BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP005A07 620 bp,

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EMT33700.1|  Tubulin beta-3 chain                                    399   1e-136   Aegilops tauschii
gb|ACN32164.1|  unknown                                                 399   3e-136   Zea mays [maize]
ref|XP_010495405.1|  PREDICTED: tubulin beta-8 chain-like               398   3e-136   Camelina sativa [gold-of-pleasure]
gb|ACF88196.1|  unknown                                                 398   6e-136   Zea mays [maize]
gb|EEE55549.1|  hypothetical protein OsJ_03802                          398   6e-136   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140291.1|  uncharacterized protein LOC100272336               398   7e-136   Zea mays [maize]
emb|CAA55021.1|  beta tubulin                                           398   8e-136   Oryza sativa Japonica Group [Japonica rice]
gb|EPS64778.1|  hypothetical protein M569_10002                         395   8e-136   Genlisea aurea
gb|ABY75517.1|  beta-tubulin                                            395   1e-135   Bambusa emeiensis
ref|XP_002267304.1|  PREDICTED: tubulin beta chain                      399   1e-135   Vitis vinifera
sp|P28551.2|TBB3_SOYBN  RecName: Full=Tubulin beta chain; AltName...    398   1e-135   Glycine max [soybeans]
sp|P25862.1|TBB1_AVESA  RecName: Full=Tubulin beta-1 chain; AltNa...    397   1e-135   Avena sativa [cultivated oat]
gb|AET80382.1|  beta-tubulin 1                                          396   1e-135   x Doritaenopsis hybrid cultivar
sp|Q40665.2|TBB3_ORYSJ  RecName: Full=Tubulin beta-3 chain; AltNa...    399   1e-135   Oryza sativa Japonica Group [Japonica rice]
gb|ACM78033.1|  beta-tubulin                                            399   2e-135   Citrus maxima [buntan]
ref|XP_006656368.1|  PREDICTED: tubulin beta-3 chain-like               399   2e-135   Oryza brachyantha
gb|AJA29691.1|  beta-tubulin                                            397   2e-135   Betula luminifera [liang ye hua]
ref|NP_001058334.1|  Os06g0671900                                       399   2e-135   
ref|XP_003535107.1|  PREDICTED: tubulin beta-3 chain-like               399   2e-135   Glycine max [soybeans]
gb|EPS63676.1|  beta-tubulin                                            399   2e-135   Genlisea aurea
ref|XP_011096695.1|  PREDICTED: tubulin beta chain                      399   2e-135   Sesamum indicum [beniseed]
ref|XP_010941598.1|  PREDICTED: tubulin beta chain                      399   2e-135   Elaeis guineensis
ref|XP_006448872.1|  hypothetical protein CICLE_v10015255mg             399   2e-135   Citrus clementina
ref|XP_006646923.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    399   2e-135   Oryza brachyantha
ref|NP_001169695.1|  uncharacterized protein LOC100383576               399   2e-135   Zea mays [maize]
ref|XP_002451606.1|  hypothetical protein SORBIDRAFT_04g004520          399   2e-135   Sorghum bicolor [broomcorn]
ref|XP_008445559.1|  PREDICTED: tubulin beta chain                      399   2e-135   Cucumis melo [Oriental melon]
ref|XP_010098541.1|  Tubulin beta-1 chain                               399   2e-135   Morus notabilis
ref|XP_010906251.1|  PREDICTED: tubulin beta chain-like                 399   2e-135   Elaeis guineensis
ref|XP_009792728.1|  PREDICTED: tubulin beta chain                      399   2e-135   Nicotiana sylvestris
ref|XP_009622091.1|  PREDICTED: tubulin beta chain                      399   2e-135   Nicotiana tomentosiformis
ref|NP_001046006.1|  Os02g0167300                                       399   2e-135   
ref|XP_003546276.1|  PREDICTED: tubulin beta-3 chain                    399   2e-135   Glycine max [soybeans]
ref|XP_004486478.1|  PREDICTED: tubulin beta-3 chain-like               399   2e-135   Cicer arietinum [garbanzo]
ref|XP_004951797.1|  PREDICTED: tubulin beta-3 chain-like               399   2e-135   Setaria italica
ref|XP_011039269.1|  PREDICTED: tubulin beta chain-like                 399   2e-135   Populus euphratica
ref|XP_004135544.1|  PREDICTED: tubulin beta-1 chain-like               399   2e-135   Cucumis sativus [cucumbers]
ref|XP_008644456.1|  PREDICTED: tubulin beta-7 chain                    399   2e-135   Zea mays [maize]
dbj|BAA02505.1|  beta-tubulin                                           399   2e-135   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051451.1|  Os03g0780600                                       399   2e-135   
ref|XP_009405384.1|  PREDICTED: tubulin beta chain                      399   2e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007015370.1|  Beta-6 tubulin isoform 2                           397   2e-135   Theobroma cacao [chocolate]
ref|XP_008793578.1|  PREDICTED: tubulin beta chain                      399   3e-135   Phoenix dactylifera
ref|XP_007022910.1|  Tubulin beta-7 chain                               399   3e-135   Theobroma cacao [chocolate]
ref|XP_007147456.1|  hypothetical protein PHAVU_006G126100g             399   3e-135   Phaseolus vulgaris [French bean]
ref|XP_002523174.1|  tubulin beta chain, putative                       399   3e-135   Ricinus communis
gb|ACN28844.1|  unknown                                                 396   3e-135   Zea mays [maize]
gb|AEN19686.1|  beta-tubulin                                            395   3e-135   Cymbidium faberi
ref|XP_006650676.1|  PREDICTED: tubulin beta-7 chain-like               399   3e-135   
ref|XP_009399255.1|  PREDICTED: tubulin beta chain-like                 399   3e-135   Musa acuminata subsp. malaccensis [pisang utan]
sp|P18025.1|TBB1_MAIZE  RecName: Full=Tubulin beta-1 chain; AltNa...    399   3e-135   Zea mays [maize]
gb|AAW88509.1|  beta-tubulin                                            394   3e-135   Lolium perenne [perennial ryegrass]
ref|XP_008370041.1|  PREDICTED: tubulin beta chain                      399   3e-135   Malus domestica [apple tree]
gb|ABY75516.1|  beta-tubulin                                            394   3e-135   Bambusa emeiensis
ref|XP_007205196.1|  hypothetical protein PRUPE_ppa005693mg             399   3e-135   Prunus persica
gb|KDP23866.1|  hypothetical protein JCGZ_27135                         399   3e-135   Jatropha curcas
gb|ABY75515.1|  beta-tubulin                                            394   3e-135   Bambusa emeiensis
pir||JC2511  beta-tubulin R2242 - rice                                  399   3e-135
ref|XP_004981550.1|  PREDICTED: tubulin beta-7 chain-like               399   4e-135   Setaria italica
ref|XP_004293671.1|  PREDICTED: tubulin beta chain                      399   4e-135   Fragaria vesca subsp. vesca
ref|XP_008648960.1|  PREDICTED: tubulin beta-7 chain-like               399   4e-135   
gb|AFC88847.1|  putative beta-5 tubulin                                 395   4e-135   Tetragonia tetragonioides
ref|XP_011037726.1|  PREDICTED: tubulin beta chain                      398   4e-135   Populus euphratica
ref|XP_002466356.1|  hypothetical protein SORBIDRAFT_01g006310          398   4e-135   Sorghum bicolor [broomcorn]
ref|XP_006377941.1|  tubulin beta chain family protein                  398   4e-135   Populus trichocarpa [western balsam poplar]
sp|Q6VAF7.1|TBB5_GOSHI  RecName: Full=Tubulin beta-5 chain; AltNa...    398   4e-135   Gossypium hirsutum [American cotton]
gb|EMT10073.1|  Tubulin beta-1 chain                                    395   4e-135   Aegilops tauschii
ref|XP_008804937.1|  PREDICTED: tubulin beta-2 chain                    398   4e-135   Phoenix dactylifera
ref|XP_010540645.1|  PREDICTED: tubulin beta chain                      398   4e-135   Tarenaya hassleriana [spider flower]
ref|XP_007036799.1|  Beta-6 tubulin                                     398   5e-135   Theobroma cacao [chocolate]
ref|XP_008442483.1|  PREDICTED: tubulin beta chain-like                 398   5e-135   Cucumis melo [Oriental melon]
gb|ADW84691.1|  beta-tubulin                                            396   5e-135   Theobroma cacao [chocolate]
gb|KJB29774.1|  hypothetical protein B456_005G118100                    398   5e-135   Gossypium raimondii
dbj|BAA82639.1|  Beta-tubulin                                           398   5e-135   Zinnia violacea [garden zinnia]
ref|XP_003594596.1|  Tubulin beta chain                                 398   5e-135   Medicago truncatula
ref|XP_008448943.1|  PREDICTED: tubulin beta chain-like                 398   5e-135   Cucumis melo [Oriental melon]
ref|XP_004172348.1|  PREDICTED: tubulin beta-1 chain-like               398   5e-135   
gb|ACN39870.1|  unknown                                                 398   5e-135   Picea sitchensis
ref|XP_006421924.1|  hypothetical protein CICLE_v10004755mg             400   5e-135   Citrus clementina
gb|KJB21246.1|  hypothetical protein B456_003G126300                    396   5e-135   Gossypium raimondii
sp|Q9ZRB0.1|TBB3_WHEAT  RecName: Full=Tubulin beta-3 chain; AltNa...    398   5e-135   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010101838.1|  Tubulin beta-1 chain                               398   6e-135   Morus notabilis
sp|Q9ZPP0.1|TBB1_ELEIN  RecName: Full=Tubulin beta-1 chain; AltNa...    398   6e-135   Eleusine indica [crabgrass]
ref|NP_001289662.1|  tubulin beta chain                                 398   6e-135   Eucalyptus grandis [rose gum]
ref|XP_002299541.1|  hypothetical protein POPTR_0001s09180g             398   6e-135   Populus trichocarpa [western balsam poplar]
emb|CAM58980.1|  beta tubulin 2                                         398   6e-135   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002299042.1|  hypothetical protein POPTR_0001s46870g             398   6e-135   Populus trichocarpa [western balsam poplar]
ref|XP_003569962.1|  PREDICTED: tubulin beta-3 chain                    398   6e-135   Brachypodium distachyon [annual false brome]
ref|XP_004147894.1|  PREDICTED: tubulin beta-1 chain-like               398   6e-135   Cucumis sativus [cucumbers]
ref|XP_002267380.1|  PREDICTED: tubulin beta-1 chain                    398   6e-135   Vitis vinifera
sp|Q40106.1|TBB2_LUPAL  RecName: Full=Tubulin beta-2 chain; AltNa...    398   6e-135   Lupinus albus
ref|XP_006339000.1|  PREDICTED: tubulin beta-8 chain-like               398   6e-135   Solanum tuberosum [potatoes]
ref|XP_006410627.1|  hypothetical protein EUTSA_v10016629mg             398   7e-135   Eutrema salsugineum
gb|ABR22557.1|  beta-tubulin                                            393   7e-135   Mesostigma viride
emb|CDP12577.1|  unnamed protein product                                398   7e-135   Coffea canephora [robusta coffee]
gb|KCW77253.1|  hypothetical protein EUGRSUZ_D01612                     398   7e-135   Eucalyptus grandis [rose gum]
gb|AID52920.1|  tubulin beta-2 chain                                    398   7e-135   Carthamus tinctorius
ref|XP_007026823.1|  Tubulin beta 8                                     398   7e-135   Theobroma cacao [chocolate]
gb|AIA09927.1|  beta-tubulin                                            398   7e-135   Quercus suber [cork oak]
tpg|DAA51374.1|  TPA: hypothetical protein ZEAMMB73_041268              398   7e-135   Zea mays [maize]
ref|XP_008377500.1|  PREDICTED: tubulin beta-1 chain                    398   7e-135   Malus domestica [apple tree]
gb|AGE44289.1|  beta-tubulin                                            398   7e-135   Dimocarpus longan [longan]
ref|XP_006853321.1|  hypothetical protein AMTR_s00032p00056500          398   7e-135   Amborella trichopoda
ref|XP_010926884.1|  PREDICTED: tubulin beta chain-like                 398   7e-135   Elaeis guineensis
gb|AGH08232.1|  beta-tubulin 3                                          398   7e-135   Salix arbutifolia
ref|XP_006350813.1|  PREDICTED: tubulin beta-2 chain-like               398   7e-135   Solanum tuberosum [potatoes]
ref|XP_010530505.1|  PREDICTED: tubulin beta-8 chain                    397   8e-135   Tarenaya hassleriana [spider flower]
ref|XP_002438838.1|  hypothetical protein SORBIDRAFT_10g027010          398   8e-135   Sorghum bicolor [broomcorn]
gb|EYU38358.1|  hypothetical protein MIMGU_mgv1a007077mg                397   8e-135   Erythranthe guttata [common monkey flower]
emb|CDX80390.1|  BnaC07g30540D                                          398   8e-135   Brassica napus [oilseed rape]
emb|CDX84283.1|  BnaC04g10450D                                          398   8e-135   Brassica napus [oilseed rape]
ref|XP_009371335.1|  PREDICTED: tubulin beta-1 chain                    398   8e-135   Pyrus x bretschneideri [bai li]
sp|P37392.1|TBB1_LUPAL  RecName: Full=Tubulin beta-1 chain; AltNa...    398   8e-135   Lupinus albus
ref|XP_007218003.1|  hypothetical protein PRUPE_ppa005698mg             398   8e-135   Prunus persica
ref|XP_010255421.1|  PREDICTED: tubulin beta-2 chain                    397   8e-135   Nelumbo nucifera [Indian lotus]
dbj|BAH82659.1|  tubulin beta chain                                     397   8e-135   Lotus japonicus
ref|XP_006654403.1|  PREDICTED: tubulin beta-1 chain-like               397   8e-135   Oryza brachyantha
ref|XP_010908105.1|  PREDICTED: tubulin beta-2 chain-like               397   8e-135   Elaeis guineensis
ref|XP_010035138.1|  PREDICTED: tubulin beta-1 chain                    397   8e-135   Eucalyptus grandis [rose gum]
ref|XP_004241186.1|  PREDICTED: tubulin beta chain-like                 397   8e-135   Solanum lycopersicum
gb|KDP46576.1|  hypothetical protein JCGZ_08548                         398   8e-135   Jatropha curcas
ref|XP_003556108.1|  PREDICTED: tubulin beta-1 chain-like               398   8e-135   Glycine max [soybeans]
gb|AGT02044.1|  beta-tubulin                                            397   8e-135   Dimocarpus longan [longan]
emb|CDY31638.1|  BnaA05g09090D                                          397   8e-135   Brassica napus [oilseed rape]
ref|XP_004496560.1|  PREDICTED: tubulin beta-1 chain-like               397   8e-135   Cicer arietinum [garbanzo]
ref|XP_004966294.1|  PREDICTED: tubulin beta-1 chain-like               397   8e-135   Setaria italica
gb|AGH08242.1|  beta-tubulin 8                                          397   8e-135   Salix arbutifolia
sp|Q9ZPN8.1|TBB3_ELEIN  RecName: Full=Tubulin beta-3 chain; AltNa...    397   9e-135   Eleusine indica [crabgrass]
ref|NP_001105688.1|  tubulin beta-7 chain                               397   9e-135   Zea mays [maize]
ref|XP_011076163.1|  PREDICTED: tubulin beta-1 chain                    397   9e-135   Sesamum indicum [beniseed]
gb|ABA41230.1|  beta-tubulin                                            396   9e-135   Coleochaete scutata
ref|XP_010274718.1|  PREDICTED: tubulin beta-6 chain-like               397   9e-135   Nelumbo nucifera [Indian lotus]
ref|XP_004308083.1|  PREDICTED: tubulin beta-1 chain                    397   9e-135   Fragaria vesca subsp. vesca
ref|XP_004137743.1|  PREDICTED: tubulin beta-1 chain-like               397   9e-135   Cucumis sativus [cucumbers]
ref|XP_009150907.1|  PREDICTED: tubulin beta-8 chain                    397   9e-135   Brassica rapa
ref|XP_008807190.1|  PREDICTED: tubulin beta chain-like                 397   9e-135   Phoenix dactylifera
gb|ABY86655.1|  beta-tubulin 4                                          397   9e-135   Gossypium hirsutum [American cotton]
ref|XP_011022718.1|  PREDICTED: tubulin beta-5 chain-like               397   9e-135   Populus euphratica
ref|XP_010273068.1|  PREDICTED: tubulin beta-1 chain-like               397   9e-135   Nelumbo nucifera [Indian lotus]
ref|XP_009398811.1|  PREDICTED: tubulin beta-2 chain-like               397   9e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006490393.1|  PREDICTED: tubulin beta-1 chain-like               397   9e-135   Citrus sinensis [Valencia orange]
ref|XP_009402559.1|  PREDICTED: tubulin beta chain-like                 397   9e-135   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05193.1|  unnamed protein product                                397   1e-134   Coffea canephora [robusta coffee]
ref|XP_008376592.1|  PREDICTED: tubulin beta-1 chain-like               397   1e-134   Malus domestica [apple tree]
ref|XP_010108341.1|  Tubulin beta-1 chain                               397   1e-134   Morus notabilis
ref|XP_011072460.1|  PREDICTED: tubulin beta-8 chain-like               397   1e-134   Sesamum indicum [beniseed]
ref|XP_006394642.1|  hypothetical protein EUTSA_v10004208mg             397   1e-134   Eutrema salsugineum
gb|AFN53689.1|  putative tubulin beta-1 chain protein                   397   1e-134   Linum usitatissimum
ref|XP_003536467.1|  PREDICTED: tubulin beta-1 chain-like               397   1e-134   Glycine max [soybeans]
ref|XP_011029244.1|  PREDICTED: tubulin beta-1 chain-like               397   1e-134   Populus euphratica
gb|AAK96884.1|  beta tubulin                                            397   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510784.1|  tubulin beta chain, putative                       397   1e-134   Ricinus communis
ref|XP_002271992.1|  PREDICTED: tubulin beta-2 chain                    397   1e-134   Vitis vinifera
ref|XP_006644071.1|  PREDICTED: tubulin beta-1 chain-like               397   1e-134   Oryza brachyantha
ref|XP_010673793.1|  PREDICTED: tubulin beta-4 chain                    397   1e-134   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006404194.1|  hypothetical protein EUTSA_v10010366mg             397   1e-134   Eutrema salsugineum
ref|NP_568437.1|  tubulin beta-8 chain                                  397   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001168511.1|  hypothetical protein                               397   1e-134   Zea mays [maize]
ref|XP_002307960.1|  hypothetical protein POPTR_0006s03390g             397   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_009596463.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Nicotiana tomentosiformis
ref|NP_001239638.1|  beta-tubulin                                       397   1e-134   Glycine max [soybeans]
ref|XP_007040195.1|  Tubulin beta 8                                     397   1e-134   Theobroma cacao [chocolate]
ref|XP_009626214.1|  PREDICTED: tubulin beta-2 chain-like               397   1e-134   Nicotiana tomentosiformis
gb|KJB36870.1|  hypothetical protein B456_006G179900                    397   1e-134   Gossypium raimondii
ref|XP_009380867.1|  PREDICTED: tubulin beta chain-like                 397   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007038700.1|  Tubulin beta 8                                     397   1e-134   Theobroma cacao [chocolate]
ref|XP_006827680.1|  hypothetical protein AMTR_s00009p00255970          397   1e-134   Amborella trichopoda
gb|KHN08902.1|  Tubulin beta-1 chain                                    397   1e-134   Glycine soja [wild soybean]
ref|XP_007143420.1|  hypothetical protein PHAVU_007G070800g             397   1e-134   Phaseolus vulgaris [French bean]
ref|XP_002304488.1|  hypothetical protein POPTR_0003s12540g             397   1e-134   Populus trichocarpa [western balsam poplar]
gb|AAW88508.1|  beta-tubulin                                            393   1e-134   Lolium perenne [perennial ryegrass]
ref|XP_008654521.1|  PREDICTED: uncharacterized protein LOC100272...    397   1e-134   Zea mays [maize]
ref|XP_003554108.1|  PREDICTED: tubulin beta-4 chain-like               397   1e-134   Glycine max [soybeans]
ref|XP_002872076.1|  tubulin beta-8                                     397   1e-134   Arabidopsis lyrata subsp. lyrata
gb|ADZ76155.1|  beta-tubulin                                            397   1e-134   Vanilla planifolia [cultivated vanilla]
ref|XP_010088982.1|  Tubulin beta-1 chain                               397   1e-134   Morus notabilis
ref|XP_002270069.1|  PREDICTED: tubulin beta-4 chain                    397   1e-134   Vitis vinifera
gb|AAL92026.1|AF484959_1  tubulin beta-1                                397   1e-134   Gossypium hirsutum [American cotton]
ref|XP_006481398.1|  PREDICTED: tubulin beta-2 chain                    397   1e-134   Citrus sinensis [Valencia orange]
ref|XP_009767718.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Nicotiana sylvestris
ref|XP_009404699.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967662.1|  PREDICTED: tubulin beta-5 chain-like               397   1e-134   Setaria italica
ref|XP_009393282.1|  PREDICTED: tubulin beta chain-like                 397   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB34131.1|  hypothetical protein B456_006G049000                    397   1e-134   Gossypium raimondii
ref|XP_010243823.1|  PREDICTED: tubulin beta-4 chain-like               397   1e-134   Nelumbo nucifera [Indian lotus]
gb|ABY86660.1|  beta-tubulin 14                                         397   1e-134   Gossypium hirsutum [American cotton]
ref|XP_006387232.1|  hypothetical protein POPTR_1455s00200g             397   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_004986075.1|  PREDICTED: tubulin beta-2 chain-like               397   1e-134   Setaria italica
gb|KJB56320.1|  hypothetical protein B456_009G115600                    397   1e-134   Gossypium raimondii
ref|XP_010676480.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010923772.1|  PREDICTED: tubulin beta chain-like                 397   1e-134   Elaeis guineensis
emb|CDP09135.1|  unnamed protein product                                396   1e-134   Coffea canephora [robusta coffee]
ref|XP_004249322.1|  PREDICTED: tubulin beta-5 chain                    397   1e-134   Solanum lycopersicum
ref|XP_002283056.1|  PREDICTED: tubulin beta-5 chain                    397   1e-134   Vitis vinifera
ref|XP_002468688.1|  hypothetical protein SORBIDRAFT_01g050310          397   1e-134   Sorghum bicolor [broomcorn]
sp|Q41785.1|TBB8_MAIZE  RecName: Full=Tubulin beta-8 chain; AltNa...    397   1e-134   Zea mays [maize]
gb|ABY86665.1|  beta-tubulin 19                                         397   1e-134   Gossypium hirsutum [American cotton]
ref|XP_010542657.1|  PREDICTED: tubulin beta-2 chain-like               397   1e-134   Tarenaya hassleriana [spider flower]
ref|XP_010271905.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Nelumbo nucifera [Indian lotus]
gb|ABK95893.1|  unknown                                                 397   1e-134   Populus trichocarpa [western balsam poplar]
emb|CDM85842.1|  unnamed protein product                                397   1e-134   Triticum aestivum [Canadian hard winter wheat]
sp|P93176.1|TBB_HORVU  RecName: Full=Tubulin beta chain; AltName:...    397   1e-134   Hordeum vulgare [barley]
gb|ABY86662.1|  beta-tubulin 16                                         397   1e-134   Gossypium hirsutum [American cotton]
ref|XP_007016239.1|  Tubulin beta 8                                     397   1e-134   Theobroma cacao [chocolate]
tpg|DAA54230.1|  TPA: hypothetical protein ZEAMMB73_283964              396   1e-134   Zea mays [maize]
ref|XP_009588441.1|  PREDICTED: tubulin beta-1 chain                    397   1e-134   Nicotiana tomentosiformis
ref|XP_011075465.1|  PREDICTED: tubulin beta-5 chain isoform X2         397   1e-134   Sesamum indicum [beniseed]
ref|XP_011036386.1|  PREDICTED: tubulin beta-5 chain                    397   1e-134   Populus euphratica
ref|XP_010922039.1|  PREDICTED: tubulin beta-5 chain                    397   1e-134   Elaeis guineensis
gb|ABY86654.1|  beta-tubulin 2                                          397   1e-134   Gossypium hirsutum [American cotton]
ref|XP_009385041.1|  PREDICTED: tubulin beta chain-like                 397   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011040743.1|  PREDICTED: tubulin beta-5 chain-like               397   1e-134   Populus euphratica
gb|ABK94073.1|  unknown                                                 397   1e-134   Populus trichocarpa [western balsam poplar]
gb|KHN26219.1|  Tubulin beta-2 chain                                    395   1e-134   Glycine soja [wild soybean]
ref|XP_002962554.1|  hypothetical protein SELMODRAFT_23468              395   1e-134   Selaginella moellendorffii
ref|XP_011079080.1|  PREDICTED: tubulin beta-5 chain-like               397   1e-134   Sesamum indicum [beniseed]
ref|XP_006644872.1|  PREDICTED: tubulin beta-4 chain-like               397   1e-134   Oryza brachyantha
ref|XP_010673064.1|  PREDICTED: tubulin beta-6 chain isoform X2         397   1e-134   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006429261.1|  hypothetical protein CICLE_v10011723mg             397   1e-134   Citrus clementina
ref|NP_001055546.1|  Os05g0413200                                       397   1e-134   
ref|XP_010520236.1|  PREDICTED: tubulin beta-2 chain-like               397   1e-134   Tarenaya hassleriana [spider flower]
gb|ABK92780.1|  unknown                                                 397   1e-134   Populus trichocarpa [western balsam poplar]
emb|CAM58986.1|  beta tubulin 8                                         397   1e-134   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001105317.1|  tubulin beta-6 chain                               397   1e-134   Zea mays [maize]
gb|KDP25455.1|  hypothetical protein JCGZ_20611                         397   2e-134   Jatropha curcas
ref|XP_006339255.1|  PREDICTED: tubulin beta-1 chain-like               397   2e-134   Solanum tuberosum [potatoes]
sp|Q9ZRB1.1|TBB2_WHEAT  RecName: Full=Tubulin beta-2 chain; AltNa...    397   2e-134   Triticum aestivum [Canadian hard winter wheat]
pir||JC2510  beta-tubulin R1623 - rice                                  397   2e-134
ref|NP_001105458.1|  tubulin beta-5 chain                               397   2e-134   Zea mays [maize]
ref|NP_001044565.1|  Os01g0805900                                       397   2e-134   
ref|XP_008790003.1|  PREDICTED: tubulin beta-1 chain-like               397   2e-134   Phoenix dactylifera
sp|Q9ZPN7.1|TBB4_ELEIN  RecName: Full=Tubulin beta-4 chain; AltNa...    397   2e-134   Eleusine indica [crabgrass]
ref|XP_009412045.1|  PREDICTED: tubulin beta chain-like                 397   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006410012.1|  hypothetical protein EUTSA_v10016651mg             397   2e-134   Eutrema salsugineum
ref|XP_002456503.1|  hypothetical protein SORBIDRAFT_03g037490          397   2e-134   Sorghum bicolor [broomcorn]
ref|XP_004982240.1|  PREDICTED: tubulin beta-3 chain-like               397   2e-134   Setaria italica
gb|AIS84169.1|  beta-tubulin 4a                                         397   2e-134   Linum usitatissimum
ref|XP_010087906.1|  Tubulin beta-1 chain                               397   2e-134   Morus notabilis
ref|XP_009395425.1|  PREDICTED: tubulin beta-2 chain-like               397   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW79504.1|  hypothetical protein ZEAMMB73_908177                    397   2e-134   Zea mays [maize]
gb|EMT08428.1|  Tubulin beta-1 chain                                    397   2e-134   Aegilops tauschii
sp|Q9ZPN9.1|TBB2_ELEIN  RecName: Full=Tubulin beta-2 chain; AltNa...    397   2e-134   Eleusine indica [crabgrass]
ref|XP_010905373.1|  PREDICTED: tubulin beta-8 chain-like               397   2e-134   Elaeis guineensis
ref|XP_008798348.1|  PREDICTED: tubulin beta-1 chain                    397   2e-134   Phoenix dactylifera
ref|XP_010909062.1|  PREDICTED: tubulin beta-1 chain                    397   2e-134   Elaeis guineensis
emb|CAE52516.1|  beta tubulin                                           397   2e-134   Setaria viridis
ref|XP_011075464.1|  PREDICTED: tubulin beta-5 chain isoform X1         397   2e-134   Sesamum indicum [beniseed]
ref|NP_001042761.1|  Os01g0282800                                       397   2e-134   
ref|XP_006649228.1|  PREDICTED: tubulin beta-2 chain-like               397   2e-134   Oryza brachyantha
ref|XP_008787350.1|  PREDICTED: tubulin beta chain-like                 397   2e-134   Phoenix dactylifera
ref|XP_002992756.1|  hypothetical protein SELMODRAFT_186992             397   2e-134   Selaginella moellendorffii
ref|XP_010516638.1|  PREDICTED: tubulin beta chain                      397   2e-134   Camelina sativa [gold-of-pleasure]
ref|XP_009396166.1|  PREDICTED: tubulin beta-1 chain                    396   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002466715.1|  hypothetical protein SORBIDRAFT_01g012740          396   2e-134   Sorghum bicolor [broomcorn]
dbj|BAA82637.1|  Beta-tubulin                                           396   2e-134   Zinnia violacea [garden zinnia]
ref|XP_010934750.1|  PREDICTED: tubulin beta-2 chain-like               396   2e-134   Elaeis guineensis
emb|CDO98351.1|  unnamed protein product                                396   2e-134   Coffea canephora [robusta coffee]
ref|XP_003592284.1|  Tubulin beta chain                                 396   2e-134   Medicago truncatula
ref|XP_010685649.1|  PREDICTED: tubulin beta-1 chain                    396   3e-134   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EEC74344.1|  hypothetical protein OsI_09642                          396   3e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_011072483.1|  PREDICTED: tubulin beta-8 chain-like               396   3e-134   Sesamum indicum [beniseed]
gb|AGH08233.1|  beta-tubulin 1                                          396   3e-134   Salix arbutifolia
ref|XP_008811481.1|  PREDICTED: tubulin beta-8 chain-like               396   3e-134   Phoenix dactylifera
ref|XP_009763987.1|  PREDICTED: tubulin beta-8 chain-like               396   3e-134   Nicotiana sylvestris
ref|XP_006287738.1|  hypothetical protein CARUB_v10000948mg             396   3e-134   Capsella rubella
ref|XP_004249594.1|  PREDICTED: tubulin beta-2 chain                    396   3e-134   Solanum lycopersicum
gb|AIS84176.1|  beta-tubulin 7c                                         396   3e-134   Linum usitatissimum
ref|XP_010469941.1|  PREDICTED: tubulin beta-7 chain-like               396   3e-134   Camelina sativa [gold-of-pleasure]
gb|AIZ74332.1|  beta-tubulin                                            396   3e-134   Pinus massoniana [Chinese red pine]
gb|ADE76978.1|  unknown                                                 396   3e-134   Picea sitchensis
gb|EYU43219.1|  hypothetical protein MIMGU_mgv1a006450mg                396   3e-134   Erythranthe guttata [common monkey flower]
ref|XP_010510475.1|  PREDICTED: tubulin beta-7 chain isoform X1         396   3e-134   Camelina sativa [gold-of-pleasure]
ref|XP_004249588.1|  PREDICTED: tubulin beta-2 chain-like               396   3e-134   Solanum lycopersicum
emb|CAA55912.1|  beta tubulin                                           396   3e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011025004.1|  PREDICTED: tubulin beta-4 chain-like               396   3e-134   Populus euphratica
gb|KFK27675.1|  hypothetical protein AALP_AA8G414100                    396   3e-134   Arabis alpina [alpine rockcress]
ref|XP_002963869.1|  hypothetical protein SELMODRAFT_266715             396   3e-134   Selaginella moellendorffii
ref|XP_008388103.1|  PREDICTED: tubulin beta chain-like                 396   3e-134   Malus domestica [apple tree]
ref|XP_010673063.1|  PREDICTED: tubulin beta-6 chain isoform X1         397   3e-134   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010926477.1|  PREDICTED: tubulin beta-5 chain-like               396   3e-134   
ref|XP_010940464.1|  PREDICTED: tubulin beta-2 chain                    396   3e-134   
ref|XP_006358716.1|  PREDICTED: tubulin beta-2 chain-like               396   3e-134   
gb|AIS84174.1|  beta-tubulin 7a                                         396   3e-134   
gb|AGH08230.1|  beta-tubulin 7                                          396   3e-134   
sp|P29502.1|TBB3_PEA  RecName: Full=Tubulin beta-3 chain; AltName...    396   3e-134   
emb|CDP09741.1|  unnamed protein product                                393   3e-134   
ref|XP_006650378.1|  PREDICTED: tubulin beta-8 chain-like               396   3e-134   
dbj|BAJ21570.1|  beta-tubulin                                           394   3e-134   
ref|XP_002509780.1|  tubulin beta chain, putative                       396   3e-134   
ref|XP_009590874.1|  PREDICTED: tubulin beta-8 chain-like               396   3e-134   
ref|XP_010521908.1|  PREDICTED: tubulin beta-2 chain-like               396   3e-134   
gb|KJB09278.1|  hypothetical protein B456_001G132500                    396   3e-134   
ref|XP_009793967.1|  PREDICTED: tubulin beta-2 chain-like               396   3e-134   
ref|NP_001289638.1|  tubulin beta-9 chain                               396   3e-134   
sp|Q6VAF8.1|TBB3_GOSHI  RecName: Full=Tubulin beta-3 chain; AltNa...    395   3e-134   
ref|XP_002969478.1|  hypothetical protein SELMODRAFT_170592             396   3e-134   
gb|KHN25859.1|  Tubulin beta-1 chain                                    396   3e-134   
ref|XP_008806874.1|  PREDICTED: tubulin beta-2 chain                    396   3e-134   
ref|NP_180515.1|  tubulin beta-7 chain                                  396   3e-134   
ref|XP_010519051.1|  PREDICTED: tubulin beta chain-like                 396   3e-134   
gb|AIY99979.1|  tubulin beta 3                                          396   3e-134   
ref|XP_011032195.1|  PREDICTED: tubulin beta-2 chain-like               396   4e-134   
gb|AGZ90159.1|  tubulin beta                                            396   4e-134   
gb|AIS84175.1|  beta-tubulin 7b                                         396   4e-134   
ref|XP_010909929.1|  PREDICTED: tubulin beta-1 chain-like               396   4e-134   
gb|EMT13417.1|  Tubulin beta-1 chain                                    394   4e-134   
ref|XP_010541432.1|  PREDICTED: tubulin beta-2 chain-like               396   4e-134   
ref|NP_001167653.1|  uncharacterized protein LOC100381283               396   4e-134   
ref|XP_006430521.1|  hypothetical protein CICLE_v10011719mg             396   4e-134   
emb|CDX98679.1|  BnaA03g44640D                                          396   4e-134   
ref|XP_003563397.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    396   4e-134   
gb|AAK32919.1|AF367332_1  AT5g62700/MRG21_12                            392   4e-134   
sp|Q8H7U1.1|TBB2_ORYSJ  RecName: Full=Tubulin beta-2 chain; AltNa...    396   4e-134   
ref|XP_002322609.1|  hypothetical protein POPTR_0016s03300g             396   4e-134   
ref|XP_011035226.1|  PREDICTED: tubulin beta-2 chain                    396   4e-134   
ref|XP_002298330.1|  Tubulin beta-2/beta-3 chain family protein         396   4e-134   
ref|XP_011041397.1|  PREDICTED: tubulin beta-5 chain-like               396   4e-134   
ref|XP_009420971.1|  PREDICTED: tubulin beta-4 chain                    396   4e-134   
gb|EYU19549.1|  hypothetical protein MIMGU_mgv1a006353mg                396   4e-134   
ref|XP_009794774.1|  PREDICTED: tubulin beta-2 chain                    396   4e-134   
ref|XP_007028241.1|  Beta-6 tubulin                                     396   4e-134   
ref|XP_009629036.1|  PREDICTED: tubulin beta-2 chain                    396   4e-134   
ref|XP_002313404.1|  hypothetical protein POPTR_0009s04500g             396   4e-134   
ref|XP_003624926.1|  Tubulin beta chain                                 396   4e-134   
gb|KDP21557.1|  hypothetical protein JCGZ_03665                         396   4e-134   
ref|XP_002881356.1|  beta-tubulin R2242-rice                            396   4e-134   
emb|CAN64745.1|  hypothetical protein VITISV_041322                     396   4e-134   
ref|XP_006826860.1|  hypothetical protein AMTR_s00010p00119100          396   4e-134   
gb|AGH08235.1|  beta-tubulin 11                                         396   4e-134   
ref|XP_007015367.1|  Beta-6 tubulin isoform 1                           396   4e-134   
ref|XP_002961244.1|  hypothetical protein SELMODRAFT_164404             396   4e-134   
ref|NP_001167651.1|  uncharacterized protein LOC100381281               397   4e-134   
ref|XP_006482055.1|  PREDICTED: tubulin beta-1 chain-like               396   4e-134   
gb|ACM89775.1|  beta-tubulin 3                                          396   4e-134   
ref|XP_004504719.1|  PREDICTED: tubulin beta-3 chain-like               395   4e-134   
ref|XP_009337361.1|  PREDICTED: tubulin beta chain-like                 395   4e-134   
ref|XP_009374320.1|  PREDICTED: tubulin beta chain                      395   4e-134   
ref|XP_008220065.1|  PREDICTED: tubulin beta chain                      395   4e-134   
gb|KDP36971.1|  hypothetical protein JCGZ_08563                         396   5e-134   
ref|XP_007211629.1|  hypothetical protein PRUPE_ppa005785mg             395   5e-134   
ref|XP_007133955.1|  hypothetical protein PHAVU_010G006400g             396   5e-134   
ref|XP_010504960.1|  PREDICTED: tubulin beta chain-like                 395   5e-134   
ref|XP_009403832.1|  PREDICTED: tubulin beta-1 chain-like               395   5e-134   
ref|XP_010232467.1|  PREDICTED: tubulin beta chain                      395   5e-134   
dbj|BAJ21573.1|  beta-tubulin                                           394   5e-134   
gb|ACG35721.1|  tubulin beta-8 chain                                    395   5e-134   
ref|NP_001105456.1|  tubulin beta-3 chain                               395   5e-134   
ref|XP_002881057.1|  tubulin beta-7 chain                               395   5e-134   
ref|XP_004294235.1|  PREDICTED: tubulin beta chain                      395   5e-134   
gb|EYU20815.1|  hypothetical protein MIMGU_mgv1a006356mg                395   5e-134   
gb|AFW84815.1|  hypothetical protein ZEAMMB73_647337                    397   5e-134   
ref|XP_011019176.1|  PREDICTED: tubulin beta chain-like                 395   5e-134   
gb|KEH31339.1|  tubulin                                                 395   5e-134   
gb|ACA24138.1|  beta-tubulin                                            391   5e-134   
ref|NP_001050825.1|  Os03g0661300                                       395   5e-134   
ref|XP_002282157.1|  PREDICTED: tubulin beta chain                      395   5e-134   
ref|XP_009362200.1|  PREDICTED: tubulin beta chain-like                 395   6e-134   
ref|XP_002309109.1|  hypothetical protein POPTR_0006s09610g             395   6e-134   
gb|AIY99978.1|  tubulin beta 2                                          395   6e-134   
ref|XP_006424984.1|  hypothetical protein CICLE_v10028436mg             395   6e-134   
gb|EMT00232.1|  Tubulin beta-2 chain                                    396   6e-134   
ref|XP_007015369.1|  Beta-6 tubulin isoform 1                           395   6e-134   
emb|CAA55022.1|  beta tubulin                                           395   6e-134   
gb|AGH08227.1|  beta-tubulin 4                                          395   6e-134   
ref|NP_001289666.1|  tubulin beta-5 chain                               395   6e-134   
emb|CDY31428.1|  BnaC03g63960D                                          395   6e-134   
ref|XP_003559023.1|  PREDICTED: tubulin beta-2 chain                    395   6e-134   
ref|XP_003531075.2|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    395   6e-134   
ref|XP_009137158.1|  PREDICTED: tubulin beta-9 chain-like               395   6e-134   
gb|ACJ84273.1|  unknown                                                 394   7e-134   
ref|XP_002960790.1|  hypothetical protein SELMODRAFT_73284              395   7e-134   
gb|AEG89522.1|  tubulin beta-6                                          395   7e-134   
gb|AHZ58494.1|  beta-tubulin 1                                          387   7e-134   
ref|XP_003568202.1|  PREDICTED: tubulin beta-5 chain-like               395   7e-134   
ref|XP_011085182.1|  PREDICTED: tubulin beta chain-like                 397   7e-134   
ref|XP_010654216.1|  PREDICTED: tubulin beta-2 chain                    395   7e-134   
ref|XP_008782284.1|  PREDICTED: tubulin beta-6 chain-like               395   7e-134   
gb|KFK36378.1|  hypothetical protein AALP_AA4G115600                    395   7e-134   
gb|AFK44728.1|  unknown                                                 394   7e-134   
ref|XP_006294210.1|  hypothetical protein CARUB_v10023206mg             395   8e-134   
ref|XP_006399740.1|  hypothetical protein EUTSA_v10013524mg             395   8e-134   
ref|XP_009108485.1|  PREDICTED: tubulin beta-9 chain                    395   8e-134   
emb|CDX94014.1|  BnaC07g36480D                                          395   8e-134   
ref|XP_002298455.1|  hypothetical protein POPTR_0001s27960g             395   8e-134   
ref|XP_010536143.1|  PREDICTED: tubulin beta-4 chain                    395   8e-134   
gb|AGH08240.1|  beta-tubulin 15                                         395   8e-134   
ref|XP_010557230.1|  PREDICTED: tubulin beta-2 chain-like               395   8e-134   
gb|AGH08229.1|  beta-tubulin 17                                         395   8e-134   
ref|XP_010419814.1|  PREDICTED: tubulin beta-6 chain-like               395   8e-134   
ref|NP_196786.1|  beta-6 tubulin                                        395   8e-134   
ref|XP_006289933.1|  hypothetical protein CARUB_v10003555mg             395   8e-134   
gb|EEE58163.1|  hypothetical protein OsJ_09084                          396   8e-134   
ref|XP_010509706.1|  PREDICTED: tubulin beta chain-like                 395   9e-134   
ref|XP_010459234.1|  PREDICTED: tubulin beta-2 chain-like               395   9e-134   
tpg|DAA57202.1|  TPA: beta tubulin6                                     396   9e-134   
gb|AHJ25926.1|  tubulin beta chain                                      395   9e-134   
ref|XP_008788536.1|  PREDICTED: tubulin beta-5 chain-like               395   9e-134   
ref|XP_009144365.1|  PREDICTED: tubulin beta-7 chain                    395   9e-134   
ref|XP_008778745.1|  PREDICTED: tubulin beta-2 chain-like               395   9e-134   
ref|XP_004962088.1|  PREDICTED: tubulin beta-2 chain-like               395   9e-134   
ref|XP_002281289.1|  PREDICTED: tubulin beta-2 chain                    395   9e-134   
emb|CDY51360.1|  BnaA04g28540D                                          395   9e-134   
ref|XP_009121863.1|  PREDICTED: tubulin beta-6 chain                    395   9e-134   
emb|CDY45452.1|  BnaA05g12490D                                          395   9e-134   
ref|NP_001265938.1|  tubulin beta chain                                 395   1e-133   
gb|KFK44234.1|  hypothetical protein AALP_AA1G232100                    395   1e-133   
ref|XP_010228968.1|  PREDICTED: tubulin beta-4 chain                    395   1e-133   
ref|XP_004240391.1|  PREDICTED: tubulin beta-8 chain-like               395   1e-133   
ref|XP_002523247.1|  tubulin beta chain, putative                       395   1e-133   
ref|XP_011036385.1|  PREDICTED: tubulin beta-1 chain-like               395   1e-133   
gb|EEC71666.1|  hypothetical protein OsI_04129                          397   1e-133   
emb|CDY53366.1|  BnaC04g54460D                                          395   1e-133   
gb|EYU18601.1|  hypothetical protein MIMGU_mgv1a005215mg                396   1e-133   
ref|XP_004240734.1|  PREDICTED: tubulin beta-1 chain                    395   1e-133   
ref|XP_003527622.1|  PREDICTED: tubulin beta chain-like                 395   1e-133   
ref|NP_001275206.1|  tubulin beta-2 chain-like                          395   1e-133   
ref|XP_002314014.2|  hypothetical protein POPTR_0009s07150g             395   1e-133   
gb|EYU38453.1|  hypothetical protein MIMGU_mgv1a006387mg                395   1e-133   
gb|AAF71758.1|  beta-tubulin                                            390   1e-133   
emb|CDX69693.1|  BnaA10g20420D                                          395   1e-133   
ref|XP_003523477.1|  PREDICTED: tubulin beta chain-like                 395   1e-133   
ref|XP_004970293.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    397   1e-133   
gb|AIS84172.1|  beta-tubulin 6a                                         395   1e-133   
ref|XP_009393896.1|  PREDICTED: tubulin beta chain                      395   1e-133   
emb|CAM58981.1|  beta tubulin 3                                         395   1e-133   
gb|KFK28005.1|  hypothetical protein AALP_AA8G459200                    395   1e-133   
ref|NP_001274811.1|  uncharacterized protein LOC102577679               395   1e-133   
ref|XP_006848044.1|  hypothetical protein AMTR_s00029p00190040          395   1e-133   
ref|XP_004161837.1|  PREDICTED: tubulin beta-1 chain-like               395   1e-133   
ref|XP_006836258.1|  hypothetical protein AMTR_s00101p00135960          393   1e-133   
emb|CDP06213.1|  unnamed protein product                                398   1e-133   
gb|AIS84173.1|  beta-tubulin 6b                                         395   1e-133   
ref|XP_008227321.1|  PREDICTED: tubulin beta-4 chain                    395   1e-133   
ref|XP_003603765.1|  Tubulin beta chain                                 395   1e-133   
gb|ACN40991.1|  unknown                                                 394   1e-133   
gb|ABY86663.1|  beta-tubulin 17                                         394   1e-133   
gb|ABA46752.1|  unknown                                                 395   1e-133   
ref|NP_001105457.1|  tubulin beta-4 chain                               395   1e-133   
ref|XP_004137501.1|  PREDICTED: tubulin beta-1 chain-like               394   1e-133   
ref|XP_002864813.1|  tubulin beta-2                                     395   1e-133   
ref|XP_004235778.1|  PREDICTED: tubulin beta chain-like                 394   1e-133   
ref|NP_568959.1|  tubulin beta-2/beta-3 chain                           395   1e-133   
gb|EMS61990.1|  Tubulin beta-4 chain                                    394   1e-133   
emb|CAM58983.1|  beta tubulin 5                                         394   1e-133   
ref|XP_008464297.1|  PREDICTED: tubulin beta chain-like                 394   1e-133   
gb|AGN95064.1|  putative tubulin beta-2-like protein                    395   1e-133   
gb|KHN45928.1|  Tubulin beta-1 chain                                    395   1e-133   
ref|XP_009144143.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    395   1e-133   
gb|AAA66495.1|  beta-tubulin                                            394   1e-133   
gb|KHN27008.1|  Tubulin beta-1 chain                                    394   1e-133   
gb|AGH08238.1|  beta-tubulin 2                                          394   1e-133   
ref|XP_003516925.1|  PREDICTED: tubulin beta-2 chain-like               394   1e-133   
ref|XP_002877519.1|  tubulin beta-2                                     394   1e-133   
ref|XP_003520939.1|  PREDICTED: tubulin beta-2 chain-like               394   2e-133   
ref|XP_006404432.1|  hypothetical protein EUTSA_v10010368mg             394   2e-133   
ref|NP_001289924.1|  tubulin beta-2 chain                               394   2e-133   
gb|KFK34015.1|  hypothetical protein AALP_AA5G090900                    394   2e-133   
ref|XP_010916508.1|  PREDICTED: tubulin beta chain-like                 394   2e-133   
ref|XP_007160535.1|  hypothetical protein PHAVU_002G329800g             394   2e-133   
ref|XP_010255399.1|  PREDICTED: tubulin beta chain-like                 394   2e-133   
gb|ABA41233.1|  beta-tubulin                                            392   2e-133   
ref|XP_006291122.1|  hypothetical protein CARUB_v10017235mg             394   2e-133   
ref|XP_007205123.1|  hypothetical protein PRUPE_ppa004884mg             396   2e-133   
ref|XP_004152649.1|  PREDICTED: tubulin beta-1 chain-like               394   2e-133   
ref|XP_004302651.1|  PREDICTED: tubulin beta-1 chain-like               394   2e-133   
ref|XP_009803077.1|  PREDICTED: tubulin beta-1 chain-like               394   2e-133   
gb|KDP24509.1|  hypothetical protein JCGZ_25073                         394   2e-133   
gb|ACM89774.1|  beta-tubulin 14                                         394   2e-133   
gb|AAV71172.1|  beta-tubulin                                            393   2e-133   
gb|AEN19688.1|  beta-tubulin                                            390   2e-133   
ref|XP_009134084.1|  PREDICTED: tubulin beta-9 chain                    394   2e-133   
ref|XP_010434259.1|  PREDICTED: tubulin beta-9 chain                    394   2e-133   
ref|XP_001756507.1|  predicted protein                                  394   2e-133   
ref|XP_006283733.1|  hypothetical protein CARUB_v10004805mg             394   2e-133   
gb|ABY86661.1|  beta-tubulin 15                                         394   2e-133   
gb|ACG32188.1|  tubulin beta-4 chain                                    394   2e-133   
ref|XP_007136094.1|  hypothetical protein PHAVU_009G017300g             394   2e-133   
ref|XP_008444814.1|  PREDICTED: tubulin beta chain                      394   2e-133   
gb|KJB37164.1|  hypothetical protein B456_006G191900                    394   2e-133   
emb|CDX82788.1|  BnaC01g12380D                                          394   2e-133   
gb|KJB20685.1|  hypothetical protein B456_003G159300                    394   2e-133   
ref|NP_001105426.1|  tubulin beta-2 chain                               394   2e-133   
ref|NP_001168917.1|  uncharacterized protein LOC100382727               397   2e-133   
dbj|BAP59013.1|  beta tubulin                                           394   3e-133   
gb|AEG89521.1|  tubulin beta-6                                          394   3e-133   
gb|AAD10493.1|  beta-tubulin 6                                          394   3e-133   
gb|AGH08225.1|  beta-tubulin 18                                         394   3e-133   
ref|XP_004291357.1|  PREDICTED: tubulin beta chain-like                 394   3e-133   
ref|XP_004506645.1|  PREDICTED: tubulin beta-2 chain-like               394   3e-133   
ref|XP_008221256.1|  PREDICTED: tubulin beta chain-like                 394   3e-133   
ref|XP_002969671.1|  hypothetical protein SELMODRAFT_410535             393   3e-133   
gb|EYU23480.1|  hypothetical protein MIMGU_mgv1a006417mg                394   3e-133   
ref|XP_002321512.2|  hypothetical protein POPTR_0015s04560g             394   3e-133   
ref|XP_009414515.1|  PREDICTED: tubulin beta chain-like                 394   3e-133   
ref|XP_007201980.1|  hypothetical protein PRUPE_ppa004851mg             395   3e-133   
ref|XP_007222097.1|  hypothetical protein PRUPE_ppa005644mg             394   3e-133   
ref|XP_004493370.1|  PREDICTED: tubulin beta-6 chain-like               394   3e-133   
ref|XP_003567397.1|  PREDICTED: tubulin beta-4 chain                    393   4e-133   
emb|CDX97180.1|  BnaC09g44450D                                          395   4e-133   
ref|XP_003604816.1|  Tubulin beta chain                                 394   4e-133   



>gb|EMT33700.1| Tubulin beta-3 chain [Aegilops tauschii]
Length=366

 Score =   399 bits (1026),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  28   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  87

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  88   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  147

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  148  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  207

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  208  PELTQQMWDSKNMMCAADPRHGRYLT  233



>gb|ACN32164.1| unknown [Zea mays]
Length=380

 Score =   399 bits (1025),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>ref|XP_010495405.1| PREDICTED: tubulin beta-8 chain-like, partial [Camelina sativa]
Length=353

 Score =   398 bits (1022),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  11   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  70

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  71   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  130

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  131  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  190

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  191  PELTQQMWDSKNMMCAADPRHGRYLT  216



>gb|ACF88196.1| unknown [Zea mays]
Length=381

 Score =   398 bits (1023),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>gb|EEE55549.1| hypothetical protein OsJ_03802 [Oryza sativa Japonica Group]
Length=382

 Score =   398 bits (1023),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>ref|NP_001140291.1| uncharacterized protein LOC100272336 [Zea mays]
 gb|ACN28163.1| unknown [Zea mays]
Length=379

 Score =   398 bits (1022),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>emb|CAA55021.1| beta tubulin [Oryza sativa Japonica Group]
Length=383

 Score =   398 bits (1022),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  49   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  108

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  109  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  168

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  169  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  228

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  229  PELTQQMWDAKNMMCAADPRHGRYLT  254



>gb|EPS64778.1| hypothetical protein M569_10002, partial [Genlisea aurea]
Length=300

 Score =   395 bits (1014),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  50   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  109

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  110  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  169

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  170  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  229

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  230  PELTQQMWDAKNMMCAADPRHGRYLT  255



>gb|ABY75517.1| beta-tubulin, partial [Bambusa emeiensis]
Length=319

 Score =   395 bits (1015),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  28   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  87

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ P+FGDLN
Sbjct  88   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTAPSFGDLN  147

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  148  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  207

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  208  PELTQQMWDAKNMMCAADPRHGRYLT  233



>ref|XP_002267304.1| PREDICTED: tubulin beta chain [Vitis vinifera]
Length=445

 Score =   399 bits (1026),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|P28551.2|TBB3_SOYBN RecName: Full=Tubulin beta chain; AltName: Full=Beta-tubulin, 
partial [Glycine max]
 emb|CAA42777.1| beta-tubulin [Glycine max]
Length=408

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|P25862.1|TBB1_AVESA RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin, 
partial [Avena sativa]
 emb|CAA38630.1| beta-tubulin [Avena sativa]
Length=386

 Score =   397 bits (1021),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  45   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  104

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  105  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  164

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  165  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  224

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  225  PELTQQMWDSKNMMCAADPRHGRYLT  250



>gb|AET80382.1| beta-tubulin 1, partial [x Doritaenopsis hybrid cultivar]
 gb|AET80383.1| beta-tubulin 2 [x Doritaenopsis hybrid cultivar]
Length=351

 Score =   396 bits (1017),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>sp|Q40665.2|TBB3_ORYSJ RecName: Full=Tubulin beta-3 chain; AltName: Full=Beta-3-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAD46004.1| beta-tubulin R2242 [Oryza sativa Japonica Group]
 dbj|BAD46281.1| beta-tubulin R2242 [Oryza sativa Japonica Group]
 gb|EAZ02040.1| hypothetical protein OsI_24075 [Oryza sativa Indica Group]
 gb|EAZ37984.1| hypothetical protein OsJ_22330 [Oryza sativa Japonica Group]
 dbj|BAG91329.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   399 bits (1026),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ACM78033.1| beta-tubulin [Citrus maxima]
Length=444

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006656368.1| PREDICTED: tubulin beta-3 chain-like [Oryza brachyantha]
Length=445

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AJA29691.1| beta-tubulin [Betula luminifera]
Length=382

 Score =   397 bits (1020),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRM+LT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMLLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>ref|NP_001058334.1| Os06g0671900 [Oryza sativa Japonica Group]
 dbj|BAF20248.1| Os06g0671900 [Oryza sativa Japonica Group]
Length=433

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003535107.1| PREDICTED: tubulin beta-3 chain-like [Glycine max]
 gb|KHN23022.1| Tubulin beta-3 chain [Glycine soja]
Length=446

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|EPS63676.1| beta-tubulin, partial [Genlisea aurea]
Length=441

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011096695.1| PREDICTED: tubulin beta chain [Sesamum indicum]
Length=444

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010941598.1| PREDICTED: tubulin beta chain [Elaeis guineensis]
Length=444

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006448872.1| hypothetical protein CICLE_v10015255mg [Citrus clementina]
 ref|XP_006468333.1| PREDICTED: tubulin beta-3 chain-like [Citrus sinensis]
 gb|ESR62112.1| hypothetical protein CICLE_v10015255mg [Citrus clementina]
 gb|KDO75207.1| hypothetical protein CISIN_1g013391mg [Citrus sinensis]
Length=444

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006646923.1| PREDICTED: LOW QUALITY PROTEIN: tubulin beta-5 chain-like [Oryza 
brachyantha]
Length=447

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001169695.1| uncharacterized protein LOC100383576 [Zea mays]
 gb|ACN34551.1| unknown [Zea mays]
 gb|AFW70248.1| hypothetical protein ZEAMMB73_202058 [Zea mays]
Length=444

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002451606.1| hypothetical protein SORBIDRAFT_04g004520 [Sorghum bicolor]
 gb|EES04582.1| hypothetical protein SORBIDRAFT_04g004520 [Sorghum bicolor]
Length=446

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008445559.1| PREDICTED: tubulin beta chain [Cucumis melo]
Length=443

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010098541.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB75201.1| Tubulin beta-1 chain [Morus notabilis]
Length=445

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010906251.1| PREDICTED: tubulin beta chain-like [Elaeis guineensis]
Length=443

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009792728.1| PREDICTED: tubulin beta chain [Nicotiana sylvestris]
Length=444

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009622091.1| PREDICTED: tubulin beta chain [Nicotiana tomentosiformis]
Length=444

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001046006.1| Os02g0167300 [Oryza sativa Japonica Group]
 sp|P46265.1|TBB5_ORYSJ RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAA06382.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAD26239.1| tubulin beta chain [Oryza sativa Japonica Group]
 dbj|BAF07920.1| Os02g0167300 [Oryza sativa Japonica Group]
 gb|EAY84626.1| hypothetical protein OsI_05997 [Oryza sativa Indica Group]
 gb|EAZ21874.1| hypothetical protein OsJ_05524 [Oryza sativa Japonica Group]
 dbj|BAH00558.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003546276.1| PREDICTED: tubulin beta-3 chain [Glycine max]
 gb|KHN14312.1| Tubulin beta-3 chain [Glycine soja]
Length=446

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004486478.1| PREDICTED: tubulin beta-3 chain-like [Cicer arietinum]
Length=445

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004951797.1| PREDICTED: tubulin beta-3 chain-like [Setaria italica]
Length=446

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011039269.1| PREDICTED: tubulin beta chain-like [Populus euphratica]
Length=445

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004135544.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 gb|KGN65908.1| hypothetical protein Csa_1G537560 [Cucumis sativus]
Length=443

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008644456.1| PREDICTED: tubulin beta-7 chain [Zea mays]
 gb|AFW67455.1| hypothetical protein ZEAMMB73_720122 [Zea mays]
Length=445

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>dbj|BAA02505.1| beta-tubulin [Oryza sativa Japonica Group]
Length=444

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001051451.1| Os03g0780600 [Oryza sativa Japonica Group]
 sp|P37832.2|TBB7_ORYSJ RecName: Full=Tubulin beta-7 chain; AltName: Full=Beta-7-tubulin; 
AltName: Full=pTUB22 [Oryza sativa Japonica Group]
 gb|AAK09229.1|AC084320_16 beta-tubulin [Oryza sativa Japonica Group]
 gb|ABF99177.1| Tubulin beta-7 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99178.1| Tubulin beta-7 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13365.1| Os03g0780600 [Oryza sativa Japonica Group]
 gb|EAY92049.1| hypothetical protein OsI_13743 [Oryza sativa Indica Group]
 dbj|BAG99904.1| unnamed protein product [Oryza sativa Japonica Group]
Length=444

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009405384.1| PREDICTED: tubulin beta chain [Musa acuminata subsp. malaccensis]
Length=445

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007015370.1| Beta-6 tubulin isoform 2 [Theobroma cacao]
 gb|EOY32989.1| Beta-6 tubulin isoform 2 [Theobroma cacao]
Length=385

 Score =   397 bits (1019),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>ref|XP_008793578.1| PREDICTED: tubulin beta chain [Phoenix dactylifera]
Length=445

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007022910.1| Tubulin beta-7 chain [Theobroma cacao]
 gb|EOY25532.1| Tubulin beta-7 chain [Theobroma cacao]
Length=446

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007147456.1| hypothetical protein PHAVU_006G126100g [Phaseolus vulgaris]
 gb|ESW19450.1| hypothetical protein PHAVU_006G126100g [Phaseolus vulgaris]
Length=447

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002523174.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF39205.1| tubulin beta chain, putative [Ricinus communis]
Length=444

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ACN28844.1| unknown [Zea mays]
Length=380

 Score =   396 bits (1018),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ P+FGDLN
Sbjct  102  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTNPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>gb|AEN19686.1| beta-tubulin [Cymbidium faberi]
Length=351

 Score =   395 bits (1016),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNL+PFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_006650676.1| PREDICTED: tubulin beta-7 chain-like [Oryza brachyantha]
Length=446

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009399255.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=449

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|P18025.1|TBB1_MAIZE RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Zea mays]
 emb|CAA37060.1| beta 1 tubulin [Zea mays]
Length=446

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGS MGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSAMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AAW88509.1| beta-tubulin [Lolium perenne]
Length=321

 Score =   394 bits (1013),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  59   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  118

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  119  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  178

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  179  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  238

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  239  PELTQQMWDSKNMMCAADPRHGRYLT  264



>ref|XP_008370041.1| PREDICTED: tubulin beta chain [Malus domestica]
 ref|XP_009370237.1| PREDICTED: tubulin beta chain [Pyrus x bretschneideri]
 ref|XP_009370255.1| PREDICTED: tubulin beta chain [Pyrus x bretschneideri]
Length=447

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY75516.1| beta-tubulin, partial [Bambusa emeiensis]
Length=318

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC++GFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  28   TEGAELIDSVLDVVRKEAENCDCLRGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  87

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  88   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  147

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRAL+V
Sbjct  148  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALSV  207

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  208  PELTQQMWDAKNMMCAADPRHGRYLT  233



>ref|XP_007205196.1| hypothetical protein PRUPE_ppa005693mg [Prunus persica]
 ref|XP_008239841.1| PREDICTED: tubulin beta chain-like [Prunus mume]
 gb|EMJ06395.1| hypothetical protein PRUPE_ppa005693mg [Prunus persica]
Length=447

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KDP23866.1| hypothetical protein JCGZ_27135 [Jatropha curcas]
Length=444

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY75515.1| beta-tubulin, partial [Bambusa emeiensis]
Length=318

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDS LDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  28   TEGAELIDSALDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  87

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNA LSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  88   FSVFPSPKVSDTVVEPYNAALSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  147

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  148  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  207

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  208  PELTQQMWDAKNMMCAADPRHGRYLT  233



>pir||JC2511 beta-tubulin R2242 - rice
Length=444

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004981550.1| PREDICTED: tubulin beta-7 chain-like [Setaria italica]
Length=445

 Score =   399 bits (1024),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004293671.1| PREDICTED: tubulin beta chain [Fragaria vesca subsp. vesca]
Length=446

 Score =   399 bits (1024),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR+LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008648960.1| PREDICTED: tubulin beta-7 chain-like [Zea mays]
 gb|AFW76044.1| tubulin beta-7 chain isoform 1 [Zea mays]
 gb|AFW76045.1| tubulin beta-7 chain isoform 2 [Zea mays]
Length=445

 Score =   399 bits (1024),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>gb|AFC88847.1| putative beta-5 tubulin, partial [Tetragonia tetragonioides]
Length=355

 Score =   395 bits (1015),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  82   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  141

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  142  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  201

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  202  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  261

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  262  PELTQQMWDSKNMMCAADPRHGRYLT  287



>ref|XP_011037726.1| PREDICTED: tubulin beta chain [Populus euphratica]
Length=445

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002466356.1| hypothetical protein SORBIDRAFT_01g006310 [Sorghum bicolor]
 gb|EER93354.1| hypothetical protein SORBIDRAFT_01g006310 [Sorghum bicolor]
Length=445

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006377941.1| tubulin beta chain family protein [Populus trichocarpa]
 gb|ERP55738.1| tubulin beta chain family protein [Populus trichocarpa]
Length=445

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q6VAF7.1|TBB5_GOSHI RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Gossypium hirsutum]
 gb|AAQ92665.1| beta-tubulin 5 [Gossypium hirsutum]
Length=445

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|EMT10073.1| Tubulin beta-1 chain [Aegilops tauschii]
Length=374

 Score =   395 bits (1016),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMM+T
Sbjct  35   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMT  94

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  95   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPTFGDLN  154

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQ YRALTV
Sbjct  155  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQMYRALTV  214

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  215  PELTQQMWDSKNMMCAADPRHGRYLT  240



>ref|XP_008804937.1| PREDICTED: tubulin beta-2 chain [Phoenix dactylifera]
Length=446

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010540645.1| PREDICTED: tubulin beta chain [Tarenaya hassleriana]
Length=445

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007036799.1| Beta-6 tubulin [Theobroma cacao]
 gb|EOY21300.1| Beta-6 tubulin [Theobroma cacao]
Length=445

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008442483.1| PREDICTED: tubulin beta chain-like [Cucumis melo]
Length=446

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ADW84691.1| beta-tubulin [Theobroma cacao]
Length=385

 Score =   396 bits (1017),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  42   TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  101

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSV+PSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  102  FSVYPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  161

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  162  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  221

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  222  PELTQQMWDAKNMMCAADPRHGRYLT  247



>gb|KJB29774.1| hypothetical protein B456_005G118100 [Gossypium raimondii]
Length=447

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>dbj|BAA82639.1| Beta-tubulin [Zinnia elegans]
Length=441

 Score =   398 bits (1022),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMM+T
Sbjct  100  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMT  159

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  160  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  219

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  220  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  279

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  280  PELTQQMWDAKNMMCAADPRHGRYLT  305



>ref|XP_003594596.1| Tubulin beta chain [Medicago truncatula]
 gb|AES64847.1| tubulin beta-1 chain [Medicago truncatula]
Length=445

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_008448943.1| PREDICTED: tubulin beta chain-like [Cucumis melo]
Length=446

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004172348.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
Length=446

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ACN39870.1| unknown [Picea sitchensis]
Length=445

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTL+ISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLIISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALT+
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTI  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006421924.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
 gb|ESR35164.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
Length=514

 Score =   400 bits (1029),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  175  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  234

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  235  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  294

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  295  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  354

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  355  PELTQQMWDAKNMMCAADPRHGRYLT  380



>gb|KJB21246.1| hypothetical protein B456_003G126300 [Gossypium raimondii]
Length=388

 Score =   396 bits (1017),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q9ZRB0.1|TBB3_WHEAT RecName: Full=Tubulin beta-3 chain; AltName: Full=Beta-3-tubulin 
[Triticum aestivum]
 gb|AAD10489.1| beta-tubulin 3 [Triticum aestivum]
Length=445

 Score =   398 bits (1022),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_010101838.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB89975.1| Tubulin beta-1 chain [Morus notabilis]
Length=447

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q9ZPP0.1|TBB1_ELEIN RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Eleusine indica]
 gb|AAD20178.1| beta-tubulin 1 [Eleusine indica]
Length=445

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|NP_001289662.1| tubulin beta chain [Eucalyptus grandis]
 gb|ABS50668.1| beta-tubulin [Eucalyptus grandis]
Length=449

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002299541.1| hypothetical protein POPTR_0001s09180g [Populus trichocarpa]
 gb|EEE84346.1| hypothetical protein POPTR_0001s09180g [Populus trichocarpa]
Length=447

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CAM58980.1| beta tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_002299042.1| hypothetical protein POPTR_0001s46870g [Populus trichocarpa]
 gb|EEE83847.1| hypothetical protein POPTR_0001s46870g [Populus trichocarpa]
Length=445

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR+LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003569962.1| PREDICTED: tubulin beta-3 chain [Brachypodium distachyon]
Length=445

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_004147894.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 gb|KGN54346.1| hypothetical protein Csa_4G307390 [Cucumis sativus]
Length=446

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002267380.1| PREDICTED: tubulin beta-1 chain [Vitis vinifera]
Length=449

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q40106.1|TBB2_LUPAL RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Lupinus albus]
 gb|AAB03267.1| beta-tubulin 2 [Lupinus albus]
Length=448

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006339000.1| PREDICTED: tubulin beta-8 chain-like [Solanum tuberosum]
Length=447

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006410627.1| hypothetical protein EUTSA_v10016629mg [Eutrema salsugineum]
 gb|ESQ52080.1| hypothetical protein EUTSA_v10016629mg [Eutrema salsugineum]
Length=445

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRAL+V
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALSV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABR22557.1| beta-tubulin, partial [Mesostigma viride]
Length=313

 Score =   393 bits (1009),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDV RKEAE+CDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMM+T
Sbjct  12   TEGAELIDSVLDVCRKEAESCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMT  71

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  72   FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPTFGDLN  131

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  132  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  191

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  192  PELTQQMWDAKNMMCAADPRHGRYLT  217



>emb|CDP12577.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KCW77253.1| hypothetical protein EUGRSUZ_D01612 [Eucalyptus grandis]
Length=449

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AID52920.1| tubulin beta-2 chain [Carthamus tinctorius]
Length=445

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMM+T
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007026823.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY07325.1| Tubulin beta 8 [Theobroma cacao]
Length=444

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AIA09927.1| beta-tubulin [Quercus suber]
Length=446

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>tpg|DAA51374.1| TPA: hypothetical protein ZEAMMB73_041268 [Zea mays]
Length=445

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENAD+CMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADQCMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008377500.1| PREDICTED: tubulin beta-1 chain [Malus domestica]
Length=447

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AGE44289.1| beta-tubulin [Dimocarpus longan]
Length=446

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006853321.1| hypothetical protein AMTR_s00032p00056500 [Amborella trichopoda]
 gb|ERN14788.1| hypothetical protein AMTR_s00032p00056500 [Amborella trichopoda]
Length=444

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_010926884.1| PREDICTED: tubulin beta chain-like [Elaeis guineensis]
Length=446

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>gb|AGH08232.1| beta-tubulin 3 [Salix arbutifolia]
Length=447

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006350813.1| PREDICTED: tubulin beta-2 chain-like [Solanum tuberosum]
Length=446

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010530505.1| PREDICTED: tubulin beta-8 chain, partial [Tarenaya hassleriana]
Length=442

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002438838.1| hypothetical protein SORBIDRAFT_10g027010 [Sorghum bicolor]
 gb|EER90205.1| hypothetical protein SORBIDRAFT_10g027010 [Sorghum bicolor]
Length=446

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>gb|EYU38358.1| hypothetical protein MIMGU_mgv1a007077mg [Erythranthe guttata]
Length=420

 Score =   397 bits (1019),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CDX80390.1| BnaC07g30540D [Brassica napus]
Length=449

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CDX84283.1| BnaC04g10450D [Brassica napus]
Length=446

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRAL+V
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALSV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009371335.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
 ref|XP_009340030.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
 ref|XP_009342969.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
Length=447

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|P37392.1|TBB1_LUPAL RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Lupinus albus]
 emb|CAA49736.1| Beta tubulin 1 [Lupinus albus]
Length=447

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007218003.1| hypothetical protein PRUPE_ppa005698mg [Prunus persica]
 ref|XP_008234243.1| PREDICTED: tubulin beta-1 chain [Prunus mume]
 ref|XP_008234244.1| PREDICTED: tubulin beta-1 chain [Prunus mume]
 gb|EMJ19202.1| hypothetical protein PRUPE_ppa005698mg [Prunus persica]
Length=447

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010255421.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
 ref|XP_010255422.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
Length=446

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>dbj|BAH82659.1| tubulin beta chain [Lotus japonicus]
Length=446

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_006654403.1| PREDICTED: tubulin beta-1 chain-like [Oryza brachyantha]
Length=445

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010908105.1| PREDICTED: tubulin beta-2 chain-like [Elaeis guineensis]
Length=447

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010035138.1| PREDICTED: tubulin beta-1 chain [Eucalyptus grandis]
 gb|KCW46432.1| hypothetical protein EUGRSUZ_K00264 [Eucalyptus grandis]
Length=447

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004241186.1| PREDICTED: tubulin beta chain-like [Solanum lycopersicum]
Length=446

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KDP46576.1| hypothetical protein JCGZ_08548 [Jatropha curcas]
Length=448

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003556108.1| PREDICTED: tubulin beta-1 chain-like [Glycine max]
 gb|KHN26647.1| Tubulin beta-1 chain [Glycine soja]
Length=448

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AGT02044.1| beta-tubulin [Dimocarpus longan]
Length=446

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CDY31638.1| BnaA05g09090D [Brassica napus]
Length=444

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRAL+V
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALSV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004496560.1| PREDICTED: tubulin beta-1 chain-like [Cicer arietinum]
Length=448

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004966294.1| PREDICTED: tubulin beta-1 chain-like [Setaria italica]
Length=445

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>gb|AGH08242.1| beta-tubulin 8 [Salix arbutifolia]
Length=445

 Score =   397 bits (1021),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>sp|Q9ZPN8.1|TBB3_ELEIN RecName: Full=Tubulin beta-3 chain; AltName: Full=Beta-3-tubulin 
[Eleusine indica]
 gb|AAD20180.1| beta-tubulin 3 [Eleusine indica]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR+LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001105688.1| tubulin beta-7 chain [Zea mays]
 sp|Q41784.1|TBB7_MAIZE RecName: Full=Tubulin beta-7 chain; AltName: Full=Beta-7-tubulin 
[Zea mays]
 gb|AAA19708.1| beta-7 tubulin [Zea mays]
Length=445

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_011076163.1| PREDICTED: tubulin beta-1 chain [Sesamum indicum]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABA41230.1| beta-tubulin, partial [Coleochaete scutata]
Length=398

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAE+CDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  94   TEGAELIDSVLDVVRKEAESCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  153

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  154  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPTFGDLN  213

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  214  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  273

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  274  PELTQQMWDAKNMMCAADPRHGRYLT  299



>ref|XP_010274718.1| PREDICTED: tubulin beta-6 chain-like [Nelumbo nucifera]
Length=449

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004308083.1| PREDICTED: tubulin beta-1 chain [Fragaria vesca subsp. vesca]
Length=447

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004137743.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 ref|XP_004168413.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 gb|KGN58809.1| hypothetical protein Csa_3G732650 [Cucumis sativus]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009150907.1| PREDICTED: tubulin beta-8 chain [Brassica rapa]
Length=449

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008807190.1| PREDICTED: tubulin beta chain-like [Phoenix dactylifera]
Length=445

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>gb|ABY86655.1| beta-tubulin 4 [Gossypium hirsutum]
Length=448

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011022718.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010273068.1| PREDICTED: tubulin beta-1 chain-like [Nelumbo nucifera]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009398811.1| PREDICTED: tubulin beta-2 chain-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006490393.1| PREDICTED: tubulin beta-1 chain-like [Citrus sinensis]
 gb|KDO59996.1| hypothetical protein CISIN_1g013291mg [Citrus sinensis]
Length=446

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009402559.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ PTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CDP05193.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008376592.1| PREDICTED: tubulin beta-1 chain-like [Malus domestica]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010108341.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXC19132.1| Tubulin beta-1 chain [Morus notabilis]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011072460.1| PREDICTED: tubulin beta-8 chain-like [Sesamum indicum]
Length=445

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006394642.1| hypothetical protein EUTSA_v10004208mg [Eutrema salsugineum]
 gb|ESQ31928.1| hypothetical protein EUTSA_v10004208mg [Eutrema salsugineum]
Length=450

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AFN53689.1| putative tubulin beta-1 chain protein [Linum usitatissimum]
 gb|AIS84163.1| beta-tubulin 1a [Linum usitatissimum]
 gb|AIS84164.1| beta-tubulin 1b [Linum usitatissimum]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003536467.1| PREDICTED: tubulin beta-1 chain-like [Glycine max]
 gb|KHN21746.1| Tubulin beta-1 chain [Glycine soja]
Length=448

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011029244.1| PREDICTED: tubulin beta-1 chain-like [Populus euphratica]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AAK96884.1| beta tubulin [Arabidopsis thaliana]
 gb|AAM10035.1| beta tubulin [Arabidopsis thaliana]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002510784.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF51386.1| tubulin beta chain, putative [Ricinus communis]
Length=448

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002271992.1| PREDICTED: tubulin beta-2 chain [Vitis vinifera]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006644071.1| PREDICTED: tubulin beta-1 chain-like [Oryza brachyantha]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010673793.1| PREDICTED: tubulin beta-4 chain [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006404194.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
 gb|ESQ45647.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
Length=451

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_568437.1| tubulin beta-8 chain [Arabidopsis thaliana]
 ref|NP_001190373.1| tubulin beta-8 chain [Arabidopsis thaliana]
 sp|P29516.2|TBB8_ARATH RecName: Full=Tubulin beta-8 chain; AltName: Full=Beta-8-tubulin 
[Arabidopsis thaliana]
 dbj|BAB10059.1| beta tubulin [Arabidopsis thaliana]
 gb|AED93223.1| tubulin beta-8 chain [Arabidopsis thaliana]
 gb|AED93224.1| tubulin beta-8 chain [Arabidopsis thaliana]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001168511.1| hypothetical protein [Zea mays]
 gb|ACN28480.1| unknown [Zea mays]
 gb|AFW84813.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
 gb|AFW84814.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
Length=448

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002307960.1| hypothetical protein POPTR_0006s03390g [Populus trichocarpa]
 ref|XP_006380970.1| Tubulin beta-6 chain family protein [Populus trichocarpa]
 gb|EEE91483.1| hypothetical protein POPTR_0006s03390g [Populus trichocarpa]
 gb|ERP58767.1| Tubulin beta-6 chain family protein [Populus trichocarpa]
Length=448

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009596463.1| PREDICTED: tubulin beta-1 chain [Nicotiana tomentosiformis]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001239638.1| beta-tubulin [Glycine max]
 gb|AAX86048.1| tubulin B4 [Glycine max]
 gb|KHN12167.1| Tubulin beta-5 chain [Glycine soja]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007040195.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY24696.1| Tubulin beta 8 [Theobroma cacao]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009626214.1| PREDICTED: tubulin beta-2 chain-like [Nicotiana tomentosiformis]
Length=447

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KJB36870.1| hypothetical protein B456_006G179900 [Gossypium raimondii]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009380867.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ PTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007038700.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY23201.1| Tubulin beta 8 [Theobroma cacao]
Length=448

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHS+GGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSMGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006827680.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
 gb|ERM95096.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KHN08902.1| Tubulin beta-1 chain [Glycine soja]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007143420.1| hypothetical protein PHAVU_007G070800g [Phaseolus vulgaris]
 gb|ESW15414.1| hypothetical protein PHAVU_007G070800g [Phaseolus vulgaris]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002304488.1| hypothetical protein POPTR_0003s12540g [Populus trichocarpa]
 gb|EEE79467.1| hypothetical protein POPTR_0003s12540g [Populus trichocarpa]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AAW88508.1| beta-tubulin [Lolium perenne]
Length=328

 Score =   393 bits (1009),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAEL DSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  59   TEGAELTDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  118

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  119  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  178

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  179  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  238

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  239  PELTQQMWDSKNMMCAADPRHGRYLT  264



>ref|XP_008654521.1| PREDICTED: uncharacterized protein LOC100272336 isoform X1 [Zea 
mays]
 ref|XP_008654522.1| PREDICTED: uncharacterized protein LOC100272336 isoform X1 [Zea 
mays]
 gb|AFW79501.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
 gb|AFW79502.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
 gb|AFW79503.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
Length=444

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_003554108.1| PREDICTED: tubulin beta-4 chain-like [Glycine max]
Length=450

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002872076.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48335.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ADZ76155.1| beta-tubulin [Vanilla planifolia]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>ref|XP_010088982.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB37197.1| Tubulin beta-1 chain [Morus notabilis]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002270069.1| PREDICTED: tubulin beta-4 chain [Vitis vinifera]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AAL92026.1|AF484959_1 tubulin beta-1 [Gossypium hirsutum]
 gb|AAL92118.1|AF487511_1 beta-tubulin [Gossypium hirsutum]
 gb|KJB25807.1| hypothetical protein B456_004G210600 [Gossypium raimondii]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006481398.1| PREDICTED: tubulin beta-2 chain [Citrus sinensis]
Length=432

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR+LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009767718.1| PREDICTED: tubulin beta-1 chain [Nicotiana sylvestris]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009404699.1| PREDICTED: tubulin beta-1 chain [Musa acuminata subsp. malaccensis]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004967662.1| PREDICTED: tubulin beta-5 chain-like [Setaria italica]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009393282.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLS P+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSNPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KJB34131.1| hypothetical protein B456_006G049000 [Gossypium raimondii]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010243823.1| PREDICTED: tubulin beta-4 chain-like [Nelumbo nucifera]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY86660.1| beta-tubulin 14 [Gossypium hirsutum]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006387232.1| hypothetical protein POPTR_1455s00200g [Populus trichocarpa]
 gb|ERP46146.1| hypothetical protein POPTR_1455s00200g [Populus trichocarpa]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004986075.1| PREDICTED: tubulin beta-2 chain-like [Setaria italica]
 emb|CAE52517.1| beta tubulin [Setaria viridis]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KJB56320.1| hypothetical protein B456_009G115600 [Gossypium raimondii]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010676480.1| PREDICTED: tubulin beta-1 chain [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010923772.1| PREDICTED: tubulin beta chain-like [Elaeis guineensis]
Length=443

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



>emb|CDP09135.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   396 bits (1018),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004249322.1| PREDICTED: tubulin beta-5 chain [Solanum lycopersicum]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002283056.1| PREDICTED: tubulin beta-5 chain [Vitis vinifera]
 emb|CAN64894.1| hypothetical protein VITISV_029111 [Vitis vinifera]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002468688.1| hypothetical protein SORBIDRAFT_01g050310 [Sorghum bicolor]
 ref|XP_008667860.1| PREDICTED: uncharacterized protein LOC100273658 isoform X1 [Zea 
mays]
 gb|EER95686.1| hypothetical protein SORBIDRAFT_01g050310 [Sorghum bicolor]
 tpg|DAA42821.1| TPA: beta tubulin1 isoform 1 [Zea mays]
 tpg|DAA42822.1| TPA: beta tubulin1 isoform 2 [Zea mays]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q41785.1|TBB8_MAIZE RecName: Full=Tubulin beta-8 chain; AltName: Full=Beta-8-tubulin 
[Zea mays]
 gb|AAA19709.1| beta-8 tubulin [Zea mays]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY86665.1| beta-tubulin 19 [Gossypium hirsutum]
 gb|KJB21245.1| hypothetical protein B456_003G126300 [Gossypium raimondii]
Length=444

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010542657.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010271905.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
 ref|XP_010271906.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABK95893.1| unknown [Populus trichocarpa]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CDM85842.1| unnamed protein product [Triticum aestivum]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|P93176.1|TBB_HORVU RecName: Full=Tubulin beta chain; AltName: Full=Beta-tubulin 
[Hordeum vulgare]
 emb|CAA70891.1| beta-tubulin 1 [Hordeum vulgare subsp. vulgare]
 emb|CAM58979.1| beta tubulin 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87463.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92333.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY86662.1| beta-tubulin 16 [Gossypium hirsutum]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_007016239.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY33858.1| Tubulin beta 8 [Theobroma cacao]
Length=444

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>tpg|DAA54230.1| TPA: hypothetical protein ZEAMMB73_283964, partial [Zea mays]
Length=427

 Score =   396 bits (1018),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009588441.1| PREDICTED: tubulin beta-1 chain [Nicotiana tomentosiformis]
 ref|XP_009769578.1| PREDICTED: tubulin beta-1 chain [Nicotiana sylvestris]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011075465.1| PREDICTED: tubulin beta-5 chain isoform X2 [Sesamum indicum]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011036386.1| PREDICTED: tubulin beta-5 chain [Populus euphratica]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010922039.1| PREDICTED: tubulin beta-5 chain [Elaeis guineensis]
 ref|XP_010922040.1| PREDICTED: tubulin beta-5 chain [Elaeis guineensis]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABY86654.1| beta-tubulin 2 [Gossypium hirsutum]
 gb|KJB55793.1| hypothetical protein B456_009G094600 [Gossypium raimondii]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009385041.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=443

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ PTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011040743.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
 ref|XP_011040744.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABK94073.1| unknown [Populus trichocarpa]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KHN26219.1| Tubulin beta-2 chain [Glycine soja]
Length=400

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  58   TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  117

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  118  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  177

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRAL+V
Sbjct  178  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALSV  237

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  238  PELTQQMWDSKNMMCAADPRHGRYLT  263



>ref|XP_002962554.1| hypothetical protein SELMODRAFT_23468, partial [Selaginella moellendorffii]
 gb|EFJ36017.1| hypothetical protein SELMODRAFT_23468, partial [Selaginella moellendorffii]
Length=408

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAE+CDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAESCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011079080.1| PREDICTED: tubulin beta-5 chain-like [Sesamum indicum]
 ref|XP_011079081.1| PREDICTED: tubulin beta-5 chain-like [Sesamum indicum]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006644872.1| PREDICTED: tubulin beta-4 chain-like [Oryza brachyantha]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010673064.1| PREDICTED: tubulin beta-6 chain isoform X2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673065.1| PREDICTED: tubulin beta-6 chain isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006429261.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|ESR42501.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|KDO58028.1| hypothetical protein CISIN_1g013335mg [Citrus sinensis]
Length=445

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR+LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001055546.1| Os05g0413200 [Oryza sativa Japonica Group]
 sp|Q76FS3.1|TBB6_ORYSJ RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAC82429.1| beta-tubulin [Oryza sativa Japonica Group]
 gb|AAT94032.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF17460.1| Os05g0413200 [Oryza sativa Japonica Group]
Length=444

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010520236.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|ABK92780.1| unknown [Populus trichocarpa]
Length=448

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CAM58986.1| beta tubulin 8 [Hordeum vulgare subsp. vulgare]
 dbj|BAK00571.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50212.1| Tubulin beta-2 chain [Triticum urartu]
Length=447

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001105317.1| tubulin beta-6 chain [Zea mays]
 ref|XP_008673429.1| PREDICTED: tubulin beta-6 chain isoform X1 [Zea mays]
 sp|Q41783.1|TBB6_MAIZE RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Zea mays]
 gb|AAA20186.1| beta-6 tubulin [Zea mays]
 gb|ACL53189.1| unknown [Zea mays]
 tpg|DAA57200.1| TPA: beta tubulin6 isoform 1 [Zea mays]
 tpg|DAA57201.1| TPA: beta tubulin6 isoform 2 [Zea mays]
Length=446

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|KDP25455.1| hypothetical protein JCGZ_20611 [Jatropha curcas]
Length=447

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006339255.1| PREDICTED: tubulin beta-1 chain-like [Solanum tuberosum]
Length=447

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q9ZRB1.1|TBB2_WHEAT RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Triticum aestivum]
 gb|AAD10488.1| beta-tubulin 2 [Triticum aestivum]
Length=447

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>pir||JC2510 beta-tubulin R1623 - rice
Length=446

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001105458.1| tubulin beta-5 chain [Zea mays]
 ref|XP_008673433.1| PREDICTED: tubulin beta-5 chain isoform X1 [Zea mays]
 sp|Q43697.1|TBB5_MAIZE RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Zea mays]
 emb|CAA52720.1| beta-5 tubulin [Zea mays]
 tpg|DAA54227.1| TPA: tubulin beta-8 chain isoform 1 [Zea mays]
 tpg|DAA54228.1| TPA: tubulin beta-8 chain isoform 2 [Zea mays]
 tpg|DAA54229.1| TPA: tubulin beta-8 chain isoform 3 [Zea mays]
Length=445

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|NP_001044565.1| Os01g0805900 [Oryza sativa Japonica Group]
 sp|P45960.1|TBB4_ORYSJ RecName: Full=Tubulin beta-4 chain; AltName: Full=Beta-4-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAA06381.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAB92274.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF06479.1| Os01g0805900 [Oryza sativa Japonica Group]
 dbj|BAG93002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008790003.1| PREDICTED: tubulin beta-1 chain-like [Phoenix dactylifera]
Length=446

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q9ZPN7.1|TBB4_ELEIN RecName: Full=Tubulin beta-4 chain; AltName: Full=Beta-4-tubulin 
[Eleusine indica]
 gb|AAD20181.1| beta-tubulin 4 [Eleusine indica]
Length=446

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009412045.1| PREDICTED: tubulin beta chain-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLS P+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSNPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006410012.1| hypothetical protein EUTSA_v10016651mg [Eutrema salsugineum]
 gb|ESQ51465.1| hypothetical protein EUTSA_v10016651mg [Eutrema salsugineum]
Length=449

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_002456503.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
 gb|EES01623.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_004982240.1| PREDICTED: tubulin beta-3 chain-like [Setaria italica]
Length=446

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+ P+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTNPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AIS84169.1| beta-tubulin 4a [Linum usitatissimum]
 gb|AIS84170.1| beta-tubulin 4b [Linum usitatissimum]
Length=442

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYR LTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010087906.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB30492.1| Tubulin beta-1 chain [Morus notabilis]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISK+REEYPDRMM+T
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKVREEYPDRMMMT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_009395425.1| PREDICTED: tubulin beta-2 chain-like [Musa acuminata subsp. malaccensis]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|AFW79504.1| hypothetical protein ZEAMMB73_908177, partial [Zea mays]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>gb|EMT08428.1| Tubulin beta-1 chain [Aegilops tauschii]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>sp|Q9ZPN9.1|TBB2_ELEIN RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Eleusine indica]
 gb|AAD20179.1| beta-tubulin 2 [Eleusine indica]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010905373.1| PREDICTED: tubulin beta-8 chain-like [Elaeis guineensis]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMM+T
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008798348.1| PREDICTED: tubulin beta-1 chain [Phoenix dactylifera]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_010909062.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909063.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909064.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>emb|CAE52516.1| beta tubulin [Setaria viridis]
Length=448

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_011075464.1| PREDICTED: tubulin beta-5 chain isoform X1 [Sesamum indicum]
Length=456

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  116  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  175

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  176  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  235

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  236  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  295

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  296  PELTQQMWDAKNMMCAADPRHGRYLT  321



>ref|NP_001042761.1| Os01g0282800 [Oryza sativa Japonica Group]
 sp|Q43594.2|TBB1_ORYSJ RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAB39951.1| putative tubulin beta-4 chain [Oryza sativa Japonica Group]
 dbj|BAB64211.1| putative beta-tubulin 4 [Oryza sativa Japonica Group]
 dbj|BAF04675.1| Os01g0282800 [Oryza sativa Japonica Group]
 gb|EAY73543.1| hypothetical protein OsI_01426 [Oryza sativa Indica Group]
 dbj|BAH00806.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_006649228.1| PREDICTED: tubulin beta-2 chain-like [Oryza brachyantha]
Length=447

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELIDSVLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TP+FGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWDAKNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDAKNMMCAADPRHGRYLT  312



>ref|XP_008787350.1| PREDICTED: tubulin beta chain-like [Phoenix dactylifera]
Length=445

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    TEGAELIDSVLDVVRKEAENCDCIQGFQVCHslgggtgsgmgtllISKIREEYPDRMMLT  180
            TEGAELID+VLDVVRKEAENCDC+QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT
Sbjct  107  TEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLT  166

Query  181  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPTFGDLN  360
            FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKL+TPTFGDLN
Sbjct  167  FSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLN  226

Query  361  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  540
            HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV
Sbjct  227  HLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTV  286

Query  541  PELTQQMWDAKNMMCAADPRHGRYLT  618
            PELTQQMWD+KNMMCAADPRHGRYLT
Sbjct  287  PELTQQMWDSKNMMCAADPRHGRYLT  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520