BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005B06 520 bp,

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABG27026.1|  phosophlipid protein                                    110   3e-27   Gymnadenia conopsea
ref|NP_001065585.1|  Os11g0116000                                     97.4    1e-22   
gb|EAY79716.1|  hypothetical protein OsI_34868                        97.4    1e-22   Oryza sativa Indica Group [Indian rice]
gb|AAT80663.1|  lipid transfer protein precursor                      97.4    2e-22   Malus domestica [apple tree]
ref|NP_001065988.1|  Os12g0115300                                     97.4    2e-22   
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  97.4    2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAG28937.1|  lipid transfer protein                               97.1    2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KEH29195.1|  Lipid transfer protein                                98.6    2e-22   Medicago truncatula
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...  96.7    3e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT80652.1|  lipid transfer protein precursor                      96.7    3e-22   Malus domestica [apple tree]
gb|ADB12472.1|  lipid transfer protein                                95.9    3e-22   Crocus sativus [saffron crocus]
gb|AAT80650.1|  lipid transfer protein precursor                      96.7    4e-22   Malus domestica [apple tree]
gb|EAY79718.1|  hypothetical protein OsI_34870                        95.9    7e-22   Oryza sativa Indica Group [Indian rice]
gb|AGN56423.1|  non-specific lipid transfer protein 3                 94.7    1e-21   Linum usitatissimum
gb|AAT80665.1|  lipid transfer protein precursor                      95.1    1e-21   Malus domestica [apple tree]
gb|AAY83343.1|  non-specific lipid transfer protein precursor         94.7    2e-21   Fragaria x ananassa
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    3e-21   Populus euphratica
ref|NP_001065586.1|  Os11g0116200                                     94.4    4e-21   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         93.6    4e-21   Fragaria x ananassa
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               93.6    5e-21   Phalaenopsis japonica
gb|AFM35695.1|  nonspecific lipid transfer protein                    93.2    6e-21   Vitis pseudoreticulata
ref|XP_003605309.1|  Non-specific lipid-transfer protein              99.0    7e-21   
gb|ABG54494.1|  putative allergen Rub i 3                             92.8    8e-21   Rubus idaeus [European raspberry]
gb|ABK96515.1|  unknown                                               92.8    9e-21   Populus trichocarpa x Populus deltoides
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAY83346.1|  non-specific lipid transfer protein precursor         92.4    1e-20   Fragaria x ananassa
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    1e-20   Fragaria vesca subsp. vesca
gb|ABK94706.1|  unknown                                               92.0    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011466421.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    2e-20   Fragaria vesca subsp. vesca
ref|XP_002305878.2|  lipid transfer family protein                    91.7    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    3e-20   Fragaria vesca subsp. vesca
gb|AAT80649.1|  lipid transfer protein precursor                      91.3    3e-20   Malus domestica [apple tree]
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  91.3    4e-20   Populus euphratica
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   90.9    4e-20   Malus domestica [apple tree]
gb|ABB96481.1|  non-specific lipid transfer protein precursor         90.9    6e-20   Malus domestica [apple tree]
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    90.5    6e-20   Malus domestica [apple tree]
gb|AAR22488.1|  allergen Mal d 3                                      90.5    8e-20   Malus domestica [apple tree]
emb|CAC86258.1|  lipid transfer protein                               90.1    1e-19   Fragaria x ananassa
dbj|BAI94497.1|  lipid transfer protein                               90.1    1e-19   Dianthus caryophyllus [carnation]
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    1e-19   Elaeis guineensis
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   89.4    2e-19   Pyrus x bretschneideri [bai li]
emb|CAB96874.1|  mal d 3                                              88.6    2e-19   Malus domestica [apple tree]
emb|CDP14199.1|  unnamed protein product                              89.4    2e-19   Coffea canephora [robusta coffee]
gb|AAY83344.1|  non-specific lipid transfer protein precursor         89.4    2e-19   Fragaria x ananassa
ref|XP_003579021.1|  PREDICTED: probable non-specific lipid-trans...  89.7    2e-19   Brachypodium distachyon [annual false brome]
gb|ACI47547.1|  nonspecific lipid transfer protein                    89.4    2e-19   Juglans regia
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   89.0    2e-19   Pyrus x bretschneideri [bai li]
dbj|BAI94496.1|  lipid transfer protein                               89.0    3e-19   Dianthus caryophyllus [carnation]
gb|ACL01093.1|  lipid transfer protein                                89.0    3e-19   Castanea mollissima
gb|ADK60918.1|  lipid transfer protein                                89.0    3e-19   Castanea sativa
gb|ADR66947.1|  non-specific lipid transfer protein                   88.2    5e-19   Prunus armeniaca
gb|AAL27855.1|  lipid transfer protein precursor                      88.2    5e-19   Davidia involucrata
gb|ADR66948.1|  non-specific lipid transfer protein                   88.2    5e-19   Prunus armeniaca
ref|XP_006663744.1|  PREDICTED: probable non-specific lipid-trans...  87.8    8e-19   Oryza brachyantha
gb|AFK38461.1|  unknown                                               87.8    8e-19   Lotus japonicus
gb|AFK36168.1|  unknown                                               87.4    8e-19   Lotus japonicus
dbj|BAC77694.1|  lipid transfer protein                               87.8    9e-19   Atriplex nummularia
gb|AAY83342.1|  non-specific lipid transfer protein precursor         87.4    1e-18   Fragaria x ananassa
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  87.4    1e-18   Hordeum vulgare [barley]
emb|CAA80809.1|  lipid transfer protein                               87.4    1e-18   Oryza sativa Indica Group [Indian rice]
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  86.7    1e-18   Prunus armeniaca
gb|ABE11609.1|  lipid-transfer protein precursor                      87.4    1e-18   Solanum chacoense
emb|CCD33109.1|  lipid transfer protein                               87.0    1e-18   Vigna radiata [mung bean]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  86.3    1e-18   Prunus domestica
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  87.0    1e-18   Leonurus japonicus [Chinese motherwort]
gb|AET05730.1|  lipid transfer protein isoform a                      86.7    1e-18   Pyrus communis
gb|AGN56422.1|  non-specific lipid transfer protein 2                 86.7    2e-18   Linum usitatissimum
ref|XP_009398877.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGN56421.1|  non-specific lipid transfer protein 1                 86.7    2e-18   Linum usitatissimum
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 85.9    2e-18   Nicotiana tabacum [American tobacco]
ref|XP_009132019.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    3e-18   Brassica rapa
dbj|BAK05751.1|  predicted protein                                    86.3    3e-18   Hordeum vulgare subsp. vulgare [barley]
gb|ADV02772.1|  lipid transfer protein 1a                             86.3    3e-18   Ipomoea batatas [batate]
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    3e-18   Prunus mume [ume]
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  85.5    3e-18   Vitis sp.
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    4e-18   Nicotiana tomentosiformis
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    4e-18   Sesamum indicum [beniseed]
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    4e-18   Phoenix dactylifera
gb|AET05731.1|  lipid transfer protein isoform b                      85.1    4e-18   Pyrus communis
ref|XP_003605266.1|  Non-specific lipid-transfer protein              85.5    5e-18   Medicago truncatula
ref|XP_009410515.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ53932.1|  lipid transfer protein                                85.9    5e-18   Sesamum indicum [beniseed]
gb|AFK44274.1|  unknown                                               85.5    5e-18   Medicago truncatula
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    85.5    5e-18   Lilium hybrid cultivar
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    5e-18   Prunus mume [ume]
gb|AAT68263.1|  lipid transfer protein                                85.5    5e-18   Nicotiana glauca [glaucous tobacco]
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    5e-18   Nicotiana tomentosiformis
emb|CAT99615.1|  lipid transfer protein                               84.7    5e-18   Malus domestica [apple tree]
gb|ACJ62320.1|  lipid-transfer protein                                85.5    6e-18   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAP92127.1|  lipid transfer protein LPT1                           85.5    6e-18   Oryza sativa Japonica Group [Japonica rice]
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  85.5    6e-18   Pyrus communis
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    85.5    6e-18   Lilium hybrid cultivar
gb|ABA33862.1|  phospholipid transfer protein 1                       85.1    6e-18   Zea diploperennis [chapule]
gb|ABA33857.1|  phospholipid transfer protein 1                       85.5    6e-18   Zea mays subsp. parviglumis [Balsas teosinte]
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  85.5    6e-18   Lens culinaris
gb|ADR66953.1|  non-specific lipid transfer protein                   85.1    7e-18   Prunus dulcis [sweet almond]
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    7e-18   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ACJ62316.1|  lipid-transfer protein                                85.1    7e-18   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAO51648.1|  lipid transfer protein                               85.1    8e-18   Suaeda japonica
emb|CDM80995.1|  unnamed protein product                              85.1    8e-18   Triticum aestivum [Canadian hard winter wheat]
gb|AFX65219.1|  lipid transfer precursor protein                      85.1    8e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    8e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            85.5    8e-18   Cicer arietinum [garbanzo]
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    8e-18   Oryza brachyantha
gb|AAL25839.1|  lipid transfer precursor protein                      85.1    9e-18   Hevea brasiliensis [Para rubber tree]
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            84.7    9e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    9e-18   Oryza brachyantha
emb|CDP14198.1|  unnamed protein product                              84.7    1e-17   Coffea canephora [robusta coffee]
gb|ABA33846.1|  phospholipid transfer protein 1                       85.1    1e-17   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  84.7    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAB70539.1|  lipid transfer protein LPT II                         84.7    1e-17   Oryza sativa Indica Group [Indian rice]
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  84.7    1e-17   Prunus dulcis [sweet almond]
ref|NP_001176316.1|  Os11g0115466                                     84.7    1e-17   
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    1e-17   Eucalyptus grandis [rose gum]
ref|NP_001150972.1|  nonspecific lipid-transfer protein 3 precursor   84.7    1e-17   Zea mays [maize]
gb|ABA33848.1|  phospholipid transfer protein 1                       84.3    1e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001065986.1|  Os12g0115000                                     84.3    1e-17   
gb|AAQ74628.1|  lipid tranfer protein II                              84.7    1e-17   Vigna radiata [mung bean]
ref|NP_001142300.1|  uncharacterized protein LOC100274469 precursor   84.7    1e-17   Zea mays [maize]
ref|XP_004978531.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    1e-17   Setaria italica
gb|ADR66949.1|  non-specific lipid transfer protein                   84.3    1e-17   Prunus sargentii
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    1e-17   Camelina sativa [gold-of-pleasure]
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  83.6    1e-17   Vitis sp.
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    1e-17   Prunus mume [ume]
gb|ABA33849.1|  phospholipid transfer protein 1                       84.3    1e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    1e-17   Elaeis guineensis
gb|ABA33850.1|  phospholipid transfer protein 1                       84.3    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    2e-17   Camelina sativa [gold-of-pleasure]
gb|ABA33853.1|  phospholipid transfer protein 1                       84.0    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33866.1|  phospholipid transfer protein 1                       84.3    2e-17   Zea diploperennis [chapule]
gb|ACM78613.1|  lipid transfer protein 1                              84.3    2e-17   Tamarix hispida
gb|ABA33847.1|  phospholipid transfer protein 1                       84.3    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    84.3    2e-17   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    2e-17   
gb|AAA74624.1|  lipid transfer protein precursor                      84.3    2e-17   Oryza sativa [red rice]
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        84.3    2e-17   Sorghum bicolor [broomcorn]
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    84.0    2e-17   Lilium hybrid cultivar
gb|AES87466.2|  Lipid transfer protein                                84.7    2e-17   Medicago truncatula
gb|ACJ62381.1|  lipid-transfer protein                                84.3    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33860.1|  phospholipid transfer protein 1                       84.0    2e-17   Zea diploperennis [chapule]
gb|ABA33858.1|  phospholipid transfer protein 1                       84.0    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        84.0    2e-17   Sorghum bicolor [broomcorn]
gb|ACJ62387.1|  lipid-transfer protein                                84.0    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACQ42221.1|  lipid transfer protein                                84.0    2e-17   Chimonanthus praecox [wintersweet]
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    2e-17   Cucumis melo [Oriental melon]
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    2e-17   Prunus mume [ume]
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      83.6    3e-17   Nicotiana glauca [glaucous tobacco]
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   83.6    3e-17   Eucalyptus grandis [rose gum]
gb|AHB19225.1|  non specific lipid transfer protein 1C                83.6    3e-17   Punica granatum [granado]
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    3e-17   Vitis vinifera
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           83.6    3e-17   Phaseolus vulgaris [French bean]
emb|CBI18043.3|  unnamed protein product                              84.0    3e-17   Vitis vinifera
gb|ABA34089.1|  phospholipid transfer protein 2                       83.6    3e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    83.2    4e-17   Lilium hybrid cultivar
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   83.2    4e-17   Lilium longiflorum [Easter lily]
dbj|BAH03575.1|  nonspecific lipid transfer protein                   83.2    4e-17   Citrus jambhiri [citronelle]
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    4e-17   Sesamum indicum [beniseed]
gb|AAQ74627.1|  lipid transfer protein I                              83.2    4e-17   Vigna radiata [mung bean]
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    4e-17   Nelumbo nucifera [Indian lotus]
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  83.2    4e-17   Lens culinaris
gb|ADR66946.1|  non-specific lipid transfer protein                   83.2    4e-17   Prunus armeniaca
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  82.4    4e-17   Zea mays [maize]
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  83.2    5e-17   Hordeum vulgare [barley]
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    5e-17   Oryza brachyantha
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   82.8    5e-17   Lilium longiflorum [Easter lily]
ref|NP_568905.1|  non-specific lipid-transfer protein 3               82.8    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    5e-17   Phoenix dactylifera
gb|ABA29446.1|  non-specific lipid transfer protein                   82.8    5e-17   Vitis vinifera
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           82.8    5e-17   Prunus persica
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        82.8    6e-17   Vitis cinerea var. helleri x Vitis vinifera
gb|AGH27866.1|  lipid transfer protein precursor                      82.8    6e-17   Prunus kansuensis [gan su tao]
ref|XP_003605269.1|  Non-specific lipid-transfer protein              84.0    6e-17   
dbj|BAB09777.1|  lipid transfer protein-like                          82.8    6e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADR66950.1|  non-specific lipid transfer protein                   82.8    7e-17   Prunus sargentii
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    7e-17   Cicer arietinum [garbanzo]
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    7e-17   Eucalyptus grandis [rose gum]
ref|NP_001275802.1|  lipid-transfer protein precursor                 82.4    8e-17   Citrus sinensis [Valencia orange]
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           82.8    8e-17   Capsella rubella
gb|ABA33859.1|  phospholipid transfer protein 1                       82.4    9e-17   Zea diploperennis [chapule]
gb|ABA34098.1|  phospholipid transfer protein 2                       82.0    9e-17   Zea diploperennis [chapule]
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           82.0    9e-17   Arabidopsis lyrata subsp. lyrata
gb|AET05733.1|  lipid transfer protein isoform d                      81.6    1e-16   Pyrus communis
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        82.4    1e-16   Zea mays [maize]
gb|ABA33855.1|  phospholipid transfer protein 1                       82.0    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            82.0    1e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            82.0    1e-16   Morus notabilis
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  81.3    1e-16   Prunus persica
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    1e-16   Solanum tuberosum [potatoes]
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  82.0    1e-16   Sorghum bicolor [broomcorn]
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  82.0    1e-16   Lilium longiflorum [Easter lily]
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           82.0    1e-16   Phaseolus vulgaris [French bean]
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  81.6    1e-16   Arabis alpina [alpine rockcress]
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           82.0    1e-16   Citrus clementina
gb|ACJ62323.1|  lipid-transfer protein                                82.0    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62315.1|  lipid-transfer protein                                82.0    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAB96876.2|  pru p 1                                              81.3    1e-16   Prunus persica
dbj|BAJ91878.1|  predicted protein                                    81.6    1e-16   Hordeum vulgare subsp. vulgare [barley]
gb|AAK01293.1|AF331710_1  lipid transfer protein                      82.0    1e-16   Avicennia marina
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   82.0    1e-16   
ref|XP_008779709.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    1e-16   Phoenix dactylifera
dbj|BAI94498.1|  lipid transfer protein                               81.6    1e-16   Dianthus caryophyllus [carnation]
gb|ACJ62339.1|  lipid-transfer protein                                82.0    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFR43276.1|  lipid transfer protein precursor                      81.6    1e-16   Gossypium herbaceum subsp. africanum
gb|ACJ62319.1|  lipid-transfer protein                                81.6    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62318.1|  lipid-transfer protein                                81.6    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AGW21344.1|  lipid transfer protein                                81.6    2e-16   Prunus persica
gb|AFD32278.1|  stigma/style cysteine-rich adhesin                    81.6    2e-16   Lilium hybrid cultivar
ref|XP_006573392.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    2e-16   Glycine max [soybeans]
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  80.9    2e-16   Morus nigra
gb|ACJ62355.1|  lipid-transfer protein                                81.3    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            81.6    2e-16   Gossypium hirsutum [American cotton]
tpg|DAA59277.1|  TPA: hypothetical protein ZEAMMB73_838830            82.4    2e-16   Zea mays [maize]
gb|AEC04836.1|  lipid transfer protein                                81.6    2e-16   Dimocarpus longan [longan]
gb|ACP30545.1|  lipid transfer protein precursor                      81.3    2e-16   Lilium formosanum
gb|AAT68265.1|  lipid transfer protein precursor                      81.3    2e-16   Nicotiana glauca [glaucous tobacco]
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  80.9    2e-16   Prunus persica
gb|ABA33854.1|  phospholipid transfer protein 1                       81.6    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62326.1|  lipid-transfer protein                                81.3    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33856.1|  phospholipid transfer protein 1                       81.3    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AEN70936.1|  lipid transfer protein                                81.3    2e-16   Gossypium gossypioides
gb|ACG40474.1|  nonspecific lipid-transfer protein 2 precursor        81.3    2e-16   Zea mays [maize]
gb|ADR66945.1|  non-specific lipid transfer protein                   81.3    2e-16   Prunus armeniaca
gb|AGW21333.1|  lipid transfer protein                                81.3    2e-16   Prunus davidiana [David's peach]
ref|NP_001268074.1|  lipid transfer protein precursor                 81.3    2e-16   Vitis vinifera
gb|AGH27864.1|  lipid transfer protein precursor                      81.3    2e-16   Prunus davidiana [David's peach]
emb|CAA65680.1|  lipid transfer protein 7a2b                          81.3    2e-16   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    2e-16   Phoenix dactylifera
gb|AAV40850.1|  lipid transfer protein 1 precursor                    81.3    2e-16   Prunus persica
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           80.9    3e-16   Arabidopsis lyrata subsp. lyrata
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              80.5    3e-16   Hordeum vulgare subsp. vulgare [barley]
gb|AET05732.1|  lipid transfer protein isoform c                      80.5    3e-16   Pyrus communis
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    80.9    3e-16   Lilium hybrid cultivar
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    3e-16   Prunus mume [ume]
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    3e-16   Nicotiana sylvestris
ref|NP_001105392.1|  phospholipid transfer protein precursor          80.9    3e-16   Zea mays [maize]
ref|XP_002864627.1|  predicted protein                                80.9    3e-16   Arabidopsis lyrata subsp. lyrata
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       80.9    3e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    80.9    3e-16   Lilium hybrid cultivar
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  80.9    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  81.3    3e-16   Oryza sativa [red rice]
emb|CAH03799.1|  lipid transfer protein                               80.1    3e-16   Citrus sinensis [Valencia orange]
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    4e-16   Nelumbo nucifera [Indian lotus]
ref|NP_001268120.1|  lipid transfer protein precursor                 80.9    4e-16   Vitis vinifera
gb|ACJ62361.1|  lipid-transfer protein                                80.9    4e-16   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    4e-16   Pyrus x bretschneideri [bai li]
gb|AAS13435.1|  lipid-transfer protein                                80.5    4e-16   Nicotiana attenuata
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    4e-16   Oryza brachyantha
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           80.5    5e-16   Citrus clementina
ref|NP_568904.1|  non-specific lipid-transfer protein 4               80.1    5e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAN70512.1|  hypothetical protein VITISV_005630                   80.1    5e-16   Vitis vinifera
emb|CAQ86909.1|  lipid transfer protein                               80.1    5e-16   Vigna radiata [mung bean]
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  80.1    5e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    5e-16   Malus domestica [apple tree]
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   80.1    5e-16   Glycine max [soybeans]
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  80.1    6e-16   Cicer arietinum [garbanzo]
gb|AGH27863.1|  lipid transfer protein precursor                      80.1    6e-16   Prunus mira
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  80.1    6e-16   Prunus avium [gean]
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    6e-16   Malus domestica [apple tree]
gb|ADR66943.1|  non-specific lipid transfer protein                   80.1    6e-16   Prunus avium [gean]
gb|ABA33867.1|  phospholipid transfer protein 1                       80.1    6e-16   Zea diploperennis [chapule]
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    7e-16   Camelina sativa [gold-of-pleasure]
gb|KHG21711.1|  Non-specific lipid-transfer                           80.1    7e-16   Gossypium arboreum [tree cotton]
ref|NP_001274465.1|  non-specific lipid-transfer protein 3-like p...  80.1    7e-16   Setaria italica
ref|WP_039311159.1|  hypothetical protein                             79.3    7e-16   Paenibacillus sp. IHB B 3415
gb|ACJ62342.1|  lipid-transfer protein                                80.1    7e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADR66942.1|  non-specific lipid transfer protein                   79.7    7e-16   Prunus avium [gean]
gb|AER92599.1|  putative lipid transfer protein                       79.7    7e-16   Linum usitatissimum
gb|AHG99490.1|  lipid-transfer protein                                79.7    7e-16   Citrus suavissima
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    7e-16   Sesamum indicum [beniseed]
gb|AEN70915.1|  lipid transfer protein                                79.7    7e-16   Gossypium thurberi
gb|AEI70828.1|  non-specific lipid-transfer protein                   79.7    7e-16   Helianthus annuus
gb|ABA34080.1|  phospholipid transfer protein 2                       79.7    8e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAQ96338.1|  lipid transfer protein                                79.7    8e-16   Vitis aestivalis
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    8e-16   Brassica rapa
gb|KJB71535.1|  hypothetical protein B456_011G128300                  79.7    8e-16   Gossypium raimondii
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    8e-16   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    8e-16   Solanum tuberosum [potatoes]
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  79.7    9e-16   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    9e-16   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    9e-16   
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  79.3    9e-16   
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    9e-16   
gb|AEN70918.1|  lipid transfer protein                                79.7    1e-15   
gb|AAA86694.1|  phospholipid transfer protein precursor               79.3    1e-15   
gb|AEV23221.1|  stigma/stylar cysteine-rich adhesin                   79.3    1e-15   
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        79.3    1e-15   
gb|AGH13363.1|  lipid transfer protein                                79.0    1e-15   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  79.3    1e-15   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 79.3    1e-15   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        79.3    1e-15   
emb|CBW38501.1|  lipid transfer protein                               79.0    1e-15   
gb|ADB12473.1|  lipid transfer protein                                78.6    1e-15   
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            79.0    1e-15   
emb|CAT99613.1|  lipid transfer protein                               78.2    1e-15   
gb|KHL91133.1|  hypothetical protein QW71_36410                       79.0    1e-15   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       79.0    1e-15   
gb|ABB90546.1|  lipid transfer protein                                79.0    1e-15   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  79.0    1e-15   
gb|AAB70538.1|  lipid transfer protein                                79.0    1e-15   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
gb|ADY68820.1|  lipid transfer protein 3                              79.0    2e-15   
gb|ACG43443.1|  nonspecific lipid-transfer protein 4 precursor        78.6    2e-15   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     78.6    2e-15
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           79.0    2e-15   
gb|KHG30577.1|  Non-specific lipid-transfer                           79.0    2e-15   
emb|CBW38498.1|  lipid transfer protein                               78.6    2e-15   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        79.0    2e-15   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           79.0    2e-15   
ref|XP_006403901.1|  hypothetical protein EUTSA_v10010826mg           79.0    2e-15   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
gb|AAY43801.1|  FSLTP3                                                79.0    2e-15   
gb|ACP43542.1|  lipid transfer protein                                79.0    2e-15   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
gb|AHB19226.1|  non specific lipid transfer protein 1B                79.0    2e-15   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    79.0    2e-15   
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  78.6    2e-15   
gb|AFK46170.1|  unknown                                               79.0    2e-15   
gb|ABA34092.1|  phospholipid transfer protein 2                       79.0    2e-15   
ref|NP_001065989.2|  Os12g0115500                                     78.2    2e-15   
ref|XP_006664278.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    2e-15   
gb|ACM78614.1|  lipid transfer protein 2                              78.6    2e-15   
dbj|BAB09776.1|  lipid transfer protein-like                          78.6    2e-15   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    2e-15   
gb|AFV30232.1|  lipid transfer protein                                78.2    2e-15   
gb|ABH03042.1|  non-specific lipid transfer protein                   78.6    2e-15   
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    2e-15   
gb|AAM22768.1|  lipid transfer protein                                77.8    2e-15   
gb|AEN70916.1|  lipid transfer protein                                78.6    2e-15   
ref|XP_004137680.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    2e-15   
gb|ADK36632.1|  lipid transfer-like protein                           77.8    3e-15   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   
ref|XP_004977380.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   78.6    3e-15   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              78.2    3e-15   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  78.2    3e-15   
gb|AEN70919.1|  lipid transfer protein                                78.2    3e-15   
gb|KJB38056.1|  hypothetical protein B456_006G235000                  78.2    3e-15   
ref|XP_003605349.1|  Non-specific lipid-transfer protein              78.2    3e-15   
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  80.5    3e-15   
gb|AFR43295.1|  lipid transfer protein precursor                      78.2    3e-15   
ref|XP_003605345.1|  Non-specific lipid-transfer protein              78.2    3e-15   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               78.2    3e-15   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               78.2    3e-15   
gb|AFR43294.1|  lipid transfer protein precursor                      78.2    3e-15   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
gb|ABA34083.1|  phospholipid transfer protein 2                       78.2    3e-15   
gb|AAY43800.1|  FSLTP2                                                78.2    3e-15   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  78.2    3e-15   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           78.2    3e-15   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           78.6    3e-15   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    3e-15   
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
gb|AEN70933.1|  lipid transfer protein                                78.2    3e-15   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              78.2    4e-15   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  77.8    4e-15   
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    4e-15   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  78.2    4e-15   
gb|AEI70830.1|  non-specific lipid-transfer protein                   77.8    4e-15   
emb|CDM80997.1|  unnamed protein product                              77.8    4e-15   
emb|CBW38499.1|  lipid transfer protein                               77.4    4e-15   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       77.8    4e-15   
gb|ACQ42222.1|  lipid transfer protein 1                              77.8    4e-15   
gb|AAT68262.1|  lipid transfer protein                                77.8    4e-15   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    4e-15   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           79.0    4e-15   
emb|CBW38503.1|  lipid transfer protein                               77.4    4e-15   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    4e-15   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  77.8    4e-15   
gb|ACZ06858.1|  lipid transfer protein                                77.8    4e-15   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           77.8    4e-15   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  77.4    4e-15   
gb|ACB05670.1|  putative non-specific lipid transfer protein          77.8    4e-15   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  77.8    4e-15   
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    4e-15   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  77.8    4e-15   
pir||EPRZ  phospholipid transfer protein homolog - rice               77.0    5e-15
emb|CBW38504.1|  lipid transfer protein                               77.4    5e-15   
gb|AGH32497.1|  non-specific lipid transfer protein                   77.8    5e-15   
gb|AGC08426.1|  lipid transfer protein                                77.8    5e-15   
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              77.4    5e-15   
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  77.8    5e-15   
pir||S33460  lipid transfer protein - sorghum (fragment)              77.0    5e-15
gb|KHN44832.1|  Non-specific lipid-transfer protein 1                 78.2    5e-15   
gb|AHB19227.1|  non specific lipid transfer protein 1A                77.8    5e-15   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 77.4    5e-15   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            77.4    5e-15   
ref|NP_001065583.1|  Os11g0115400                                     77.4    6e-15   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  77.4    6e-15   
emb|CAT99614.1|  lipid transfer protein                               76.6    6e-15   
gb|ABK28789.1|  lipid transfer protein                                77.4    6e-15   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  77.4    6e-15   
ref|NP_001065987.1|  Os12g0115100                                     77.4    6e-15   
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    7e-15   
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    7e-15   
gb|ABO28527.1|  lipid transfer protein                                77.0    7e-15   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          77.0    7e-15   
gb|AAZ32875.1|  lipid transfer protein precursor                      76.3    7e-15   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    7e-15   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  77.0    7e-15   
emb|CAA69949.1|  lipid transfer protein                               77.0    8e-15   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  77.0    8e-15   
gb|ABP01769.1|  lipid transfer protein 2                              77.0    8e-15   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  77.0    8e-15   
prf||2115353B  lipid transfer protein                                 77.0    9e-15
gb|AFK47623.1|  unknown                                               76.6    9e-15   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       77.0    9e-15   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    9e-15   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  76.6    1e-14   
prf||2115353A  lipid transfer protein                                 76.6    1e-14
emb|CBW38497.1|  lipid transfer protein                               76.3    1e-14   
gb|ABA34094.1|  phospholipid transfer protein 2                       76.6    1e-14   
gb|AAF23459.1|AF208833_1  non-specific lipid transfer protein pre...  76.6    1e-14   
ref|NP_001065984.1|  Os12g0114500                                     76.6    1e-14   
emb|CCK33472.1|  lipid transfer protein precursor                     75.9    1e-14   
gb|ABA34096.1|  phospholipid transfer protein 2                       76.6    1e-14   
gb|ABA96281.1|  Nonspecific lipid-transfer protein 5 precursor, p...  76.3    1e-14   
emb|CBW38502.1|  lipid transfer protein                               76.3    1e-14   
gb|ABX56711.1|  LTP isoallergen 1 precursor                           76.6    1e-14   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  75.9    1e-14   
gb|AEI70827.1|  non-specific lipid-transfer protein                   76.3    1e-14   
emb|CDM80963.1|  unnamed protein product                              76.3    1e-14   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    1e-14   
gb|KFK34403.1|  hypothetical protein AALP_AA5G140600                  76.3    1e-14   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
ref|XP_002442773.1|  hypothetical protein SORBIDRAFT_08g002660        76.6    1e-14   
gb|KJB71509.1|  hypothetical protein B456_011G128200                  76.3    1e-14   
gb|KJB71510.1|  hypothetical protein B456_011G128200                  76.3    1e-14   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            76.3    1e-14   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   76.3    1e-14   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    1e-14   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  76.3    2e-14   
gb|AEN70917.1|  lipid transfer protein                                76.3    2e-14   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|ACG25358.1|  nonspecific lipid-transfer protein 2 precursor        76.3    2e-14   
gb|AAC49860.1|  non-specific lipid transfer protein PvLTP-24          76.3    2e-14   
gb|AAT68264.1|  lipid transfer protein                                75.9    2e-14   
gb|AGC08428.1|  lipid transfer protein                                76.3    2e-14   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
gb|AAA70046.1|  lipid transfer protein precursor                      75.5    2e-14   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
ref|NP_001148362.1|  LOC100281973 precursor                           76.3    2e-14   
emb|CAH69194.1|  type 1 non specific lipid transfer protein precu...  75.9    2e-14   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|AAX20049.1|  putative non-specific lipid transfer protein          75.9    2e-14   
ref|XP_006292059.1|  hypothetical protein CARUB_v10018254mg           75.9    2e-14   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  75.9    2e-14   
gb|AAX08122.1|  lipid transfer protein III                            75.9    2e-14   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        75.9    2e-14   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
gb|AGC08425.1|  lipid transfer protein                                76.3    2e-14   
gb|AEG79730.2|  lipid transfer protein precursor                      75.9    2e-14   
gb|ADV02773.1|  lipid transfer protein 1b                             75.1    2e-14   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              75.9    2e-14   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  75.9    3e-14   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  75.5    3e-14   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       75.5    3e-14   
gb|AEN70935.1|  lipid transfer protein                                75.5    3e-14   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  75.5    3e-14   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
gb|AEI70829.1|  non-specific lipid-transfer protein                   75.5    3e-14   
gb|AFI61838.1|  harmalin                                              75.5    3e-14   
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  75.5    3e-14   
emb|CAH04983.1|  type 1 non-specific lipid transfer protein precu...  75.5    3e-14   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  74.7    3e-14   
ref|XP_003577848.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  75.5    3e-14   
ref|XP_004137679.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    3e-14   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           75.5    4e-14   
gb|AEI70826.1|  non-specific lipid-transfer protein                   75.1    4e-14   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    4e-14   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             75.1    4e-14   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    4e-14   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  75.1    4e-14   
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  75.1    4e-14   
ref|XP_010515586.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    4e-14   
gb|AAA03284.1|  CW21=non-specific lipid transfer protein              74.3    4e-14   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  75.1    4e-14   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    4e-14   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    4e-14   
ref|XP_007206596.1|  hypothetical protein PRUPE_ppa020486mg           75.1    4e-14   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           75.1    5e-14   
gb|EMS50623.1|  Non-specific lipid-transfer protein                   75.1    5e-14   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             74.7    5e-14   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    74.7    5e-14   
gb|AAB70541.1|  lipid transfer protein LPT IV                         74.7    6e-14   



>gb|ABG27026.1| phosophlipid protein [Gymnadenia conopsea]
Length=121

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG VASSL  CF YI G  PL   CC GV+ L AAA+TT DRQTAC CLK+L+G++
Sbjct  29   AAISCGQVASSLGRCFSYITGKGPLPQQCCNGVQGLNAAARTTPDRQTACTCLKTLSGRI  88

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP LAAG+PG+CGV++ YPIST+TDCS++H
Sbjct  89   SGLNPNLAAGLPGRCGVSIPYPISTTTDCSRVH  121



>ref|NP_001065585.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|ABA91223.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27430.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|EAZ17209.1| hypothetical protein OsJ_32721 [Oryza sativa Japonica Group]
 dbj|BAG87779.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93418.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87082.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
               N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  86   KSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|EAY79716.1| hypothetical protein OsI_34868 [Oryza sativa Indica Group]
Length=118

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
               N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  86   KSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|AAT80663.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80664.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSDGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>ref|NP_001065988.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|ABA96285.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29007.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|EAY82036.1| hypothetical protein OsI_37222 [Oryza sativa Indica Group]
 gb|EAZ19436.1| hypothetical protein OsJ_34997 [Oryza sativa Japonica Group]
 dbj|BAG88412.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
               N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  86   KSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|ABA96286.1| Nonspecific lipid-transfer protein 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY82041.1| hypothetical protein OsI_37228 [Oryza sativa Indica Group]
 gb|EAZ19437.1| hypothetical protein OsJ_34998 [Oryza sativa Japonica Group]
Length=118

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
               N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  86   KSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>emb|CAG28937.1| lipid transfer protein [Oryza sativa Japonica Group]
 gb|ABA91227.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ17211.1| hypothetical protein OsJ_32723 [Oryza sativa Japonica Group]
 dbj|BAG89260.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
               N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  86   KSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCGTV  SL  C  Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS AG +
Sbjct  80   AAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAI  139

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            SG NP +AAG+PGKCGVN+ Y ISTST+C+ I
Sbjct  140  SGLNPNIAAGLPGKCGVNIPYKISTSTNCATI  171



>ref|XP_009396874.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S+L SC  Y  G  PL+ ACC GVK L +AAKTTADR+TAC C+KS   +LS
Sbjct  26   AITCGQVTSALSSCISYATGKGPLSTACCSGVKSLNSAAKTTADRKTACTCIKSTVSRLS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G   G  AG+PGKCGV++GYPIS STDCSK+
Sbjct  86   GAQAGAIAGIPGKCGVSIGYPISASTDCSKV  116



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|ADB12472.1| lipid transfer protein, partial [Crocus sativus]
Length=91

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ++C TVAS++  C  Y++G   LT ACC GVK LAAAA TT DR+TAC+CLKS+AGK+SG
Sbjct  1    VSCSTVASAISPCIGYVRGQGALTGACCSGVKGLAAAAATTPDRRTACSCLKSMAGKISG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             NP LA G+PGKCG +V Y ISTSTDC+K+
Sbjct  61   LNPSLAKGLPGKCGASVPYVISTSTDCTKV  90



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|EAY79718.1| hypothetical protein OsI_34870 [Oryza sativa Indica Group]
Length=121

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
               N G  AGVPGKCGVNVG+PIS STDC+K
Sbjct  86   KSLNLGTVAGVPGKCGVNVGFPISLSTDCNK  116



>gb|AGN56423.1| non-specific lipid transfer protein 3 [Linum usitatissimum]
Length=103

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VAS +  C  YI+G  PLT ACC G+K L AAA +T DRQ AC CLKS A  + 
Sbjct  14   AITCGRVASGIAPCLGYIRGMAPLTPACCGGIKSLNAAASSTVDRQAACRCLKSAASGVR  73

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCS  270
            G N GLA G+PGKCGVNVG+PIS S +C+
Sbjct  74   GINYGLAGGLPGKCGVNVGFPISQSVNCA  102



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG    +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNVESLPGKCGVNVPYKISTSTNCATV  114



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASS+  C  Y+K    + AACC GV+ L +AAKTTADRQT CNCLK  +G + 
Sbjct  26   AITCGQVASSIAPCVNYVKSGGAVPAACCNGVRSLNSAAKTTADRQTTCNCLKQASGAIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  86   GLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V+SSL  C  Y++    + AACC G+K L +AA TT DRQ  CNCLKSLAGK+
Sbjct  26   AAITCGQVSSSLAQCIGYLQKGGAVPAACCSGLKSLNSAAATTPDRQGVCNCLKSLAGKI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLAAG+P KCGV++ Y IS STDC  + 
Sbjct  86   SGLNYGLAAGLPSKCGVSISYKISPSTDCKTVK  118



>ref|NP_001065586.1| Os11g0116200 [Oryza sativa Japonica Group]
 dbj|BAF27431.1| Os11g0116200 [Oryza sativa Japonica Group]
Length=132

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +
Sbjct  26   AAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
               N G  AGVPGKCGVNVG+PIS STDC+ 
Sbjct  86   KSLNLGTVAGVPGKCGVNVGFPISLSTDCNN  116



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASS+  C  Y+K    + AACC G++ L +AAKTTADRQT CNCLK  +G + 
Sbjct  26   AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  86   GLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>gb|AAF71695.1|AF198168_1 phospholipid transfer protein [Hygrochilus japonicus]
Length=120

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V S+L  C  YI+G   L   CC GVK L A A T+ DRQ AC+CLK+LA  +  
Sbjct  30   ITCGQVVSTLTPCISYIRGDSTLPQTCCSGVKKLNALASTSPDRQGACSCLKNLASHIPN  89

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AAG+PG CGV+V YPISTSTDCSK+ 
Sbjct  90   LNPARAAGLPGNCGVSVPYPISTSTDCSKVR  120



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V SSL  C  Y+K   P+   CC G+K+L +AA+TTADRQTAC CLKSL+G +
Sbjct  27   AAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNSAAQTTADRQTACKCLKSLSGSI  86

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             G N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  87   PGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCGTV  SL  C  Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS AG +
Sbjct  452  AAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAI  511

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP +AAG+PGKCGVN+ Y ISTST+C+ I 
Sbjct  512  SGLNPNIAAGLPGKCGVNIPYKISTSTNCATIR  544


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +
Sbjct  23   AAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLW  294
            SG N   A+ +PGKCGVN+ Y ISTST+C +     +W
Sbjct  83   SGLNTAAASALPGKCGVNIPYKISTSTNCHQGMKMMMW  120



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V  ++  CF Y+K    + AACC GV++L + AKTTADRQ  CNCLK+ AG + 
Sbjct  26   AITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGV+V Y ISTST+C+ + 
Sbjct  86   GLNPSLAAGLPGKCGVSVPYKISTSTNCATVK  117



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+
Sbjct  26   AAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLAAG+P KCGV++ Y IS STDC  + 
Sbjct  86   SGINYGLAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_009384323.1| PREDICTED: non-specific lipid-transfer protein-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI CG + S L+ C  Y +GT PLT  CC GV+ L  AA+TT DRQ  CNCLK  A  +
Sbjct  25   AAIGCGQIISYLIPCLGYAQGTGPLTDGCCSGVRALNGAAQTTPDRQATCNCLKRSAAGV  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG  PGL AG+P KCG+NV Y IS STDCS++ 
Sbjct  85   SGIQPGLIAGIPSKCGINVPYRISPSTDCSRVR  117



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V  ++  CF Y+K    + AACCKGV +L + AKTTADRQ  CNCLKS AG + G
Sbjct  27   ITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKG  86

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             N  LAAG+PGKCGVNV Y ISTST+C+ +
Sbjct  87   LNANLAAGLPGKCGVNVPYKISTSTNCNNV  116



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=116

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V  ++  CF Y+K    + AACC G++ L +AAKTTADR+  CNCLKS AG + 
Sbjct  25   AITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIK  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N  LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  85   GLNANLAAGLPGKCGVNVPYKISTSTNCNNVK  116



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+
Sbjct  26   AAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G+AAG+P KCGV++ Y IS STDC  + 
Sbjct  86   SGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_011466421.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=116

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V  ++  CF Y+K    + AACC G++ L +AAKTTADR+  CNCLKS AG + 
Sbjct  25   AITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIK  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N  LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  85   GLNANLAAGLPGKCGVNVPYKISTSTNCAAVK  116



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+
Sbjct  26   AAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G+AAG+P KCGV++ Y IS STDC  + 
Sbjct  86   SGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASS+  C  Y+K    + AACC G++ L +AAKTTADRQ  CNCLK  +G + 
Sbjct  26   AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGV+V Y ISTST+C+ + 
Sbjct  86   GLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK  117



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V SSL  C  Y++    +  ACC G++ + + A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRNGGAVPPACCNGIRTINSLARTTADRQTACNCLKNLAGSIS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V+SSL  C  Y++    L  ACC G+K L +AAKTT DRQ  CNCLKSLAGK+
Sbjct  26   AAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSAAKTTPDRQGVCNCLKSLAGKI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLAAG+P KCGV++ Y IS +TDC  + 
Sbjct  86   SGLNYGLAAGLPSKCGVSIPYKISPATDCKTVK  118



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++G  P+  ACC G++ + + A+TT DRQ  CNCLKSLA  +S
Sbjct  24   AITCGQVSSNLAPCIGYLRGGGPVPPACCNGIRTINSLAETTPDRQAVCNCLKSLASSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCS  270
            G NPG A  +PGKCGVNV Y ISTST+C+
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCT  112



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VAS++  C  Y+K    + AACC G+++L   AKTTADRQ ACNCLK  AG + 
Sbjct  26   AITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGV+V Y IST+T+C+ + 
Sbjct  86   GLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK  117



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+TCG V+ SL SC  Y+KG    + ACC G+K L   A+T  DR+TAC CLKS A  +S
Sbjct  28   ALTCGQVSGSLASCISYLKGAPGPSGACCGGIKRLNGMAQTPPDRKTACGCLKSAAAAIS  87

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N GLA  +PGKCGV++ YPIS +TDCS++H
Sbjct  88   GINYGLANALPGKCGVSIPYPISPNTDCSRVH  119



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASS+  C  Y++    + A+CC GV+ LA +AKTTADR+T CNCLKS A ++S
Sbjct  27   AITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKSTAARIS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G  P LAAG+P KCGV + + IS STDCSK+
Sbjct  87   GIKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++    +  ACC G+K + A AKTT DRQ ACNCLKSL+G +S
Sbjct  24   AITCGQVSSNLAPCINYVRSGGAVPPACCNGIKTINALAKTTPDRQAACNCLKSLSGSIS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG
Sbjct  1    ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  61   VNPNNAAGLPGKCGVNVPYKISTSTNCATVK  91



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC TVA  L +C  Y++    + A CC G++ L + AKTT DR+TAC+CLKSLAG++ 
Sbjct  27   AITCNTVAGDLGACLGYLQKGGAVPAGCCTGIRSLNSQAKTTVDRRTACSCLKSLAGRVR  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              N GLAAG+PGKCGVNVGYPISTST+C+ + 
Sbjct  87   -VNQGLAAGLPGKCGVNVGYPISTSTNCNSVQ  117



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASS+  C  Y+K    + A CC G++ L +AAKTTADRQT CNCLK  +G + 
Sbjct  26   AITCGQVASSIAPCVNYVKSGGAVPAGCCNGIRSLNSAAKTTADRQTTCNCLKQASGAIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGK GVNV Y ISTST+C+ + 
Sbjct  86   GLNPNLAAGLPGKXGVNVPYKISTSTNCAAVK  117



>ref|XP_003579021.1| PREDICTED: probable non-specific lipid-transfer protein 3 [Brachypodium 
distachyon]
Length=123

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AA+TCG V SS+  C  Y+ G    ++  CC G++ L   A+TTADRQ AC CLKS+AG 
Sbjct  30   AAVTCGQVGSSIAPCVAYVTGKAAAVSPGCCSGIRGLNNMARTTADRQAACRCLKSMAGS  89

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            +   N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  90   IKALNMGKVAGVPGKCGVNVGFPISMSTDCNKV  122



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEP-LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG VASS+ SC  Y++GT P +  +CC GVK L  AA TTADRQ AC CLK  +G + 
Sbjct  28   ITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIP  87

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NPGLAAG+PGKCGV+V Y ISTST+C  + 
Sbjct  88   GLNPGLAAGLPGKCGVSVPYKISTSTNCKAVK  119



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V SSL  C  Y KG   +  ACC G++ +   A+TTADRQ ACNCLK+LAG + 
Sbjct  24   AITCGQVTSSLAPCINYAKGGGVVPPACCNGIRTINGIARTTADRQAACNCLKNLAGSIR  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AA +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAALPGKCGVNVPYKISTSTNCATV  114



>dbj|BAI94496.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA+TCG V+ +L  C  Y+KG    +A CC G+K L   A+T  DR+TAC CLKS A  +
Sbjct  27   AAMTCGQVSGNLGPCITYLKGAPGPSALCCAGIKRLNGMAQTPPDRKTACGCLKSAAAAI  86

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLA+G+PGKCGV++ YPIS STDCSK++
Sbjct  87   SGLNYGLASGLPGKCGVSIPYPISPSTDCSKVN  119



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V SSLV+C  Y++     T ACC GVK L  AAKTTADRQ AC CLK+ AG +
Sbjct  26   AAISCGQVQSSLVACIPYLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG +P  AA +PGKCGVNV Y ISTST+C  + 
Sbjct  86   SGLSPANAASLPGKCGVNVPYKISTSTNCKNVK  118



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V SSLV+C  Y++     T ACC GVK L  AAKTTADRQ AC CLK+ AG +
Sbjct  26   AAISCGQVQSSLVACIPYLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG +P  AA +PGKCGVNV Y ISTST+C  + 
Sbjct  86   SGLSPANAASLPGKCGVNVPYKISTSTNCKNVK  118



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYKISASTNCATVK  117



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCGTV  SL  C  Y+K   P+  ACC G+K L AAAKTTADRQ ACNCLK+ +  +
Sbjct  28   AAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTADRQAACNCLKTASTSI  87

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +G N   A+ +PGKCGVNV Y IS STDCSK+ 
Sbjct  88   AGINLSYASSLPGKCGVNVPYKISPSTDCSKVQ  120



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYKISISTNCAAVK  117



>ref|XP_006663744.1| PREDICTED: probable non-specific lipid-transfer protein 3-like 
[Oryza brachyantha]
Length=116

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAITCG V +++  C  Y+ G +  L+  CC GVK L +AA++TADRQ AC CLKSL G 
Sbjct  23   AAITCGQVGTAIAPCIPYVTGRSSALSQGCCNGVKGLNSAARSTADRQAACRCLKSLVGT  82

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +   N G AAG+P KCGVNVG+PI  STDC+K+ 
Sbjct  83   VKSLNLGTAAGIPAKCGVNVGFPIRLSTDCNKVR  116



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG + S+L+ C  YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS AG  
Sbjct  23   AAITCGAIVSALIPCTAYIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSAAGSF  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            S FN G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  83   SRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG +AS+L+ C  YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS AG  
Sbjct  23   AAITCGAIASALIPCTAYIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSAAGSF  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              FN G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  83   PRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+TCG V SS+  C  Y+ G    T ACC GVK L + A T ADR+ AC CLKS AG ++
Sbjct  26   ALTCGQVTSSMTPCMSYLTGGGSPTPACCGGVKSLNSMASTPADRKAACGCLKSAAGAMT  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              N G AA +PGKCG+++ YPISTSTDCSK++
Sbjct  86   NLNMGNAASLPGKCGISLPYPISTSTDCSKVN  117



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VAS++  C  Y+K    + A CC G+++L   AKTTADRQ  CNCLK  AG + 
Sbjct  26   AITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP LAAG+PGKCGV+V Y IST+T+C+ + 
Sbjct  86   GLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK  117



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAI+CG V+S+L  C  Y +G   +P   ACC GVK LA AA++TAD+Q AC CLKSLA 
Sbjct  25   AAISCGQVSSALSPCISYARGNGAKP-PVACCSGVKRLAGAAQSTADKQAACRCLKSLAT  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             + G N G  +GVPGKCGV+V +PIS STDC+K+H
Sbjct  84   SIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKVH  118



>emb|CAA80809.1| lipid transfer protein [Oryza sativa Indica Group]
Length=117

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G  P +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  26   AAISCGQVNSAVSPCLSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y IS S DCS+++
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSRVN  117



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +SG
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK  91



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA+TCG V SSL SC  Y++ T PL   CC GVK L   A+TTADRQTACNCLKS AG +
Sbjct  24   AALTCGQVTSSLFSCLPYLRNTGPL-GDCCSGVKKLKGQAQTTADRQTACNCLKSTAGSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N G AA +P  C VN+ Y IS STDCSK+ 
Sbjct  83   KGLNFGKAASLPSTCSVNIPYEISPSTDCSKVQ  115



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASSL  C  Y++     +A+CC GVK L +AA TTADR+TACNCLK+LAG  S
Sbjct  25   AITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKS  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G N G AA +PGKC VNV Y ISTST+C+ I
Sbjct  85   GINEGNAASLPGKCKVNVPYKISTSTNCANI  115



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+S+L  C  Y+KG   +  ACC G++++   A+TTADR+ ACNCLK L+G + G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AA +PGKCGVNV Y IS ST+C+ + 
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK  91



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI C TVAS +  C  Y+ G  PL   CC GVK L  AA+TT DRQ  CNCLK+LA   
Sbjct  24   AAIGCNTVASKMAPCLPYVTGKGPL-GGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSY  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AAG+PGKCGV++ Y IS +TDCSK+H
Sbjct  83   SGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH  115



>gb|AET05730.1| lipid transfer protein isoform a, partial [Pyrus communis]
Length=94

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC  V+S+L  C  Y++    +  ACC G+K +   A TT DRQ ACNCLK+LAG +S
Sbjct  3    AITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVS  62

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  63   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  93



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            +TCG V+S + +C  Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ AG + G
Sbjct  26   LTCGQVSSGMAACLTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTAAGNVPG  85

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCS  270
             NP +AAG+PGKCGV + Y ISTST+C+
Sbjct  86   LNPAIAAGLPGKCGVKIPYKISTSTNCN  113



>ref|XP_009398877.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+TCG V S L SC  Y +G   LT +CC GV+ L  AAKTT DRQTAC+CLKS    L 
Sbjct  26   ALTCGQVVSFLQSCIPYARGQGLLTKSCCSGVRSLNDAAKTTPDRQTACSCLKSTVAGLK  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G   G  AG+PGKCGV+V YPISTS DCSK+ 
Sbjct  86   GIQSGTVAGIPGKCGVSVPYPISTSVDCSKVK  117



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            +TCG V+S + +C  Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ AG + G
Sbjct  26   LTCGQVSSGMAACLTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTAAGNVPG  85

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCS  270
             NP +AAG+PGKCGV + Y ISTST+C+
Sbjct  86   LNPAIAAGLPGKCGVKIPYKISTSTNCN  113



>pdb|1T12|A Chain A, Solution Structure Of A New Ltp1
Length=91

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S+L  C  Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS AG +S
Sbjct  1    AITCGQVTSNLAPCLAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS  59

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  60   GINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  91



>ref|XP_009132019.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brassica 
rapa]
 emb|CDX88678.1| BnaA03g09710D [Brassica napus]
Length=125

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            A I+CGTV  S+  C  Y+ G   LTAACC GV+DL A A+TT DRQ  C CL+++A K+
Sbjct  22   APISCGTVVQSMSPCITYLSGRMDLTAACCGGVRDLNAIAQTTPDRQQTCKCLQAVAKKI  81

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             GFN   A+ +PGKC V+  +PIS ST+C  +H
Sbjct  82   PGFNQTRASDLPGKCRVSFPFPISISTNCDNVH  114



>dbj|BAK05751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            A+TCG V SS+  C  Y  G     +A CC GV+ L   A T ADRQ AC CLK+LAG  
Sbjct  25   AVTCGDVTSSIAPCMSYATGKASAPSAGCCSGVRSLNGKASTAADRQAACRCLKNLAGSF  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G + G AAG+PGKCGV+V +PISTS DC+K+H
Sbjct  85   KGISMGNAAGIPGKCGVSVSFPISTSVDCNKLH  117



>gb|ADV02772.1| lipid transfer protein 1a [Ipomoea batatas]
Length=120

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAITCG++ + L SC  Y++G  T    AACC  +K + + A TT DRQ AC CLK +AG
Sbjct  26   AAITCGSMVAKLSSCLSYVQGKVTGGPPAACCGAIKSINSVATTTPDRQAACKCLKQMAG  85

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              S  N G+ + +P KCGVN+GYPISTS DC+K+H
Sbjct  86   SYSSVNMGVVSSLPSKCGVNIGYPISTSVDCAKVH  120



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++    +  ACC G++ +   A+TT DR+ ACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCINYVRKGGVVPPACCNGIRAVNGLARTTPDRRAACNCLKQLSGSIS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AAG+PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAGLPGKCGVNIPYKISASTNCATVK  117



>sp|P80273.2|NLTP3_VITSX RecName: Full=Non-specific lipid-transfer protein P3; Short=LTP 
P3 [Vitis sp.]
Length=91

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ++CG VA+ + SC  Y++G  PL AACC GVK+L  +A TT DR+TAC CL S +  +SG
Sbjct  1    LSCGDVATQMASCINYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N GLAAG+P KCGV++ Y IS ST+C +++
Sbjct  61   VNFGLAAGLPAKCGVSIPYKISPSTNCDQVN  91



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            A +TCGTVA+ L  C  Y++    + A CC G++ L +AA TT DRQT CNC+KS AG +
Sbjct  26   AVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRSLFSAASTTQDRQTVCNCMKSAAGAI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N  LAA +P KCGVN+ Y IS S DC+K+ 
Sbjct  86   SGVNLNLAAALPNKCGVNIPYKISPSIDCAKVQ  118



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCGTV S L SC  Y+    PL  +CC GVK L  AAKTT DRQ+ CNCLKSLA   
Sbjct  27   AAITCGTVVSDLDSCLSYLTNKGPL-GSCCSGVKGLYGAAKTTQDRQSVCNCLKSLADSY  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +  +   AAG+PG+CGVN+ Y IS STDCS +H
Sbjct  86   TDVDLSKAAGLPGQCGVNIPYKISPSTDCSTVH  118



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S L  C  Y +   P+ A CC GVK L AAAK+T DRQTAC+CLK  A  +S
Sbjct  27   AITCGQVVSFLTPCIAYARNGGPIPAGCCSGVKGLVAAAKSTPDRQTACSCLKRAAASIS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N GL AGVP KCGV + Y IS STDCSK+ 
Sbjct  87   GLNTGLIAGVPAKCGVRIPYSISPSTDCSKVK  118



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC  V+++L  C  Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +S
Sbjct  3    AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVS  62

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  63   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  93



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +
Sbjct  23   AAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N   A+ +PGKCGVN+ Y ISTST+C+ I 
Sbjct  83   SGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>ref|XP_009410515.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S L  C  Y +   PLTA CC GV+ L  AA+TT DRQT CNCLK     +
Sbjct  22   AAISCGQVVSYLTPCLGYARAIGPLTAGCCSGVRALDGAARTTPDRQTTCNCLKRSTAGI  81

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             G  PGL +G+P KCGVN+ Y I  STDCS++
Sbjct  82   QGLQPGLISGIPRKCGVNIPYSIGPSTDCSRV  113



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI CGTV S L SCF Y+ GT  L   CCKG+KDL AAA+TTADRQ+ C+CLK LA   
Sbjct  27   AAIGCGTVVSYLNSCFPYVTGTGAL-GGCCKGIKDLYAAAQTTADRQSVCDCLKDLAAST  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +G + G AAG+P +CG+N+ Y I  STDCSK+ 
Sbjct  86   TGVDLGKAAGLPSQCGLNIPYKIIPSTDCSKVQ  118



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +
Sbjct  23   AAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N   A+ +PGKCGVN+ Y ISTST+C+ I 
Sbjct  83   SGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>gb|AFD32273.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC+GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYSRNGGEIPPGCCEGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y+KG   +  ACCKG++ ++  AKTTADRQ ACNCLK L+G +S
Sbjct  26   AITCGQVSSNLAPCIPYVKGGGAVPPACCKGIRTVSGLAKTTADRQAACNCLKQLSGSIS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVNV Y I+T  +C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNVPYKINTFINCAAVK  117



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V +SL  C  Y++    + AACC G+K L + A +T DRQTACNC+KS A  +
Sbjct  25   AAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSAARSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLA+ +PGKCGVN+ Y IS S DCS + 
Sbjct  85   SGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S+L  C  Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS AG +S
Sbjct  24   AITCGQVTSNLAPCLAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS  82

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  83   GINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  114



>emb|CAT99615.1| lipid transfer protein [Malus domestica]
Length=82

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  16   GTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNP  195
            G V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NP
Sbjct  1    GQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNP  60

Query  196  GLAAGVPGKCGVNVGYPISTST  261
            G A  +PGKCGVNV Y ISTST
Sbjct  61   GNAESLPGKCGVNVPYKISTST  82



>gb|ACJ62320.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62321.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62322.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62327.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62334.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62336.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62359.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62360.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62386.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AAP92127.1| lipid transfer protein LPT1 [Oryza sativa]
Length=118

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G  P +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  26   AAISCGQVNSAVSPCLSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
            SG N G AA +P KCGV++ Y IS S DCS+
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSR  115



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC  V+++L  C  Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +S
Sbjct  24   AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVS  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|AFD32275.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=114

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  22   SAITCGQVDSDLTSCLAYARNGGQIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  81

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  82   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  114



>gb|ABA33862.1| phospholipid transfer protein 1, partial [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=111

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A  
Sbjct  18   AAISCGQVASAIAPCISYARGQGSAPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAG  77

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  78   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  111



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV+ +LV C  Y+KG    +  CC GVK L  AA+TT DR+ ACNCLKS AG +
Sbjct  25   AAISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG  PG  A +PGKCGV + Y ISTST+C+ I 
Sbjct  85   SGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR  117



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y+KG   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVKGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYQISPSTNCANVK  117



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA+TCG V SSL+ C  Y++G    + ACC G+K L + A T ADR+TAC CLKS A  +
Sbjct  24   AAVTCGQVTSSLLPCLGYLQGGASPSPACCGGIKSLNSMASTPADRKTACGCLKSAAASV  83

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G +   A+G+PGKC V++ YPISTSTDCSK++
Sbjct  84   KGIDMSAASGLPGKCDVSIPYPISTSTDCSKVN  116



>gb|ACJ62316.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62332.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62333.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62337.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62380.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62382.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62383.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62384.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62385.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  25   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V S L  C  Y+K     TAACC GVK L + A T ADR+ AC CLKS A  +
Sbjct  26   AAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPADRKAACGCLKSAAASI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N   A+ +P KCGV++ YPISTS DC+K++
Sbjct  86   SGMNTAAASSLPSKCGVSIPYPISTSVDCAKVN  118



>emb|CDM80995.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+AG
Sbjct  25   AAISCGQVSSALAPCVAYAKGSGTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVAG  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
               G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  84   ---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  115



>gb|AFX65219.1| lipid transfer precursor protein, partial [Triticum aestivum]
Length=121

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+AG
Sbjct  31   AAISCGQVSSALTPCVAYAKGSGTSP-SGACCNGVRKLAGLARSTADKQATCRCLKSVAG  89

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
               G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  90   ---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  121



>ref|XP_009396871.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S L  C  Y  G   LT+ CC GVK L +AAKT+ADR+TAC C+KSL  + S
Sbjct  25   AITCGQVTSDLSPCIPYATGKGSLTSGCCNGVKSLNSAAKTSADRKTACTCIKSLVSRFS  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              N G+ +G+PGKCGV++ Y IS STDCSK++
Sbjct  85   SANTGVVSGIPGKCGVSIPYTISPSTDCSKVN  116



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V+++L  C  Y++G    +A CC GV++L +AA TT DRQ ACNCLKS AG +
Sbjct  23   SAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            S  N   AA +PGKCGVN+ Y ISTST+C+  H
Sbjct  83   SRLNANNAAALPGKCGVNIPYKISTSTNCATYH  115



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+ AG +
Sbjct  25   AAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            SG N G AA +P KCGV++ Y ISTS DCS++
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLT-AACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AITCG V S+LV C  Y+K T P   A CC GV+ +  AAKTTADR+TAC CLKS AG +
Sbjct  24   AITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSV  83

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G NP   AG+PGKCGVN+ Y IS ST+C+ + 
Sbjct  84   KGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK  116



>gb|AAK20395.1|AF334185_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAV28706.1| lipid transfer protein [Triticum aestivum]
 emb|CAH69208.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+AG
Sbjct  25   AAISCGQVSSALTPCVAYAKGSGTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVAG  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
               G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  84   ---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  115



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+ AG +
Sbjct  25   AAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            SG N G AA +P KCGV++ Y ISTS DCS++
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+ ++  C  Y++    +  +CC G++ L  AAKTTADR+TACNCLKS AG++ 
Sbjct  27   AITCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLVGAAKTTADRRTACNCLKSAAGRIP  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G  PGLAAG+PGKCGV+V +PISTS +C+ +
Sbjct  87   GLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  25   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  117



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV++L +AA TTADR+TACNCLK++AG +
Sbjct  26   AAISCGQVNSAVSPCLSYPRGGSGPSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AA +PGKCGVN+ Y IS ST+C+ +
Sbjct  86   GVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  26   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>ref|XP_010035997.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW47517.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=118

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITC  ++SS+  C  Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G
Sbjct  28   ITCSQISSSMGPCIGYLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQG  87

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             +  LAAG+PGKCGV+V Y IS +TDC  + 
Sbjct  88   IDFNLAAGLPGKCGVSVPYKISPTTDCKSVK  118



>ref|NP_001150972.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
 gb|ACG41114.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
Length=122

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V SSL  C  Y  G    L A+CC GVK L +AA+T+ADRQ AC CLKSLA  + 
Sbjct  31   ITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVK  90

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
              N G  A +PGKCGV+VG+PIS STDC+KI
Sbjct  91   SVNMGTVATIPGKCGVSVGFPISMSTDCNKI  121



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A  
Sbjct  17   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAG  76

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  77   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  110



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  18   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  77

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  78   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  110



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASSL  C  Y++     +A+CC GVK L +AA TTADR+TACNCLK+LAG  S
Sbjct  25   AITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKS  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G N G AA +PGKC VNV Y IST T+C+ I
Sbjct  85   GINEGNAASLPGKCKVNVPYKISTFTNCANI  115



>ref|NP_001142300.1| uncharacterized protein LOC100274469 precursor [Zea mays]
 gb|ACF79347.1| unknown [Zea mays]
 gb|ACF86436.1| unknown [Zea mays]
 gb|ACF88133.1| unknown [Zea mays]
 gb|ACR36788.1| unknown [Zea mays]
 tpg|DAA59276.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V SSL  C  Y  G    L A+CC GVK L +AA+T+ADRQ AC CLKSLA  + 
Sbjct  32   ITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVK  91

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
              N G  A +PGKCGV+VG+PIS STDC+KI
Sbjct  92   SVNMGTVATIPGKCGVSVGFPISMSTDCNKI  122



>ref|XP_004978531.1| PREDICTED: non-specific lipid-transfer protein 3-like [Setaria 
italica]
Length=121

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG VASSL  C  Y  G  + + + CC GV+ L +AA+T+ADRQ AC CLKSLAG + 
Sbjct  30   ITCGQVASSLAPCIPYATGNAKAMPSGCCGGVRSLNSAARTSADRQAACRCLKSLAGSIK  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
              N G  AG+PGKCGV+V +PIS STDC+K+
Sbjct  90   KLNMGTVAGIPGKCGVSVPFPISMSTDCNKV  120



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++G   +  ACC G++D+   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRDVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_010483551.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A  L
Sbjct  23   AAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG +P LA+G+PGKCGV++ YPIS ST+C  + 
Sbjct  83   SGLDPSLASGLPGKCGVSIPYPISMSTNCDNVK  115



>sp|P85105.1|NLTP5_VITSX RecName: Full=Non-specific lipid-transfer protein P5; Short=LTP 
P5 [Vitis sp.]
Length=91

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG
Sbjct  1    LSCGDVATQLAPCINYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  61   VNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  91



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y+ G   +  ACC G++++   A TTADRQ ACNCLK L+G + 
Sbjct  26   AITCGQVSSNLAPCIPYVIGGGAVPPACCNGIRNVDNLANTTADRQAACNCLKQLSGSIP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS+ST+C+ + 
Sbjct  86   GVNPNNAASLPGKCGVNIPYNISSSTNCATVK  117



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  26   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  85

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  86   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  119



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S L  C  Y +    + A CC GVK L AAA+TTADR+TAC CLK+ A  LS
Sbjct  27   AITCGQVVSYLTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKNTAAGLS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G  PGL +G+PGKCGV V Y IS STDCS++
Sbjct  87   GLKPGLISGIPGKCGVRVPYAISPSTDCSRV  117



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_010443685.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A  L
Sbjct  23   AAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG +P LA+G+PGKCGV++ YPIS ST+C  + 
Sbjct  83   SGLDPSLASGLPGKCGVSIPYPISMSTNCDNVK  115



>ref|XP_010454878.1| PREDICTED: non-specific lipid-transfer protein 3-like [Camelina 
sativa]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A  L
Sbjct  23   AAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG +P LA+G+PGKCGV + YPIS ST+C  + 
Sbjct  83   SGLDPSLASGLPGKCGVTIPYPISMSTNCENVK  115



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  16   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  75

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  76   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|ABA33866.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=114

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  21   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  80

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  81   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  114



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V   L  C  +++   P  A CC  +K L +  ++T DR+ AC CLKS A   
Sbjct  26   AAITCGMVTQKLAPCLTFLQRGGPPAAGCCGAIKSLNSMVRSTPDRKAACGCLKSAAKSF  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N G AA +PGKCGVN+GYPISTS DCS++ 
Sbjct  86   PGINMGNAAALPGKCGVNIGYPISTSVDCSRVK  118



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V+++L  C  Y++G    +A CC GV++L +AA TT DRQ ACNCLKS AG +
Sbjct  23   SAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            S  N   AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  83   SRLNANNAAALPGKCGVNIPYKISTSTNCATIR  115



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  26   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV + Y IS S DCS ++
Sbjct  86   SGLNAGNAASIPSKCGVTIPYTISPSIDCSSVN  118



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG V+S++  C  Y +G     +A CC GV+ L +AA+TTADR+ ACNCLK+ A  
Sbjct  26   AAISCGQVSSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARG  85

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV+V Y ISTSTDCS+++
Sbjct  86   ISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVN  119



>gb|AFD32274.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGEIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +
Sbjct  23   AAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N   A+ +PGKCGVN+ Y ISTST+C+ + 
Sbjct  83   SGLNTAAASALPGKCGVNIPYKISTSTNCATVR  115



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            ITCG V+S++  C  Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +
Sbjct  30   ITCGQVSSAIAPCLSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGV  88

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  89   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ABA33860.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=109

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  16   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  75

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  76   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  23   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  82

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  83   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>ref|XP_002442774.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
 gb|EES16612.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
Length=123

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V S++  C  Y +GT    +AACC GV+ L +AA +TAD++TACNCLKS AG++SG 
Sbjct  34   CGQVNSAISPCLAYARGTGTAPSAACCSGVRSLNSAASSTADKRTACNCLKSAAGRVSGL  93

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGVN+ Y IS S DCS+++
Sbjct  94   NAGNAASIPSKCGVNIPYTISASIDCSRVN  123



>gb|ACJ62387.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            ITCG V+S++  C  Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +
Sbjct  25   ITCGQVSSAIAPCLSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGV  83

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  84   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA+TCGTV S+L  C  Y++    + A+CC+GV  L +AAKTTADRQ AC+CLKS    +
Sbjct  27   AALTCGTVTSALSPCITYVRNGGSVPASCCQGVAALNSAAKTTADRQAACSCLKSALSSV  86

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG  P LA+ +PGKCGV++ Y IS STDCSK+ 
Sbjct  87   SGIQPSLASSLPGKCGVSIPYQISPSTDCSKVK  119



>ref|XP_008442324.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=117

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AA+TCG+VA+++  C  Y++  +  + A CC G++ L   A TTADR+TACNCLKS A  
Sbjct  24   AAVTCGSVATAMGPCIPYLRSPSASVPAGCCSGIRSLNGQAATTADRRTACNCLKSAAKS  83

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N   AAG+PGKCGV++ YPIS +TDCS+++
Sbjct  84   ISGINYKAAAGLPGKCGVSISYPISPNTDCSRVN  117



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA++CG V +SL  C  Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK     +
Sbjct  29   AAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQAVNGI  88

Query  181  --SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLWESAG  306
              +  N GLAAG+PGKCGVN+ Y IS STDC       LW+ A 
Sbjct  89   PYTNANAGLAAGLPGKCGVNIPYKISPSTDCKASSERFLWKPAA  132



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V SSL  C  Y+     + A CC G+K L   A +T DRQTACNC+KS  G +
Sbjct  25   AAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAVGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N GLA+ +PGKCGVN+ Y IS S DCS + 
Sbjct  85   SGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|KCW47519.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=116

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITC  ++SS+  C  Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G
Sbjct  28   ITCSQISSSMGPCIGYLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQG  87

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDC  267
             +  LAAG+PGKCGV+V Y IS +TDC
Sbjct  88   IDFNLAAGLPGKCGVSVPYKISPTTDC  114



>gb|AHB19225.1| non specific lipid transfer protein 1C [Punica granatum]
Length=120

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            A ITCG V+SSL  C +Y +G    P+  ACC G++ L +AAKTT DRQ AC CLKSLA 
Sbjct  26   AGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLAS  85

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             +SG N GL AG PGKCGV++ Y I+ ST+C  + 
Sbjct  86   SISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK  120



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG
Sbjct  28   LSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISG  87

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  88   VNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  118



>ref|XP_007134701.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
 gb|ADC80503.1| non-specific lipid transfer protein 1b precursor [Phaseolus vulgaris]
 gb|ESW06695.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
Length=118

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V SSL SC  ++    P+ A+CC GV+ L AAAKTT DRQ  CNCLKS AG +
Sbjct  25   AAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             GFN   A  +PGKCGV++ Y ISTST+C+ I
Sbjct  85   PGFNANNAGILPGKCGVSIPYKISTSTNCATI  116



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG
Sbjct  49   LSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISG  108

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  109  VNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  139



>gb|ABA34089.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34091.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
            G N G AA +P KCGV++ Y ISTSTDCS+
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSR  119



>gb|AFD32272.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V SSL SC  Y +    +   CC GV+ L   AKTT DR+TACNCLKSL    
Sbjct  21   SAITCGQVVSSLTSCLGYARKGGEIPPGCCAGVRTLNNLAKTTPDRKTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGV++ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVSIPYPISMQTDCNKVR  113



>gb|AEV12221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>dbj|BAH03575.1| nonspecific lipid transfer protein [Citrus jambhiri]
Length=115

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG + 
Sbjct  24   AITCGQVSSALAPCIFYLRAGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIP  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              NP  A G+P  CGV++ Y IS STDCSK+ 
Sbjct  84   NLNPNNAVGLPRACGVSIPYKISISTDCSKVR  115



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI CGTV S L  C  Y+ GT  L   CCKG+ DL AAA+TTADRQ+ C CLK LA   
Sbjct  27   AAIGCGTVVSYLNPCLPYVTGTGAL-GGCCKGINDLYAAAQTTADRQSVCGCLKDLAAST  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AAG+P +CG+N+ Y IS STDCSK+ 
Sbjct  86   SGVNLGKAAGLPSQCGLNIPYKISPSTDCSKVQ  118



>gb|AAQ74627.1| lipid transfer protein I [Vigna radiata]
Length=117

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VASSL SC  +I     +  +CC GVK L AAAKTT DRQ  CNCLKS AG++ 
Sbjct  25   AITCGQVASSLTSCIPFITKGGIVPPSCCAGVKSLNAAAKTTPDRQAVCNCLKSEAGRIG  84

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            GFN   AA +PGKCGV++ Y ISTST+C+ I
Sbjct  85   GFNANNAAILPGKCGVSIPYKISTSTNCASI  115



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG +AS L  C  Y     PL  ACC GV+ L +AAKTTADRQ  C CLKS A  +
Sbjct  30   AAISCGQLASLLSPCVNYFVKGGPLPPACCSGVRTLNSAAKTTADRQATCQCLKSAAASI  89

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N GLA  +PGKCGVN  Y IS STDCS++ 
Sbjct  90   PGLNLGLANSIPGKCGVNFPYKISPSTDCSRVR  122



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA++CGTV   L  C  Y+ G    T +CC GVK L AAA TTADRQ ACNCLK+ AG +
Sbjct  25   AAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +  NPG AA +PGKC VN+ Y IST+T+C+ I 
Sbjct  85   NNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK  117



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V++S+  C  Y+ G   +  ACC G++++   AKTTADRQ ACNCLK L+G + 
Sbjct  26   AITCGQVSNSVAPCIPYVIGGGAVPPACCNGIRNVENLAKTTADRQAACNCLKQLSGSIP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVNV Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNVPYKISISTNCAAVK  117



>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Capric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Lauric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Myristic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Palmitoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Stearic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Oleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Alpha-Linolenic Acid 
Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Ricinoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15 
Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With 
Palmitate
Length=93

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +
Sbjct  1    AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV  60

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  61   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  93



>sp|Q43871.1|NLTP8_HORVU RecName: Full=Non-specific lipid-transfer protein Cw18; Short=LTP 
Cw-18; AltName: Full=PKG2316; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48622.1| Cw-18 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 emb|CAA85483.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK01310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAITCG V+S+L  C  Y KG  T P +A CC GVK LA  A++TAD+Q  C CLKS+AG
Sbjct  25   AAITCGQVSSALGPCAAYAKGSGTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
                +N G AAG+P +CGV+V Y IS S DCSKIH
Sbjct  84   ---AYNAGRAAGIPSRCGVSVPYTISASVDCSKIH  115



>ref|XP_006662670.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
 ref|XP_006663742.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
Length=119

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AA++CG V S++  C  Y+ G     +++CC GVK L   A ++ADR+TAC+CLKS+AG 
Sbjct  26   AAVSCGDVTSAIAPCLSYVTGRMSAPSSSCCSGVKTLNGKASSSADRRTACSCLKSMAGS  85

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +   N G AA +P KCGV+V +PISTS DCSKI+
Sbjct  86   VRNLNMGNAATIPSKCGVSVAFPISTSVDCSKIN  119



>gb|AEV23220.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPGKCGVNILYPISMQTDCNKVR  113



>ref|NP_568905.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
 sp|Q9LLR7.1|NLTP3_ARATH RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76929.1| lipid transfer protein 3 [Arabidopsis thaliana]
 gb|AAL38769.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM19801.1| AT5g59320/mnc17_210 [Arabidopsis thaliana]
 gb|AAM20222.1| putative nonspecific lipid-transfer precursor [Arabidopsis thaliana]
 gb|AAN60256.1| unknown [Arabidopsis thaliana]
 gb|AED97171.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
Length=115

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVA SL  C  Y+     +  +CC GVK L + AKTT DRQ AC C++S A  +
Sbjct  23   AAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP LA+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK  115



>ref|XP_008778766.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VAS+L  C  Y +    +   CC GV+ LA+ AKTTADR+T CNCLK+    + 
Sbjct  27   AITCGQVASALAGCISYARNGGSIPPNCCSGVRGLASRAKTTADRRTVCNCLKNAISSIR  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G  PGL  G+PGKCGV + Y IS STDCSK++
Sbjct  87   GLKPGLVNGIPGKCGVRIPYTISPSTDCSKVN  118



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG VASSL  C  Y++    +   CC G+K L +AAKTT DRQTAC CLK+ +  +SG
Sbjct  29   ITCGQVASSLSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISG  88

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVSIPYKISASTNCATVK  117



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+S+L SC  Y+K    +   CC G+K+L +AA+TTADRQ AC CLK+ +  + G
Sbjct  29   ITCGQVSSALSSCLGYLKNGGAVPPGCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIPG  88

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  89   INLGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSSLAPCIAYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVSIPYKISASTNCATVK  117



>ref|XP_003605269.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=166

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +
Sbjct  23   AAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLWESAGFLRQAITENYDD  342
            SG N   A+ +PGKCGVN+ Y ISTST+C+         S+G        NY +
Sbjct  83   SGLNTAAASALPGKCGVNIPYKISTSTNCATAT-----RSSGLEDDVAASNYAN  131



>dbj|BAB09777.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=113

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVA SL  C  Y+     +  +CC GVK L + AKTT DRQ AC C++S A  +
Sbjct  23   AAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
            SG NP LA+G+PGKCGV++ YPIS ST+C+K
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNCNK  113



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S+L  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA++CG++ S+LV C  Y+KG    +++CC GVK + AAA TT DR+ ACNCLK+ AG +
Sbjct  25   AAVSCGSITSALVPCISYLKGGPGPSSSCCGGVKRVNAAAATTPDRRAACNCLKNAAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG   G AA +P KCGVN+ Y  STST+C+ I+
Sbjct  85   SGLKAGNAAALPSKCGVNIPYKFSTSTNCNSIN  117



>ref|XP_010043171.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88335.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
 gb|KCW88336.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +A+TCG VAS +  C  Y++    L +ACC G++ L +AA+TT DRQTAC CL+S AG +
Sbjct  24   SAVTCGQVASCVAPCLGYLRAGGTLPSACCSGIRSLNSAARTTPDRQTACRCLQSAAGNI  83

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N GL + +PGKCGV+V Y IS STDCS++ 
Sbjct  84   RGLNLGLVSALPGKCGVSVPYKISPSTDCSRVK  116



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+ SL  C  +++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG + 
Sbjct  24   AITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIP  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              N   AAG+PG CGV++ Y ISTSTDCSK+ 
Sbjct  84   NLNLNNAAGLPGACGVSIPYKISTSTDCSKVR  115



>ref|XP_006281297.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
 gb|EOA14195.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
Length=137

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVA+SL  C  Y+     +   CC GVK L + A+TT DRQ AC CL+S A  +
Sbjct  45   AAISCGTVATSLAPCANYLSKGGEVPVPCCGGVKSLISMAQTTPDRQQACRCLQSTAKGM  104

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            SG +P LA+G+PGKCGV++ YPIS ST+C  +
Sbjct  105  SGLDPSLASGLPGKCGVSIPYPISMSTNCDNV  136



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  
Sbjct  25   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG  84

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KC V++ Y ISTSTDCS+++
Sbjct  85   VSGLNAGNAASIPSKCSVSIPYTISTSTDCSRVN  118



>gb|ABA34098.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34102.1| phospholipid transfer protein 2, partial [Zea diploperennis]
Length=116

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT P  +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  29   CGQVSSAIAPCLSYARGTGPAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  88

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSK  273
            N G AA +P KCGV++ Y ISTSTDCS+
Sbjct  89   NAGNAASIPSKCGVSIPYTISTSTDCSR  116



>ref|XP_002864626.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40885.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
Length=115

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVA SL  C  Y+     +   CC GVK L   A+TT DRQ AC C++S A  +
Sbjct  23   AAISCGTVAGSLAPCATYLSKGGLVPPPCCAGVKKLNGMAQTTPDRQQACRCIQSTAKSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP LA+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK  115



>gb|AET05733.1| lipid transfer protein isoform d, partial [Pyrus communis]
Length=94

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC  V S+L +C  Y+K    +  ACC G++ +   A+TTADRQT CNCLKSLAG + 
Sbjct  3    AITCSQVTSNLGACIGYVKNGGVVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGSIK  62

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AA +PGKCGVNV + ISTST+C+ +
Sbjct  63   GVNPNNAATLPGKCGVNVPFKISTSTNCATV  93



>gb|ACG30522.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=121

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  LSG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGLSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ABA33855.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            I+CG VAS++  C  Y +G     +A+CC GV+ L  AA+TTADR+ ACNCLK+ A  +S
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSASCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AAG27707.1|AF302788_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAS84745.1| lipid transfer protein [Triticum aestivum]
 gb|AAV65513.1| lipid transfer protein [Triticum aestivum]
 gb|EMT15838.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG V S+L SC  Y KG+      ACC GV+ LA  A++TAD+Q AC C+KS AG 
Sbjct  25   AAISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAG-  83

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              G NPG AA +P KCGV++ Y IS S DCSKIH
Sbjct  84   --GLNPGKAASIPSKCGVSIPYSISASVDCSKIH  115



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SS+  C  Y+K    + AACC GV+ L +AAKTTADRQ ACNCLK+ +  + 
Sbjct  24   AITCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTADRQAACNCLKTASASIK  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N  LAAG+PGKCGV+V Y IS ST+C++ +
Sbjct  84   GINLSLAAGLPGKCGVSVPYKISPSTNCNRYN  115



>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
Length=92

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + G
Sbjct  2    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG  61

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  62   VNPNNAAALPGKCGVSIPYKISASTNCATVK  92



>ref|XP_006346674.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=110

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+ CG V S ++ C  Y++GT PL   CC GV++LA+AAK+T DR+TAC CLKS AG +S
Sbjct  20   ALNCGQVTSYIIPCLGYLRGTAPL-GGCCGGVRNLASAAKSTPDRKTACTCLKSAAGAIS  78

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G N   AAG+P  CGVN+ Y IS STDCSK+
Sbjct  79   GINYSKAAGLPSTCGVNIPYKISPSTDCSKV  109



>sp|Q43193.1|NLTP1_SORBI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Sorghum bicolor]
 emb|CAA50660.1| lipid transfer protein [Sorghum bicolor]
Length=118

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAI+CG V+S++  C  Y +G    P +A CC GV+ L +AA+TTADR+ ACNCLK+ A 
Sbjct  25   AAISCGQVSSAIALCLSYARGQGFAP-SAGCCSGVRSLNSAARTTADRRAACNCLKNAAR  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             +SG N G AA +P KCGV+V Y ISTSTDCS++
Sbjct  84   GISGLNAGNAASIPSKCGVSVPYTISTSTDCSRV  117



>sp|Q9SW93.1|SCA_LILLO RecName: Full=Stigma/stylar cysteine-rich adhesin; AltName: Full=Lipid 
transfer protein; Flags: Precursor [Lilium longiflorum]
 gb|AAD46683.1|AF171094_1 lipid transfer protein precursor [Lilium longiflorum]
Length=113

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+PGKCGVN+ YPI   TDC+K+ 
Sbjct  81   LGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKVR  113



>ref|XP_007134675.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
 gb|ADC80502.1| non-specific lipid transfer protein 1a precursor [Phaseolus vulgaris]
 gb|ESW06669.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
Length=115

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            +TCG V S+LV C  +++    + A CC GV+++  +A++TADR+  CNCLK+ AG + G
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG  84

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  A  +PGKCGVN+ Y ISTST+C+ I+
Sbjct  85   LNPNNAQALPGKCGVNIPYKISTSTNCASIN  115



>gb|KFK26696.1| hypothetical protein AALP_AA8G281300 [Arabis alpina]
Length=112

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVASSL  C  Y+     +   CC+GVK+L + A+TT DRQ AC CL+S A   
Sbjct  23   AAISCGTVASSLAPCATYLSNGGAVPDPCCEGVKELNSMAQTTPDRQQACRCLQSAA---  79

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G NP LA+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  80   KGLNPSLASGLPGKCGVSIPYPISMSTNCNDIK  112



>ref|XP_006429567.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 ref|XP_006481182.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42807.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=115

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V  SL  C  Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG + 
Sbjct  24   AITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIP  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              NP  A G+P  CGV++ Y IS STDCSK+ 
Sbjct  84   NLNPNNAVGLPRACGVSIPYKISISTDCSKVR  115



>gb|ACJ62323.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62356.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62315.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62317.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62335.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62338.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62340.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62341.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62343.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62351.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62358.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62362.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62363.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62365.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62366.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62367.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62368.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62369.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62371.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62372.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62373.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62374.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62376.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>emb|CAB96876.2| pru p 1 [Prunus persica]
Length=91

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK  91



>dbj|BAJ91878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AAITCG V+S+L  C  Y KG  T P +A CC GVK LA  A++TAD+Q  C CLKS+AG
Sbjct  25   AAITCGQVSSALGPCAAYAKGSGTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG  83

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
                +N G AAG+P +CGV+V Y IS S DC+KIH
Sbjct  84   ---AYNAGRAAGIPSRCGVSVPYTISASVDCTKIH  115



>gb|AAK01293.1|AF331710_1 lipid transfer protein [Avicennia marina]
Length=117

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVAS L  C  Y+    PL   CC GVK L   A+TT DRQ+ C CLKSLA   
Sbjct  27   AAISCGTVASKLAPCIPYVTNRGPL-GGCCGGVKSLYGLARTTPDRQSVCGCLKSLASSY  85

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +  N G AAG+PG+CGVN+ Y IS STDCSK+H
Sbjct  86   N-VNLGKAAGLPGQCGVNIPYKISPSTDCSKVH  117



>ref|XP_008662435.1| PREDICTED: non-specific lipid-transfer protein [Zea mays]
 gb|ACG24030.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|AFW55967.1| phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            I+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A  +S
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVS  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|XP_008779709.1| PREDICTED: non-specific lipid-transfer protein 1-like, partial 
[Phoenix dactylifera]
Length=115

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG VAS +  C  Y +    +   CC GV+ L ++AKT+ADR+T CNCLK  A  +S
Sbjct  27   AITCGQVASGVSGCISYARSGGSIPPNCCSGVRGLVSSAKTSADRRTVCNCLKRTASSIS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCS  270
            G  PGL AG+PGKCGV + Y IS STDCS
Sbjct  87   GLKPGLVAGIPGKCGVRIPYTISPSTDCS  115



>dbj|BAI94498.1| lipid transfer protein [Dianthus caryophyllus]
Length=118

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+TCG VAS+L SC  Y+KG    +  CC G+K L   AKTT DRQTACNCLKS +  +S
Sbjct  27   AVTCGQVASNLGSCIPYLKGGPGPSGQCCGGIKTLNGLAKTTPDRQTACNCLKSESASIS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N  LA+G+P KCGV+V Y IS S DCSK+ 
Sbjct  87   GINYALASGLPSKCGVSVPYTISPSVDCSKVR  118



>gb|ACJ62339.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            A+TCG V SSL  C  Y++GT    +   CC G+K L +AA+TT DRQ AC C+KS A  
Sbjct  27   AVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCIKSAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            + G N GLA+G+PGKCGVN+ Y IS STDCS + 
Sbjct  87   IPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>gb|ACJ62319.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62329.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62330.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62331.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  27   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  86

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ACJ62318.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62324.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62325.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62328.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62345.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62346.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62347.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62348.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62349.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62350.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62352.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62353.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62354.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62357.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62364.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62370.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62375.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62377.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62378.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62379.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  27   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  86

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAVLPGKCGVSIPYKISASTNCATVK  117



>gb|AFD32278.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AK T DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKNTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+P KCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPAKCGVNIPYPISMQTDCTKVR  113



>ref|XP_006573392.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=119

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIK---GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AITCG VA SL  C  Y++   G  P  A CC+GV  L  AA  TADR+TACNCLKS+A 
Sbjct  26   AITCGEVARSLSPCINYLRSRRGGSP-EAECCRGVTSLNRAASNTADRRTACNCLKSVAA  84

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             +SG N   AA +PG+C V V Y ISTST+C++I 
Sbjct  85   SISGLNANNAASLPGRCRVRVPYRISTSTNCNRIR  119



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+SSL  C  Y++    + A CC GV+ L  AAKTTADRQ ACNCLKS    + G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N  LAAG+PGKCGV+V Y IS STDC  + 
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK  91



>gb|ACJ62355.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=109

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  20   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  79

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  80   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            A+TCG V SSL  C  Y++GT    +   CC G+K L +AA+TT DRQ AC C+KS A  
Sbjct  27   AVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCIKSAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            + G N GLA+G+PGKCGVN+ Y IS STDCS + 
Sbjct  87   IPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>tpg|DAA59277.1| TPA: hypothetical protein ZEAMMB73_838830 [Zea mays]
Length=157

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            ITCG V SSL  C  Y  G    L A+CC GVK L +AA+T+ADRQ AC CLKSLA  + 
Sbjct  32   ITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVK  91

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
              N G  A +PGKCGV+VG+PIS STDC+K
Sbjct  92   SVNMGTVATIPGKCGVSVGFPISMSTDCNK  121



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V SS+  C +Y++    +   CC G+K L  AA+TT DRQ AC CL++ A  +
Sbjct  23   AAITCGQVTSSVAPCIQYLRSGGSVPPPCCNGIKSLNNAARTTPDRQQACRCLQNAAKAI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  LAAG+PGKCGVN+ Y ISTST+C+ + 
Sbjct  83   PGINTNLAAGLPGKCGVNIPYKISTSTNCASVK  115



>gb|ACP30545.1| lipid transfer protein precursor [Lilium formosanum]
Length=113

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+P KCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPAKCGVNIPYPISMQTDCNKVR  113



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V +SL  C  Y++    +  ACC G+K L + A +T DRQTACNC+KS AG +
Sbjct  25   AAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSAAGSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTD  264
            SG N GLA+ +PGKCGVN+ Y IS S D
Sbjct  85   SGINFGLASSLPGKCGVNLPYKISPSID  112



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V+S+L  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             NP  AA +PGKCGV++ Y IS ST+C+ +
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATV  90



>gb|ABA33854.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            I+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +S
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLKNAARTTADRRAACNCLKNAAAGVS  89

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62326.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV+ L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRSLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ABA33856.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=117

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            I+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +S
Sbjct  26   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  86   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  117



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTE-PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            A+TCG V +SL  C  Y++G   P+   CC G+K L +AA+TT DRQ AC C+KS A  +
Sbjct  27   AVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNSAAQTTPDRQAACKCIKSAAAGI  86

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            SG N G+A+G+PGKCGVN+ Y IS STDC++ 
Sbjct  87   SGINYGIASGLPGKCGVNIPYKISPSTDCNRF  118



>gb|ACG40474.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
Length=120

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTA R+ ACNCLK+ A  
Sbjct  27   AAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAXRRAACNCLKNAAAG  86

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  87   VSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>gb|ADR66945.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=119

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S+L  C  Y+K    +  ACC G++ L   AKTTADRQ ACN LK L+G + 
Sbjct  28   AITCGQVVSTLAPCINYVKSGGAVPPACCNGIRTLNGLAKTTADRQAACNRLKQLSGSIP  87

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGVNV Y IS ST+C+ + 
Sbjct  88   GVNPNNAAALPGKCGVNVPYKISISTNCAAVK  119



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N   AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNLNNAASLPGKCGVNIPYQISPSTNCANVK  117



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  10   TCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            TCG VAS+L  C  Y++    + A CC G+K L +AAKTT DRQ AC CLK+ +  +SG 
Sbjct  30   TCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGI  89

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  90   NYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N   AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNLNNAASLPGKCGVNIPYQISPSTNCANVK  117



>emb|CAA65680.1| lipid transfer protein 7a2b [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AA++CG V S L  C  Y+ G    ++  CC GV+ L   A+++ DRQTAC CLKSLA  
Sbjct  29   AALSCGQVDSKLAPCVAYVTGRASAISKECCSGVQGLNGLARSSPDRQTACRCLKSLATS  88

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +   N G  +GVPGKCGV+V +PIS STDC+K+H
Sbjct  89   IKAINMGKVSGVPGKCGVSVPFPISMSTDCNKVH  122



>ref|XP_008798559.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S L  C  Y++    +  ACC GV+ LAAAAKTT DR+TAC CLK+ A  +S
Sbjct  27   AITCGQVVSYLTPCINYVRNGGQIPGACCSGVRGLAAAAKTTPDRRTACTCLKNAAAGIS  86

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSK  273
            G   GL AG+PGKCGV V Y IS STDCS+
Sbjct  87   GLKTGLIAGIPGKCGVRVPYAISPSTDCSR  116



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG  +SSL  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQASSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G NP  AA +PGKCGV++ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVSIPYKISASTNCATVK  117



>ref|XP_002866326.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42585.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCGTVASSL  C  Y+     +   CC GVK L   A+TT DRQ AC CL+S A   
Sbjct  23   AAITCGTVASSLSPCLSYLSKGGVVPPPCCAGVKKLNGLAQTTPDRQQACRCLQSAA---  79

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G NP LA+G+PGKCGV++ YPISTST+C+ I 
Sbjct  80   KGVNPSLASGLPGKCGVSIPYPISTSTNCATIK  112



>gb|AAA03283.1| CW18=non-specific lipid transfer protein [barley, cv. Bomi, leaves, 
Peptide, 90 aa]
Length=90

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AITCG V+S+L  C  Y KG  T P +A CC GVK LA  A++TAD+Q  C CLKS+AG 
Sbjct  1    AITCGQVSSALGPCAAYAKGSGTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG-  58

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
               +N G AAG+P +CGV+V Y IS S DCSKIH
Sbjct  59   --AYNAGRAAGIPSRCGVSVPYTISASVDCSKIH  90



>gb|AET05732.1| lipid transfer protein isoform c, partial [Pyrus communis]
Length=94

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITC  V+S+L  C  Y++    +  ACC G+K +   A TT DRQ ACNCLK+LAG +S
Sbjct  3    AITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVS  62

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NPG A  +PGKCGVNV   IST T+C+ +
Sbjct  63   GVNPGNAESLPGKCGVNVPCKISTPTNCATV  93



>gb|AFD32277.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLSSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+P KCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPAKCGVNIPYPISMQTDCTKVR  113



>ref|XP_010529189.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=117

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            A I+CGTVAS +  C  Y+    PL  ACC GV+ L + A TT  RQ AC CL+S A  +
Sbjct  25   AQISCGTVASRVAPCIAYLTRGGPLPPACCAGVRSLNSLANTTPARQAACRCLQSAARSI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N G A+G+P  CGV + YPIST+T+C+ + 
Sbjct  85   PGLNQGAASGLPRACGVRISYPISTTTNCNNVK  117



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AA++CG V +SL  C  Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK     +
Sbjct  29   AAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQAVNGI  88

Query  181  --SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              +  N GLAAG+PGKCGVN+ Y IS STDC  I 
Sbjct  89   PYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSIK  123



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            A+TCG V S+L  C  Y++   PL   CC GVK L  AA+TT DRQTAC CLKS AG +S
Sbjct  24   ALTCGQVTSNLAPCLPYLRNKGPL-GRCCSGVKGLLNAARTTQDRQTACTCLKSAAGAIS  82

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            G N   AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  83   GINLRKAAGLPSTCGVNIPYNISPSTDCSKVQ  114



>ref|NP_001105392.1| phospholipid transfer protein precursor [Zea mays]
 gb|AAB06443.1| phospholipid transfer protein [Zea mays]
 gb|ACF86016.1| unknown [Zea mays]
 gb|ACJ62344.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 tpg|DAA59231.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  189
            CG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG 
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  190  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|XP_002864627.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40886.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=115

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTV S+L  C  Y+     +   CC+GV+ L   A+TT DRQ AC CL+S A  +
Sbjct  23   AAISCGTVVSNLAPCVNYLSRGGVVPDLCCEGVQKLNGMAQTTPDRQQACKCLQSTAKGI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP LA+G+PGKCGV++ YPIS ST+C  + 
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISLSTNCDNVK  115



>gb|ABF14723.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 63/94 (67%), Gaps = 4/94 (4%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  177
            AAI CG V S+L SC  Y KG+      ACC GV+ LA  A++TAD+Q AC C+KS AG 
Sbjct  25   AAIPCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAG-  83

Query  178  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
              G NPG AA +P KCGV++ Y IS S DCSKIH
Sbjct  84   --GLNPGKAASIPSKCGVSIPYSISASVDCSKIH  115



>gb|AFD32276.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLSSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             G N  + AG+P KCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPAKCGVNIPYPISMQTDCNKVR  113



>gb|AAM66088.1| nonspecific lipid-transfer protein precursor-like protein [Arabidopsis 
thaliana]
Length=115

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CGTVA SL  C  Y+     +  +CC GVK L + AKTT DRQ AC C++S A  +
Sbjct  23   AAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            SG NP  A+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  83   SGLNPSXASGLPGKCGVSIPYPISMSTNCNNIK  115



>gb|AGV40204.1| nonspecific lipid-transfer protein 3, partial [Oryza sativa]
Length=126

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +
Sbjct  37   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  96

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCS  270
            SG N G AA +P KCGV++ Y IS S +CS
Sbjct  97   SGLNAGNAASIPSKCGVSIPYTISPSIECS  126



>emb|CAH03799.1| lipid transfer protein [Citrus sinensis]
Length=91

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG V  SL  C  Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG +  
Sbjct  1    ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPN  60

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             NP  A G+P  CGV++ Y IS STDCSK+ 
Sbjct  61   LNPNNAVGLPRACGVSIPYKISISTDCSKVR  91



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAITCG V SS+  C  Y++    +  ACC GVK L +AAKTT DRQTACNCLKS A   
Sbjct  27   AAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNSAAKTTPDRQTACNCLKSAAVSN  86

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
                 GLA+ +P KCGVNV Y IS STDCSK+
Sbjct  87   PSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>ref|NP_001268120.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33393.1|AF467945_1 lipid transfer protein isoform 1 [Vitis vinifera]
Length=119

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            ITCG VAS++  C  Y++    + A CC G+K L +AAKTT DRQ AC CLK+ +G + G
Sbjct  29   ITCGQVASAVGPCASYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLKTFSGSIPG  88

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
             N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|ACJ62361.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = +1

Query  13   CGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  186
            CG V+S++  C  Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +SG
Sbjct  32   CGQVSSAIAPCLSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGVSG  90

Query  187  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  91   LNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|XP_009372014.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x 
bretschneideri]
Length=115

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V S+L +C  Y+K    +  ACC G++ +   A+TTADRQT CNCLKSLAG + 
Sbjct  24   AITCGQVTSNLGACIGYVKNGGAVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGSIK  83

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G NP  AA +P KCGVNV + IS ST+C+ +
Sbjct  84   GVNPNNAATLPAKCGVNVPFKISISTNCATV  114



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  180
            AAI+CG V +SL  C  Y++    + A CC G+K L   A +T DRQTACNC+KS A  +
Sbjct  25   AAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAAAAI  84

Query  181  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
            +G N  LA  +P KCGVN+ Y IS S DCS +H
Sbjct  85   NGINYSLAGSLPSKCGVNLPYKISPSIDCSTVH  117



>ref|XP_006662672.1| PREDICTED: non-specific lipid-transfer protein 1-like [Oryza 
brachyantha]
Length=117

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  183
            AITCG V+S++  C  Y +G    ++ACC GVK L AAA+TTADR+TACNCLK+ A  + 
Sbjct  26   AITCGQVSSAISPCLAYARGGAGPSSACCTGVKSLNAAARTTADRRTACNCLKNAARGIR  85

Query  184  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  276
            G N G AA +P KCGV+V Y IS S DCS++
Sbjct  86   GLNAGNAASIPSKCGVSVPYTISASIDCSRV  116



>ref|XP_006429570.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
 ref|XP_006481183.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42810.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
Length=117

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    AAITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  174
            AA+TCG V SSL +C  Y+ G     +  ACC G+K L +AA TT DRQ+ CNCLK+ AG
Sbjct  23   AAVTCGQVTSSLQACMPYVTGPGGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLKTAAG  82

Query  175  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  279
             +   N  LA+G+P +CGVN+ Y IS S DCS++ 
Sbjct  83   SIRNLNLNLASGLPRQCGVNIPYQISPSVDCSRVR  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780