASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W+   T L +GE+ FK+ F+W E+  G+P AF I N+H  +FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEEHMGIPGAFFITNHHHTQFYLKSLTLQHVPPHG  127

Query  238  E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
              + F C SW+YP+ +YN +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128  TTLFFPCNSWIYPSHRYNKDRIFFVNQSYLPSETPEPLRKFREDELQSLRGDGNGELQEW  187

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYA YNDL DPDK  +
Sbjct  188  DRVYDYALYNDLADPDKAPQ  207



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 147/197 (75%), Gaps = 2/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            ++KG VVLM+KNVLDF DFNAS  D L +F+G+ VS +LVSS  AD  NG +GK  E AY
Sbjct  5    RVKGAVVLMKKNVLDFTDFNAS-XDRLDEFVGKSVSFQLVSSTIADPDNGNRGKVGEPAY  63

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            ++ W+   T +A GES F++ F+W E  G+P A I++N H  EFYLKTLTLED P +G +
Sbjct  64   IEEWITTITSIADGESKFQVTFQWDESQGIPGAVIVRNYHHFEFYLKTLTLEDFPGNGRI  123

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  56
            HF C SWVYP   Y Y+RIFF+N  YLP+ TPAPL+ YR+EELVHLRG   TGELKE+ R
Sbjct  124  HFVCNSWVYPVDYYMYDRIFFTNHTYLPTNTPAPLQAYRNEELVHLRGDNVTGELKEFQR  183

Query  55   VYDYAYYNDLGDPDKGA  5
            VYDYAYYNDLG+PD G+
Sbjct  184  VYDYAYYNDLGNPDNGS  200



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA--DLGNGLKGKRSEA  419
            K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A        +GK  + 
Sbjct  22   KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSESYRGKVGKK  81

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            AYL+ W+ K + L +G++A+ + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG
Sbjct  82   AYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHG  141

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             VHF C SWVYP+  Y  +RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWD
Sbjct  142  RVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWD  201

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDY  YNDLGDPDKG E
Sbjct  202  RVYDYDIYNDLGDPDKGPE  220



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            IKG VVLM+KN+L+ ND  AS +D + + LG+ VSL LVS+V  D  NG +GK  +AAYL
Sbjct  77   IKGTVVLMKKNLLELNDLGASFIDRVHELLGKAVSLRLVSAVNTDPANGNRGKIGKAAYL  136

Query  409  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  230
            ++W+ K T L + E AFK+ F W E  GVP AFII+N H +EFYLK+LTLE+VP  G VH
Sbjct  137  ENWISKVTPLTAAECAFKVNFVWDEKIGVPGAFIIRNEHASEFYLKSLTLENVPGKGRVH  196

Query  229  FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TGTGELKEWD  59
            F C SWVYPA KY  +R+FF+N+ YL S+TP  LKK+R+EELV LRG      GEL+EWD
Sbjct  197  FDCNSWVYPADKYKKDRVFFTNKTYLSSETPVGLKKFREEELVTLRGDDVVKKGELQEWD  256

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDYAYYNDLG PDKG
Sbjct  257  RVYDYAYYNDLGSPDKG  273



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 151/201 (75%), Gaps = 8/201 (4%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  + A
Sbjct  112  KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167  YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TGTGELKE  65
            VHF C SWVYP  KY  +R+FF+N+ YLPS+TP PL+KYR+EELVHLRG    G GEL+E
Sbjct  227  VHFVCNSWVYPTEKYTKDRVFFTNKTYLPSETPLPLRKYREEELVHLRGDDEKGKGELQE  286

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVYDY  YNDLG+PDKGA+
Sbjct  287  WDRVYDYDCYNDLGNPDKGAK  307



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 151/201 (75%), Gaps = 8/201 (4%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  + A
Sbjct  112  KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167  YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TGTGELKE  65
            +HF C SWVYP  KY  +R+FF+N+ YLPS+TP PL+KYR+EELVHLRG    G GEL+E
Sbjct  227  LHFVCNSWVYPTEKYTKDRVFFTNKTYLPSETPLPLRKYREEELVHLRGDDEKGKGELQE  286

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVYDY  YNDLG+PDKGA+
Sbjct  287  WDRVYDYDCYNDLGNPDKGAK  307



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 143/196 (73%), Gaps = 0/196 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI+G VVLM+K  LD ND  AS+ D   + LG KVSL+L+S+V  D    L+GK  + A
Sbjct  21   KKIQGTVVLMKKKFLDSNDLTASVTDRFDEILGNKVSLQLISAVNGDPEKELRGKLGKPA  80

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
             L+ W  K T L +    F + FEW E+ GVP AFIIKN+H NEFYLKT+TLEDVP HG 
Sbjct  81   NLEDWDTKITALTAPGVTFNVTFEWEEEIGVPGAFIIKNSHHNEFYLKTVTLEDVPGHGR  140

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYPAS Y  +R+FF+NQ YLP++TPAPL+ YR+EEL+ LRG G G+L+EWDR
Sbjct  141  VHFVCNSWVYPASCYKKDRVFFTNQTYLPTETPAPLRCYREEELLTLRGNGNGKLEEWDR  200

Query  55   VYDYAYYNDLGDPDKG  8
            VYDY  YNDL +P+KG
Sbjct  201  VYDYDIYNDLSEPEKG  216



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI G VVLMR NVLDFNDF ++++DNL + LG  VSL+LVS+   D     +GK  EAA
Sbjct  18   KKIHGTVVLMRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKEFQGKVGEAA  77

Query  415  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            YL++W+  NT+L   +GE+AF I F+W E+ G+P AF I N H +EF+LK+LTL+DVP H
Sbjct  78   YLENWI-GNTILPIFAGETAFSITFDWDEEIGIPGAFFITNQHFSEFFLKSLTLDDVPGH  136

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G +HF C SWVYPA KY   RIFF+NQAYLP++ P PL KYR +EL+ LRG G GE KEW
Sbjct  137  GRIHFDCNSWVYPADKYQTPRIFFANQAYLPNEMPKPLVKYRADELLTLRGNGKGERKEW  196

Query  61   DRVYDYAYYNDLGDPD  14
            DR+YDY  YND+GDPD
Sbjct  197  DRIYDYDVYNDIGDPD  212



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            +++G VVLM+K+VLDFNDF AS++D L +F+G+ VSL+LVS+V  D  NGLKGK  + A 
Sbjct  18   QVEGTVVLMKKSVLDFNDFTASMLDGLHEFVGKGVSLQLVSTVNTDSENGLKGKLGKPAN  77

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            LD W   +  L++GES FK+ F+W E+ G P AF+I NNH NEFYLK+LTL+ VP    +
Sbjct  78   LD-WSTASKPLSTGESTFKVSFDWDEEIGTPGAFLIWNNHDNEFYLKSLTLKGVPGQDVI  136

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYPA  Y  +RIFFSN+ YLPS+TP  L KYR+EEL  LRG G G+L++WDRV
Sbjct  137  HFVCNSWVYPAKNYVKDRIFFSNKTYLPSETPTTLLKYREEELETLRGDGKGQLEKWDRV  196

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYA YNDLG+PDKG E
Sbjct  197  YDYACYNDLGNPDKGLE  213



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   247 bits (630),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 153/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  + 
Sbjct  4    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62   AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G V+F C SW+YPA +Y ++R+FF+N+AYLP QTP PL+K+R++EL+ LRG G G+L EW
Sbjct  122  GPVNFVCNSWIYPAHRYAHDRVFFANKAYLPYQTPEPLRKFREQELIALRGKGFGKLNEW  181

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYAYYNDLG PD G +
Sbjct  182  DRVYDYAYYNDLGLPDDGPD  201



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKI G+VVLM+ NVLDF+DF+AS++D L +F+G++VSL+LVS++  D  N L+GK  E A
Sbjct  8    KKILGEVVLMKSNVLDFDDFSASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  238  E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
              + F C SW+YP+ +Y  +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128  TTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGELQEW  187

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYA YNDL DPDK  +
Sbjct  188  DRVYDYALYNDLADPDKAPQ  207



>ref|XP_004139170.1| PREDICTED: LOW QUALITY PROTEIN: linoleate 9S-lipoxygenase 6-like 
[Cucumis sativus]
Length=867

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKGKV+LMR NVLDF +F++S++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+ +Y  +RIFF+N  YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+
Sbjct  159  HFDCNSWVYPSGRYKKDRIFFANHVYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRI  218

Query  52   YDYAYYNDLGDPDKG  8
            YDY  YND+ DPD G
Sbjct  219  YDYDVYNDIADPDVG  233



>ref|XP_008454503.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X1 [Cucumis 
melo]
 ref|XP_008454506.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X2 [Cucumis 
melo]
Length=880

 Score =   244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 145/196 (74%), Gaps = 1/196 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKGKV+LMR NVLDF +F++S++DN ++ LG  VS++L+S+      N  +GK    A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSIQLISATHTS-ANDSRGKVGNKA  98

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+     L +GES F+I F W E+FG P AF I+N H +EF+LK+LTL+DVP +G 
Sbjct  99   YLERWLTSIPPLFAGESVFQINFPWEENFGFPGAFFIRNGHTSEFFLKSLTLDDVPGYGR  158

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP+ +Y  +RIFF+N  YLP+QTP PL+KYR+EEL +LRG GTGE KEWDR
Sbjct  159  VHFDCNSWVYPSGRYKKDRIFFANHVYLPNQTPNPLRKYREEELWNLRGDGTGERKEWDR  218

Query  55   VYDYAYYNDLGDPDKG  8
            +YDY  YND+ DPD G
Sbjct  219  IYDYDVYNDIADPDVG  234



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            +KG VVLMRKN LDF DF AS++D + + LGQ+VSL+LVS+   D  +G +G   + AYL
Sbjct  15   VKGTVVLMRKNTLDFTDFTASLLDGVQELLGQRVSLQLVSATVGDPKHGNRGVVGDPAYL  74

Query  409  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  230
            D +V K   +A+GES F + F W E  GVP A I+KN H ++FYLK++TL+D P  G +H
Sbjct  75   DGFVSKLPSIAAGESTFDVTFHWQEKNGVPGAVIVKNRHASQFYLKSITLKDFPGKGRIH  134

Query  229  FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRV  53
            F C SWVY A KY Y+R+FF+N AYLP +TPAPLK YR++EL++LRG   TG+L+EWDR+
Sbjct  135  FVCNSWVYSADKYKYDRVFFANTAYLPGETPAPLKPYREDELLNLRGEDVTGQLQEWDRI  194

Query  52   YDYAYYNDLGDPDKGA  5
            YDYAYYNDLG+PD  A
Sbjct  195  YDYAYYNDLGNPDSDA  210



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  604  SPTKK---IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  434
            +P+KK   +KG VVLM+KN LD +D  AS+VD + + LG KVSL+L+ +V AD  N  +G
Sbjct  7    NPSKKTTNVKGTVVLMKKNFLDLDDVKASVVDRVDEVLGHKVSLQLIGAVNADPANKCRG  66

Query  433  KRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  254
            K  + A+L++W  K T L + ++ F++ FEW E+ GVP AF+IKN H  EFYLK LTL+D
Sbjct  67   KPGKPAFLENWEAKFTPLTATDATFRVTFEWEEEAGVPGAFLIKNFHQKEFYLKKLTLDD  126

Query  253  VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  74
            VP HG V F C SW+YP+  Y  +RIFFSNQ YLPSQTP  L+ YR+EEL +LRG G G+
Sbjct  127  VPGHGRVCFICNSWIYPSEYYKKDRIFFSNQTYLPSQTPENLRSYREEELENLRGNGIGK  186

Query  73   LKEWDRVYDYAYYNDLGDPDKG  8
            L+EWDR+YDY  YNDLGDPDK 
Sbjct  187  LEEWDRIYDYDVYNDLGDPDKA  208



>ref|XP_008454513.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X3 [Cucumis 
melo]
Length=879

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKGKV+LMR NVLDF +F++S++DN ++ LG  VS++L+S+      N  +GK    A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSIQLISATHT--SNDSRGKVGNKA  97

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+     L +GES F+I F W E+FG P AF I+N H +EF+LK+LTL+DVP +G 
Sbjct  98   YLERWLTSIPPLFAGESVFQINFPWEENFGFPGAFFIRNGHTSEFFLKSLTLDDVPGYGR  157

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP+ +Y  +RIFF+N  YLP+QTP PL+KYR+EEL +LRG GTGE KEWDR
Sbjct  158  VHFDCNSWVYPSGRYKKDRIFFANHVYLPNQTPNPLRKYREEELWNLRGDGTGERKEWDR  217

Query  55   VYDYAYYNDLGDPDKG  8
            +YDY  YND+ DPD G
Sbjct  218  IYDYDVYNDIADPDVG  233



>ref|XP_007208174.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
 gb|EMJ09373.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
Length=933

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  + A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG--TGTGELKEW  62
            +HF C SWVYPA  Y  +R+FF+N+ YL S TP PLKK+R+EELV+LRG      EL+EW
Sbjct  208  IHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQEW  267

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVY YAYYNDLG P KG +
Sbjct  268  DRVYGYAYYNDLGKPHKGPK  287



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG VVLM+KN+LDF+D  AS  D   +  G KVSL+L+S+V  D  N  +GK  + A
Sbjct  57   EKIKGSVVLMKKNLLDFSDLVASAADRFDEIRGNKVSLQLISAVNGDPENDNRGKVGKPA  116

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W  K   L + + AF I FEW+E+  G+P AFIIKN+H NEFYL+TLTLEDVP HG
Sbjct  117  YLEDWFTKFDPLTAADVAFNITFEWNEEEIGLPGAFIIKNSHHNEFYLRTLTLEDVPGHG  176

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SWVYP   Y  +R+FF+NQ YLPS+TP+PL+ YR+EEL  LRG GTG+L+EWD
Sbjct  177  RIHFICNSWVYPHQYYKKDRVFFTNQTYLPSKTPSPLRHYREEELKTLRGNGTGKLEEWD  236

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDY  YNDL +P+KG
Sbjct  237  RVYDYDLYNDLSEPEKG  253



>gb|AAC61785.1| lipoxygenase 1 [Cucumis sativus]
Length=878

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+ +Y  +RIFF+N  YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+
Sbjct  159  HFDCNSWVYPSGRYKKDRIFFANHVYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRI  218

Query  52   YDYAYYNDLGDPDKG  8
            YDY  YND+ DPD G
Sbjct  219  YDYDVYNDIADPDVG  233



>emb|CAA63483.1| lipoxygenase [Cucumis sativus]
Length=878

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+ +Y  +RIFF+N  YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+
Sbjct  159  HFDCNSWVYPSGRYKKDRIFFANHVYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRI  218

Query  52   YDYAYYNDLGDPDKG  8
            YDY  YND+ DPD G
Sbjct  219  YDYDVYNDIADPDVG  233



>ref|XP_004156415.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis sativus]
Length=878

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+ +Y  +RIFF+N  YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+
Sbjct  159  HFDCNSWVYPSGRYKKDRIFFANHVYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRI  218

Query  52   YDYAYYNDLGDPDKG  8
            YDY  YND+ DPD G
Sbjct  219  YDYDVYNDIADPDVG  233



>ref|XP_006359922.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=854

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = -2

Query  604  SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  425
            S T KIKG VVLM+KNVL+F D   + +D + +  G++V+++LVS+  AD  NG KGK  
Sbjct  25   SGTIKIKGTVVLMKKNVLNFKDAGCAFLDRMHELFGKRVTIQLVSAEHADPENGSKGKLG  84

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + A L+ W    T ++  E+AF I F+W E  GVP AFI+KNNH ++FYLKTLTL DVP 
Sbjct  85   KPAILE-WASSKTWISVEEAAFNITFDWDESLGVPGAFIVKNNHHSQFYLKTLTLHDVPG  143

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
             GEVHF C SWVYP  +YNY+R+FFSN+ YLP  TP PL  YR+EELV+LRGTG+G LKE
Sbjct  144  EGEVHFVCNSWVYPPHRYNYDRVFFSNKTYLPCDTPEPLVPYRNEELVNLRGTGSGMLKE  203

Query  64   WDRVYDYAYYNDLG  23
            WDRVYDYA YNDLG
Sbjct  204  WDRVYDYAVYNDLG  217



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  + A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG--TGTGELKEW  62
            +HF C SWVYPA  Y  +R+FF+N+ YL S TP PLKK+R+EELV+LRG      EL+EW
Sbjct  208  IHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQEW  267

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVY YAYYNDLG P KG +
Sbjct  268  DRVYGYAYYNDLGKPHKGPK  287



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 5/198 (3%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D      GK  + A
Sbjct  22   EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVD-----AGKLGKEA  76

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE VP HG 
Sbjct  77   YLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGHGR  136

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYP  KY+  R+FF+N+  LP   P PL +YR++EL+ LRG G GEL+EWDR
Sbjct  137  LHFVCNSWVYPDKKYDNPRVFFTNKTCLPHDMPKPLLQYREQELMALRGNGQGELQEWDR  196

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDYAYYNDLG+PDKG E
Sbjct  197  VYDYAYYNDLGNPDKGPE  214



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 150/200 (75%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KI G+VVLM+ NVLDF+DF+ S++D L +F+G++VSL+LVS++  D  N L+GK  E A
Sbjct  8    RKILGEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  238  E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
              + F C SW+YP+ +Y  +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128  TTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGELQEW  187

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYA YNDL DPDK  +
Sbjct  188  DRVYDYALYNDLADPDKAPQ  207



>ref|XP_010556753.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=733

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 151/201 (75%), Gaps = 1/201 (0%)
 Frame = -2

Query  610  ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK  431
            A S    I+G+VV+M+KNVLDF D  AS++D + + LG++V+L+LVSSVQ D GN  +G+
Sbjct  5    AASKMTMIQGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVTLQLVSSVQPDPGNERRGR  64

Query  430  RSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDV  251
              +AA+L +WV   + + + E+AF + FEW E  G P+AF+IKN+H ++F+LK+LTL DV
Sbjct  65   LGKAAHLANWVKIKSAVTAEETAFAVAFEWDESMGTPSAFVIKNHHRSQFFLKSLTLRDV  124

Query  250  PN-HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  74
            P   G +HF C SW+YP+ +Y Y+R+FFSNQAYLP++ P  LK+ R+EEL++LRG G GE
Sbjct  125  PGASGSIHFVCNSWIYPSHRYGYDRVFFSNQAYLPNEMPELLKEIREEELMNLRGNGKGE  184

Query  73   LKEWDRVYDYAYYNDLGDPDK  11
             KEWDRVYDY  +NDLG PDK
Sbjct  185  RKEWDRVYDYDVFNDLGSPDK  205



>emb|CDP20619.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 4/186 (2%)
 Frame = -2

Query  568  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYLDHWVLKN  389
            M+K+VLDFNDF+A++VD L +FLG+KVSL+LVSSV+AD      GK    AYL++W+   
Sbjct  1    MKKHVLDFNDFSAAVVDLLYEFLGKKVSLQLVSSVKADHS----GKLGTPAYLENWITTF  56

Query  388  TVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWV  209
            + + +GESA  + F+W ED GVP AFIIKN H  EFYLKTLTLE+VP H  +HF C S V
Sbjct  57   SSVKAGESALSVTFDWDEDNGVPGAFIIKNFHQYEFYLKTLTLENVPGHDSIHFVCNSCV  116

Query  208  YPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYND  29
            YPA+KY  +RIFFSNQAYLP+ T  PLK  R+ EL +LRG GTGELKEWDR+YDYA YND
Sbjct  117  YPANKYKTDRIFFSNQAYLPNNTSEPLKFCREAELANLRGDGTGELKEWDRIYDYACYND  176

Query  28   LGDPDK  11
            LGDPD+
Sbjct  177  LGDPDR  182



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VS++L+S+   D   GL GK  E 
Sbjct  6    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSIQLISATSPDPAKGLLGKHGEE  65

Query  418  AYLDHWVLKNTVLASG-ESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            +YL+ WV   + L S  ++ F + F+W  E  GVP AFII+N+H ++FYLKT+T+ED+P 
Sbjct  66   SYLERWVSTISSLTSASDTEFWVTFDWDHEKMGVPGAFIIRNHHKSQFYLKTVTIEDIPG  125

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG V+F C SWVYPA +Y ++R+FFSN+AYLP QTP PL+K R++EL  LRG G G+L E
Sbjct  126  HGPVNFVCNSWVYPAHRYTHDRVFFSNKAYLPCQTPGPLRKLREQELEVLRGKGVGKLNE  185

Query  64   WDRVYDYAYYNDLGDPDKG  8
            WDRVYDYAYYNDLG PD G
Sbjct  186  WDRVYDYAYYNDLGTPDDG  204



>gb|ACD43483.1| lipoxygenase 1 [Olea europaea]
Length=869

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 148/199 (74%), Gaps = 1/199 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KI+G V+LM+KNV++  D  AS +D + + +G+ V+L+L+S+  AD  NG +GK  + A
Sbjct  22   RKIRGTVLLMKKNVMEMTDVGASFLDRVHEIVGKGVTLQLISASHADPANGSRGKLGKEA  81

Query  415  YLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            YL+HWV K T L++ + A F I F+W E  GVP AFII+N+H ++FYLK +TLEDVP HG
Sbjct  82   YLEHWVTKFTSLSAKDDAMFNITFDWDESMGVPGAFIIRNHHHSQFYLKKVTLEDVPGHG  141

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            ++ F C SWVYPA +Y  +R+FF+ + YLP  TP PL+ YR++EL +LRG G+G LKEWD
Sbjct  142  QLQFVCNSWVYPAHRYKNDRVFFAYKTYLPCNTPEPLRAYREDELTNLRGDGSGTLKEWD  201

Query  58   RVYDYAYYNDLGDPDKGAE  2
            RVYDYA YNDLG P+KG E
Sbjct  202  RVYDYALYNDLGSPEKGQE  220



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
             +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  + 
Sbjct  17   VQKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKK  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
             YL +W+ K   ++ GE+ FKI F W ED G+P AFII+NNH  +F+LK+LTLEDVP  G
Sbjct  77   TYLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SW+YP+ KY  +RIFF N+AY+P++TP PL+KYR +EL +LRG GTGE +EWD
Sbjct  137  RIHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYRQDELKNLRGDGTGERQEWD  196

Query  58   RVYDYAYYNDLGDPDKGA  5
            R+YDY  YNDL DP  G+
Sbjct  197  RIYDYDVYNDLEDPSSGS  214



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   242 bits (618),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  + A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV     L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTIIPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG--TGTGELKEW  62
            +HF C SWVYPA  Y  +R+FF+N+ YL S TP PLKK+R+EELV+LRG      EL+EW
Sbjct  208  IHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQEW  267

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVY YAYYNDLG P KG +
Sbjct  268  DRVYGYAYYNDLGKPHKGPK  287



>ref|XP_008246454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=934

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  + A
Sbjct  90   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGEVVSLQLISSVNGDPENG-RGKVGKPA  148

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ WV   T L + E  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  149  YLEDWVTTITPLTAEECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  208

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG--TGTGELKEW  62
            +HF C SWVYPA  Y  +R+FF+N+ YL S TP PLKK+R+EELV+LRG      EL+EW
Sbjct  209  IHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQEW  268

Query  61   DRVYDYAYYNDLGDPDKG  8
            DRVY YAYYNDLG P KG
Sbjct  269  DRVYGYAYYNDLGKPHKG  286



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS--SVQADLGNGLKGKRSE  422
            K +KG VVLM+KN+L+ ND  ASIVD++ + LG+KV+L+L++  S+  D    LKGK  +
Sbjct  118  KTMKGIVVLMKKNLLEVNDIAASIVDSVDEILGRKVALQLITTASLDHDSEENLKGKPGK  177

Query  421  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
             AYL+  + K   L +G++ + + FEW+++ G+P AF + N H +EFYLKTLTLED+P H
Sbjct  178  IAYLEDLITKIGPLTAGDATYTVTFEWTKEMGIPGAFTVTNFHHSEFYLKTLTLEDIPGH  237

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
            G VHF C SWVYPA  Y  +R+FF+NQ YLP+QTPA L++YR+EEL +LRG GTG+L+EW
Sbjct  238  GRVHFVCNSWVYPAQYYKTDRVFFANQTYLPNQTPARLRRYREEELQNLRGNGTGKLEEW  297

Query  61   DRVYDYAYYNDLGDPDK  11
            DRVYDY  YNDLGDPDK
Sbjct  298  DRVYDYDIYNDLGDPDK  314



>ref|XP_006344625.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
Length=863

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 147/197 (75%), Gaps = 2/197 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D+ N  +GK  + 
Sbjct  25   TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVANKGRGKLGKP  84

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A+L+ W  K + L   ++ F + FEW+E+ GVP AF+IKN+H NEFYLKTLTL+DVP HG
Sbjct  85   AHLEGW--KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDVPGHG  142

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +V F C SW+Y +  Y  +R+FF+NQ YLP++TPAPL+ YR+EEL +LRG GTG+ +EWD
Sbjct  143  KVCFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREEWD  202

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDY  YNDLGDP+KG
Sbjct  203  RVYDYDVYNDLGDPEKG  219



>ref|XP_009406999.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            ++KG VVLM KNVLDFND   +++D L D LGQ V+ +LVS+   D  NG +G     A 
Sbjct  32   QVKGTVVLMPKNVLDFNDLAGNVIDGLFDILGQNVTFQLVSATVGDPNNGNRGVVGSPAS  91

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L  ++ +   LA+GES F + F+W E+ G+P A I+KN H  +F+LKTLTL++ P  G +
Sbjct  92   L-QYLGRLPSLAAGESRFSVTFQWEENKGIPGAVIVKNKHATQFFLKTLTLDNFPGKGRI  150

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  56
            HF C SWVYPASKY Y+R+FF+N  YLP  TPAPLK YR +EL++LRG   TGELKEWDR
Sbjct  151  HFVCNSWVYPASKYKYDRVFFANTTYLPGDTPAPLKPYRQDELLNLRGQDVTGELKEWDR  210

Query  55   VYDYAYYNDLGDPDKGA  5
            VYDYAYYNDLG PD+GA
Sbjct  211  VYDYAYYNDLGSPDQGA  227



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  +  
Sbjct  16   QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  75

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL +W+ K   ++ GE+ FKI F+W ED G+P AF+I+NNH  +F+LK+LTLEDVP  G 
Sbjct  76   YLGNWMTKMVPVSPGETVFKISFDWDEDIGIPGAFLIRNNHFTKFFLKSLTLEDVPFVGR  135

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SW+YP+ KY  +RIFF N+AY+P++TP PL+KYR++EL +LRG GTGE +EWDR
Sbjct  136  IHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYREDELKNLRGDGTGERQEWDR  195

Query  55   VYDYAYYNDLGDP  17
            +YDY  YNDL DP
Sbjct  196  IYDYDVYNDLEDP  208



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KN+LD  D  ASI+D L +   + VS++LVS+ Q D  NG +GK  +AA 
Sbjct  38   KIKGTVVLMKKNILDVKDVGASILDRLHELFHRGVSIQLVSADQIDPENG-RGKLGKAAI  96

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W  K T +++ +  F + FEW E  G P A I++N+H ++FYLKT+TL+DVP HG++
Sbjct  97   LEKWNAKLTSVSATDVKFDVNFEWDESMGAPGALIVRNHHHSQFYLKTVTLDDVPGHGQL  156

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP  +Y Y R+FF+N+ YLPS TP  L+ YR+EEL +LRG GTG LKEWDRV
Sbjct  157  HFVCNSWVYPQHRYKYNRVFFANKTYLPSNTPEALRPYREEELDNLRGNGTGMLKEWDRV  216

Query  52   YDYAYYNDLGDPDKGAE  2
            YDYAYYNDLG+PD G E
Sbjct  217  YDYAYYNDLGNPDGGPE  233



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 149/200 (75%), Gaps = 2/200 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            K++KG+VVLM+K++LDF+D  A+++D + +FLG+ VSL+L+S+   D   GL+GK  + A
Sbjct  8    KEVKGRVVLMKKSLLDFHDIKANLLDRIHEFLGKGVSLQLISATTPDPEKGLRGKHGKVA  67

Query  415  YLDHWVLKNTVLASG-ESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  242
            YL+ W+   + L +  E+ F + F+W  E  GVP AFII NNH ++FYLKT+T+ED+P H
Sbjct  68   YLERWISSISSLTTATETEFSVTFDWDHEKMGVPGAFIITNNHHSQFYLKTVTIEDIPGH  127

Query  241  GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  62
              + F C SWVYPA +Y ++R+FF+N+AYLPS+TP  L+K R+EELV LRG G G+L EW
Sbjct  128  APITFVCNSWVYPAHRYTHQRVFFTNKAYLPSETPESLRKLREEELVALRGKGVGKLNEW  187

Query  61   DRVYDYAYYNDLGDPDKGAE  2
            DRVYDYA YNDLG PD G +
Sbjct  188  DRVYDYACYNDLGTPDDGID  207



>ref|XP_004230207.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=863

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D  N  +GK  + 
Sbjct  25   TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDAANKGRGKLGKP  84

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A L+ W  K + L   E+ F + FEW+E+ G+P AF+IKN+H NEFYLKTLTL+DVP HG
Sbjct  85   ANLEGW--KISTLTEREATFSVNFEWNEEIGIPGAFLIKNSHHNEFYLKTLTLDDVPGHG  142

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
            +V F C SW+Y +  Y  +R+FF+NQ YLP++TPAPL+ YR+EEL +LRG GTG+ +EWD
Sbjct  143  KVKFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREEWD  202

Query  58   RVYDYAYYNDLGDPDKG  8
            RVYDY  YNDLGDP+KG
Sbjct  203  RVYDYDVYNDLGDPEKG  219



>gb|ADL41189.1| lipoxygenase [Camellia sinensis]
Length=868

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKG VVLM+K++LDF+  +  +VD + + +GQKVSL+L+S+V  D G  L+GK  + A
Sbjct  18   KKIKGTVVLMKKSLLDFDGLSLPLVDRIEEVVGQKVSLQLISAVNGDPGKDLRGKIGKKA  77

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T   S + +F + FEW E+ GVP AF I N+H NEFYLKT+TLE VP+HG+
Sbjct  78   YLEDWITKITT-PSADVSFNVTFEWDEEVGVPGAFTITNSHHNEFYLKTVTLEGVPDHGQ  136

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            + F C SWVYP   Y  +R+FF+NQ YLP +TPAPL  YR+EEL+ LRG GTG+L+EWDR
Sbjct  137  IQFICNSWVYPKKYYEKDRVFFTNQTYLPGETPAPLCHYREEELLTLRGNGTGKLEEWDR  196

Query  55   VYDYAYYNDLGDPD  14
            VYDY  YNDL +P+
Sbjct  197  VYDYDLYNDLSEPE  210



>ref|XP_007150490.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
 gb|ESW22484.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
Length=860

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 146/208 (70%), Gaps = 15/208 (7%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFN-------------DFNASIVDNLSDFLGQKVSLELVSSVQADL  452
            K+KG VVLMRKNVLD N             D   S VDNL+ FLG+ VSL+L+S+ + D 
Sbjct  14   KLKGTVVLMRKNVLDVNSVTSVGGIVGQGLDILGSTVDNLTAFLGRSVSLQLISATKPD-  72

Query  451  GNGLKGKRSEAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLK  272
             NG KGK  +A +L+  +     L +G+SAFKI FEW ++ G+P AF IKN    EFYL 
Sbjct  73   ANG-KGKLGKATFLEGIITSLPTLGAGQSAFKIHFEWDDEMGIPGAFYIKNFMQTEFYLV  131

Query  271  TLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLR  92
            +LTLED+PNHG +HF C SW+Y A  +  +RIFF NQ YLPS+TPAPL KYR+EELV++R
Sbjct  132  SLTLEDIPNHGSLHFLCNSWIYNAKHFKNDRIFFVNQIYLPSETPAPLVKYREEELVNMR  191

Query  91   GTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            G GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  192  GDGTGERKEWDRIYDYDVYNDLGDPDKG  219



>ref|XP_004247367.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=854

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAY  413
            KIKG VVLM+KNVL+F D  ++ +D + +  G++V+++LVS+  AD  NG KGK  + A 
Sbjct  29   KIKGTVVLMKKNVLNFKDAGSAFLDRMHELFGKRVTIQLVSAEHADPENGSKGKLGKPAT  88

Query  412  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  233
            L+ W    T ++  E+AF I F+W E  GVP AFI+KNNH ++FYLKTLTL DVP  GEV
Sbjct  89   LE-WASSKTWISVEEAAFNITFDWDESLGVPGAFIVKNNHHSQFYLKTLTLHDVPGDGEV  147

Query  232  HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  53
            HF C SWVYP+ +YN +R+FFSN+ YLP  TP PL  YR+EELV+LRGTG+G LKEWDRV
Sbjct  148  HFVCNSWVYPSHRYNNDRVFFSNKTYLPCNTPEPLVAYRNEELVNLRGTGSGMLKEWDRV  207

Query  52   YDYAYYNDLG  23
            YDYA YNDLG
Sbjct  208  YDYAVYNDLG  217



>gb|AAA79186.1| lipoxygenase [Cucumis sativus]
Length=877

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 143/196 (73%), Gaps = 1/196 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            +KIKGKV+LMR NV+DF +F++S++DN ++ LG  VSL+L+S+ Q    +  +GK  + A
Sbjct  40   QKIKGKVILMRSNVMDFTEFHSSLLDNFTELLGGGVSLQLISATQTSALDS-RGKVGKKA  98

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+     L +GES F++ F W E FG P AF IKN H +EF+LK+LTLEDVP  G 
Sbjct  99   FLERWLTSIPPLFAGESVFQVSFTWEEGFGFPGAFFIKNGHTSEFFLKSLTLEDVPGFGH  158

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP+ +Y  +RIFF+N  YLPS TP PL+KYR+EEL+ LRG GTGE KEWDR
Sbjct  159  VHFDCNSWVYPSGRYKKDRIFFANNTYLPSDTPNPLRKYREEELLTLRGDGTGERKEWDR  218

Query  55   VYDYAYYNDLGDPDKG  8
            +YDY  YNDL +P  G
Sbjct  219  IYDYDIYNDLSEPGDG  234



>ref|XP_007030814.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11316.1| Lipoxygenase 1 [Theobroma cacao]
Length=835

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
            ++ IKG VVLM+KNVLDFN   +S VDN+ + +GQ+V+L+LVS+  AD  N   GK  + 
Sbjct  16   SQTIKGTVVLMKKNVLDFNAIGSSAVDNVLELVGQQVTLQLVSAQNADPANENAGKLGKL  75

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
            A L+ W L  T   +GE+ +K+ FEW E FG P A II+NNH  EFYLKT+TLEDVP  G
Sbjct  76   AALESWNLTFTPPIAGETQYKVSFEWDEQFGAPGAIIIRNNHAAEFYLKTITLEDVPGQG  135

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
              HF C SW+YP  +Y   R+FF+N+ YLP +TPAPL+KYR+EEL  LRG G G+LK  D
Sbjct  136  RTHFVCNSWIYPDRQYKKPRVFFANKTYLPHETPAPLRKYREEELKVLRGDGKGQLKSGD  195

Query  58   RVYDYAYYNDLGDPD  14
            RVYDYA YNDLG+PD
Sbjct  196  RVYDYAVYNDLGNPD  210



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEA  419
             +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  + 
Sbjct  17   VQKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKX  76

Query  418  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  239
             YL +W+ K   ++ GE+ FKI F W ED G+P AFII+NNH  +F+LK+LTLEDVP  G
Sbjct  77   TYLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVG  136

Query  238  EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  59
             +HF C SW+Y + KY  +RIFF N+AY+P++TP PL+KYR +EL +LRG GTGE +EWD
Sbjct  137  RIHFDCNSWIYSSGKYKNDRIFFINKAYIPNETPEPLRKYRQDELKNLRGDGTGERQEWD  196

Query  58   RVYDYAYYNDLGDPDKGA  5
            R+YDY  YNDL DP  G+
Sbjct  197  RIYDYDVYNDLEDPSSGS  214



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  568  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYLDHWVLKN  389
            M+KN LD +D  AS+VD + + LG KVSL+L+S+V AD  N  +GK  + A+L++W  K 
Sbjct  1    MKKNFLDLDDVKASVVDRVDEILGHKVSLQLISAVNADPANKCRGKPGKPAFLENWEAKF  60

Query  388  TVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWV  209
            T L + ++ F + FEW E+ GVP AF+IKN H  EFYLKTLTL+DVP  G V F C SW+
Sbjct  61   TPLTATDATFGVTFEWEEEAGVPGAFLIKNFHQKEFYLKTLTLDDVPGRGRVCFICNSWI  120

Query  208  YPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYND  29
            YP+  Y  +RIFFSNQ YLPSQTP PL+ YR+EEL +LRG G G+L+EWDR+YDY  YND
Sbjct  121  YPSEYYKRDRIFFSNQTYLPSQTPEPLRSYREEELENLRGNGIGKLEEWDRIYDYDVYND  180

Query  28   LGDPDKG  8
            LGDPDKG
Sbjct  181  LGDPDKG  187



>ref|XP_010934565.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Elaeis guineensis]
Length=885

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            +KG VVLM+KNVLDF DF A+++D++ + LGQ VSL+LVS+   D  NG +G   E AYL
Sbjct  43   VKGTVVLMKKNVLDFTDFGATLLDDVHELLGQGVSLQLVSATVGDPNNGNRGIVGEPAYL  102

Query  409  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  230
            + ++     +A+GES F + F+W+E+ G+P A I+KN H  +F+LKT+TLE+    G +H
Sbjct  103  ESYITSLPSIAAGESTFTVTFDWNENHGIPGAVIVKNQHSAQFFLKTVTLENFLGKGRIH  162

Query  229  FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE-LKEWDRV  53
            F C SWVYP  KY Y RIFF+N  YLP  TP+PL+ YR++EL HLRG G  E L+EWDRV
Sbjct  163  FVCDSWVYPVDKYKYNRIFFANNTYLPGDTPSPLRPYREDELRHLRGEGETETLQEWDRV  222

Query  52   YDYAYYNDLGDPDKGAE  2
            Y+YAYYNDLG+PD G E
Sbjct  223  YNYAYYNDLGNPDAGPE  239



>ref|NP_001280815.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82793.1| lipoxygenase [Malus domestica]
Length=885

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVL+ ND  AS+ D   +  G++V L+L+SSV  D  NG +GK  + A
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF + F+W E+ GVP AFII+N H NEFYLK+LTLEDVP  G 
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYP  KY  +R+FF+N+ Y+ S TP PL+K+R+EEL +LRG       EL+E
Sbjct  164  VHFVCNSWVYPTEKYKKDRVFFANKTYISSDTPVPLQKFREEELKNLRGDDDDEKRELQE  223

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYY+DLG P KG E
Sbjct  224  WDRVYGYAYYDDLGKPYKGLE  244



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM +  LD  +  AS++D   + +G+ VSL+L+S+  A+   G  GK  + A
Sbjct  31   KKVRGTVVLMEEECLDLTNVGASLLDRFHEVIGKGVSLQLISADHAE--PGCTGKLGKPA  88

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  89   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  148

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            +HF C SWVYPA +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  149  LHFVCNSWVYPAHRYKYDRVFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  208

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY +YNDLG PDKG +
Sbjct  209  VYDYRFYNDLGFPDKGPD  226



>ref|XP_008359870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=885

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KK++G VVLM+KNVL+ ND  AS+ D   +  G++V L+L+SSV  D  NG +GK  + A
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            YL+ W+ K T L + E+AF + F+W E+ GVP AFII+N H NEFYLK+LTLEDVP  G 
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  65
            VHF C SWVYP  KY  +R+FF+N+ Y+ S TP PL+K+R+EEL +LRG       EL+E
Sbjct  164  VHFXCNSWVYPXXKYKKDRVFFANKTYISSDTPVPLQKFREEELKNLRGDDDDEKRELQE  223

Query  64   WDRVYDYAYYNDLGDPDKGAE  2
            WDRVY YAYY+DLG P KG E
Sbjct  224  WDRVYGYAYYDDLGKPYKGLE  244



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 149/240 (62%), Gaps = 43/240 (18%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA---------------  458
            K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A               
Sbjct  22   KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESGPLD  81

Query  457  ----------------------------DLGNGLKGKRSEAAYLDHWVLKNTVLASGESA  362
                                         +    +GK  + AYL+ W+ K + L +G++A
Sbjct  82   WYGHTVRWLRCLGTCKGGCCFTGKKESEPIAESYRGKVGKKAYLEDWITKISPLTAGDTA  141

Query  361  FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYE  182
            + + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG VHF C SWVYP+  Y  +
Sbjct  142  YDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYYKKD  201

Query  181  RIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  202  RIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  261



>ref|XP_010530359.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=883

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = -2

Query  589  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAAYL  410
            I G+VV+M+KNVLDF D  AS++D + + LG++VS++LVSSVQ D GNG +G+  +AA+L
Sbjct  36   IHGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVSIQLVSSVQPDPGNGRRGRLGKAAHL  95

Query  409  DHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN-HGE  236
            + WV K  + + + E+AF I FEW E  G P+AF+IKN+H ++F+LK++TL +VP   G 
Sbjct  96   EKWVTKIKSAVTAEETAFAIAFEWDESMGTPSAFVIKNHHRSQFFLKSVTLHEVPGGSGP  155

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SW+YP  +Y Y+R+FFSNQAYLP++ P  LK+ R++EL +LRG G GE KEWDR
Sbjct  156  VHFVCNSWIYPWHRYGYDRVFFSNQAYLPNEMPELLKEIREDELKNLRGNGNGERKEWDR  215

Query  55   VYDYAYYNDLGDPDKGAE  2
            VYDY  +NDLG PDKG +
Sbjct  216  VYDYDVFNDLGSPDKGQD  233



>gb|ABB82552.1| 13S-lipoxygenase [Cucumis melo var. inodorus]
Length=877

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = -2

Query  595  KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSEAA  416
            KKIKGKV+LMR NVLDF +F++S++DNL++ LG  VS++L+S+      +  +GK  + A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNLTELLGGGVSIQLISATHTSALDS-RGKVGKKA  98

Query  415  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  236
            +L+ W+     L +GES F++ F W + FG P AF I+N H +EF+LK+LTLEDVP +G 
Sbjct  99   FLEKWLTSIPPLFAGESVFQVNFTWEDGFGFPGAFFIQNGHTSEFFLKSLTLEDVPGYGR  158

Query  235  VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  56
            VHF C SWVYP+ +Y  +RIFF+N  YLPS TP PL+KYR+EEL+ LRG GTGE KEWDR
Sbjct  159  VHFDCNSWVYPSGRYKKDRIFFANNTYLPSDTPNPLRKYREEELLTLRGDGTGERKEWDR  218

Query  55   VYDYAYYNDLGDPDKG  8
            +YDY  YNDL +P  G
Sbjct  219  IYDYDIYNDLSEPGDG  234



>ref|XP_006344624.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=865

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -2

Query  598  TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD--LGNGLKGKRS  425
            TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D  L N  +GK  
Sbjct  25   TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVVLANKGRGKLG  84

Query  424  EAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  245
            + A+L+ W  K + L   ++ F + FEW+E+ GVP AF+IKN+H NEFYLKTLTL+DVP 
Sbjct  85   KPAHLEGW--KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDVPG  142

Query  244  HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  65
            HG+V F C SW+Y +  Y  +R+FF+NQ YLP++TPAPL+ YR+EEL +LRG GTG+ +E
Sbjct  143  HGKVCFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREE  202

Query  64   WDRVYDYAYYNDLGDPDKG  8
            WDRVYDY  YNDLGDP+KG
Sbjct  203  WDRVYDYDVYNDLGDPEKG  221



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 150/239 (63%), Gaps = 42/239 (18%)
 Frame = -2

Query  592  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSV------QADLGNG----  443
            K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS        A LG      
Sbjct  22   KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESGPLD  81

Query  442  --------------------------------LKGKRSEAAYLDHWVLKNTVLASGESAF  359
                                             +GK  + AYL+ W+ K + L +G++A+
Sbjct  82   WYGHTVRWLRCLGTCKGGCCFTGKKESEPIESYRGKVGKKAYLEDWITKISPLTAGDTAY  141

Query  358  KIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYER  179
             + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG VHF C SWVYP+  Y  +R
Sbjct  142  DVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYYKKDR  201

Query  178  IFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            IFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  202  IFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230