BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004G05 645 bp,

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795683.1|  PREDICTED: ammonium transporter 1 member 2         332   5e-108   Nicotiana sylvestris
ref|XP_006340472.1|  PREDICTED: ammonium transporter 1 member 2-like    331   7e-108   Solanum tuberosum [potatoes]
ref|NP_001234253.1|  ammonium transporter 1 member 2                    329   3e-107   
emb|CDP04266.1|  unnamed protein product                                328   8e-107   Coffea canephora [robusta coffee]
ref|XP_007030324.1|  Ammonium transporter 1,2                           325   1e-105   Theobroma cacao [chocolate]
ref|XP_011102181.1|  PREDICTED: ammonium transporter 1 member 2-like    318   1e-104   Sesamum indicum [beniseed]
gb|EYU39527.1|  hypothetical protein MIMGU_mgv1a004766mg                323   1e-104   Erythranthe guttata [common monkey flower]
ref|XP_010042334.1|  PREDICTED: putative ammonium transporter 1 m...    319   2e-104   Eucalyptus grandis [rose gum]
ref|XP_008350942.1|  PREDICTED: ammonium transporter 1 member 2-like    322   2e-104   Malus domestica [apple tree]
gb|AEZ06604.1|  AMT1;2                                                  321   3e-104   Pyrus pyrifolia [sha li]
gb|AEZ06602.1|  AMT1;2                                                  320   9e-104   Pyrus calleryana [Bradford pear]
gb|AEZ06601.1|  AMT1;2                                                  320   9e-104   Pyrus betulifolia
gb|KJB44784.1|  hypothetical protein B456_007G273100                    320   9e-104   Gossypium raimondii
gb|AEZ06605.1|  AMT1;2                                                  320   9e-104   Pyrus ussuriensis [Harbin pear]
gb|AFO66661.1|  AMT1;2                                                  320   2e-103   Citrus trifoliata [hardy orange]
gb|AEZ06603.1|  AMT1;2                                                  318   5e-103   Pyrus x bretschneideri [bai li]
gb|AEY75247.1|  ammonium transporter                                    318   6e-103   Malus hupehensis
gb|KDO52481.1|  hypothetical protein CISIN_1g043627mg                   318   6e-103   Citrus sinensis [Valencia orange]
ref|XP_006443272.1|  hypothetical protein CICLE_v10019808mg             318   1e-102   Citrus clementina
ref|XP_002325790.2|  ammonium transporter 2 family protein              317   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010043315.1|  PREDICTED: ammonium transporter 1 member 1-like    317   1e-102   Eucalyptus grandis [rose gum]
gb|AEZ06606.1|  AMT1;2                                                  316   4e-102   Pyrus communis
emb|CAG26715.1|  ammonium transporter                                   316   5e-102   Populus tremula x Populus tremuloides
ref|XP_011077134.1|  PREDICTED: uncharacterized protein LOC105161213    327   6e-102   Sesamum indicum [beniseed]
gb|EYU39526.1|  hypothetical protein MIMGU_mgv1a004778mg                315   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_008801272.1|  PREDICTED: ammonium transporter 1 member 2-like    313   4e-101   Phoenix dactylifera
ref|XP_007030323.1|  Ammonium transporter 1,2                           315   4e-101   Theobroma cacao [chocolate]
ref|XP_011466031.1|  PREDICTED: ammonium transporter 1 member 2         321   5e-101   Fragaria vesca subsp. vesca
ref|XP_006420410.1|  hypothetical protein CICLE_v10004812mg             312   8e-101   Citrus clementina
ref|NP_176658.1|  ammonium transporter 1;2                              312   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AFO66660.1|  AMT1;1                                                  310   7e-100   Citrus trifoliata [hardy orange]
gb|AGG68788.1|  putative ammonium transporter                           299   1e-99    Populus alba x Populus glandulosa
ref|XP_008224012.1|  PREDICTED: ammonium transporter 1 member 1-like    309   2e-99    Prunus mume [ume]
dbj|BAD29977.1|  putative ammonium transporter                          308   6e-99    Camellia sinensis [black tea]
ref|XP_009411384.1|  PREDICTED: ammonium transporter 1 member 1-like    308   6e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009601082.1|  PREDICTED: ammonium transporter 1 member 1         307   7e-99    Nicotiana tomentosiformis
ref|XP_009382197.1|  PREDICTED: ammonium transporter 1 member 2-like    308   8e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011102198.1|  PREDICTED: ammonium transporter 1 member 2-like    308   9e-99    Sesamum indicum [beniseed]
ref|XP_009784484.1|  PREDICTED: ammonium transporter 1 member 1         307   9e-99    Nicotiana sylvestris
gb|AEY75246.1|  ammonium transporter                                    307   1e-98    Malus hupehensis
ref|XP_009384059.1|  PREDICTED: ammonium transporter 1 member 1-like    307   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223306.1|  hypothetical protein PRUPE_ppa004542mg             307   1e-98    Prunus persica
gb|AFH74974.1|  ammonium transporter AMT1;1                             307   1e-98    Pyrus calleryana [Bradford pear]
ref|XP_006478972.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    315   1e-98    Citrus sinensis [Valencia orange]
gb|AHJ60273.1|  ammonium transporter AMT1;1                             306   2e-98    Pyrus betulifolia
ref|XP_009602795.1|  PREDICTED: ammonium transporter 1 member 2         306   2e-98    Nicotiana tomentosiformis
ref|XP_010264809.1|  PREDICTED: ammonium transporter 1 member 1-like    306   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_009341599.1|  PREDICTED: ammonium transporter 1 member 1-like    306   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_008391280.1|  PREDICTED: ammonium transporter 1 member 1         306   4e-98    Malus domestica [apple tree]
ref|XP_008367234.1|  PREDICTED: ammonium transporter 1 member 1-like    306   4e-98    Malus domestica [apple tree]
emb|CDO99362.1|  unnamed protein product                                305   4e-98    Coffea canephora [robusta coffee]
emb|CDY18058.1|  BnaA01g23190D                                          300   6e-98    Brassica napus [oilseed rape]
emb|CAC10555.1|  ammonium transporter (AMT1.1)                          305   6e-98    Lotus japonicus
gb|AAG24944.1|  putative ammonium transporter AMT1;1                    305   8e-98    Lotus japonicus
ref|XP_011462429.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    305   8e-98    Fragaria vesca subsp. vesca
gb|ABI52423.2|  ammonium transporter                                    305   8e-98    Citrus sinensis x Citrus trifoliata [Carrizo citrange]
gb|AGG68787.1|  putative high affinity ammonium transporter             294   1e-97    Populus simonii x (Populus nigra x Salix matsudana)
ref|XP_010550782.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    305   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_011029719.1|  PREDICTED: ammonium transporter 1 member 1-like    304   2e-97    Populus euphratica
ref|XP_002311703.1|  ammonium transporter family protein                304   2e-97    Populus trichocarpa [western balsam poplar]
gb|AHA42545.1|  ammonium transporter 1.1                                303   4e-97    Populus nigra x Populus x canadensis
ref|XP_011041472.1|  PREDICTED: ammonium transporter 1 member 1         303   5e-97    Populus euphratica
ref|XP_004147178.1|  PREDICTED: ammonium transporter 1 member 1-like    303   6e-97    Cucumis sativus [cucumbers]
ref|XP_002522012.1|  ammonium transporter, putative                     302   1e-96    
ref|XP_003536150.1|  PREDICTED: ammonium transporter 1 member 2-like    302   1e-96    Glycine max [soybeans]
gb|KDO65757.1|  hypothetical protein CISIN_1g040022mg                   301   1e-96    Citrus sinensis [Valencia orange]
ref|XP_006443698.1|  hypothetical protein CICLE_v10023800mg             301   2e-96    Citrus clementina
ref|XP_010103468.1|  Ammonium transporter 1 member 1                    301   2e-96    Morus notabilis
ref|XP_010102194.1|  Ammonium transporter 1 member 2                    302   2e-96    Morus notabilis
ref|XP_002314518.2|  ammonium transporter family protein                301   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010920277.1|  PREDICTED: ammonium transporter 1 member 2-like    301   2e-96    Elaeis guineensis
ref|XP_010527181.1|  PREDICTED: ammonium transporter 1 member 1-like    301   2e-96    Tarenaya hassleriana [spider flower]
ref|XP_011015290.1|  PREDICTED: ammonium transporter 1 member 1-like    301   2e-96    Populus euphratica
ref|XP_010674578.1|  PREDICTED: uncharacterized protein LOC104890698    312   4e-96    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007143995.1|  hypothetical protein PHAVU_007G120200g             300   5e-96    Phaseolus vulgaris [French bean]
ref|XP_008785143.1|  PREDICTED: ammonium transporter 1 member 2-like    300   6e-96    Phoenix dactylifera
gb|AFO66662.1|  AMT1;3                                                  300   6e-96    Citrus trifoliata [hardy orange]
ref|XP_011091369.1|  PREDICTED: ammonium transporter 1 member 1-like    300   6e-96    Sesamum indicum [beniseed]
sp|P58905.1|AMT11_SOLLC  RecName: Full=Ammonium transporter 1 mem...    300   7e-96    Solanum lycopersicum
ref|XP_004247774.1|  PREDICTED: ammonium transporter 1 member 1         299   1e-95    
ref|XP_006851356.1|  hypothetical protein AMTR_s00050p00217870          292   1e-95    
emb|CAN76352.1|  hypothetical protein VITISV_044207                     299   1e-95    Vitis vinifera
ref|XP_002885634.1|  hypothetical protein ARALYDRAFT_899005             299   1e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_003590177.1|  Ammonium transporter 1 member                      299   1e-95    Medicago truncatula
ref|XP_003536149.1|  PREDICTED: ammonium transporter 1 member 2-like    299   1e-95    
ref|XP_006340957.1|  PREDICTED: ammonium transporter 1 member 1-like    298   2e-95    Solanum tuberosum [potatoes]
ref|XP_002518202.1|  ammonium transporter, putative                     299   2e-95    Ricinus communis
ref|XP_002285558.1|  PREDICTED: ammonium transporter 1 member 1         299   2e-95    Vitis vinifera
ref|XP_008460720.1|  PREDICTED: ammonium transporter 1 member 1-like    299   2e-95    Cucumis melo [Oriental melon]
ref|XP_011038587.1|  PREDICTED: uncharacterized protein LOC105135422    312   2e-95    Populus euphratica
ref|XP_002875166.1|  AMT1_1                                             298   2e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_010263964.1|  PREDICTED: ammonium transporter 1 member 1-like    298   3e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010466830.1|  PREDICTED: ammonium transporter 1 member 3         298   3e-95    Camelina sativa [gold-of-pleasure]
gb|EYU32608.1|  hypothetical protein MIMGU_mgv1a024059mg                298   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_010488522.1|  PREDICTED: ammonium transporter 1 member 3-l...    298   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009106012.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    298   4e-95    Brassica rapa
emb|CDY67718.1|  BnaUnng02430D                                          298   4e-95    Brassica napus [oilseed rape]
ref|XP_006589215.1|  PREDICTED: ammonium transporter 1 member 2-like    298   5e-95    Glycine max [soybeans]
ref|XP_009389982.1|  PREDICTED: ammonium transporter 1 member 2         298   5e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010488526.1|  PREDICTED: ammonium transporter 1 member 3-l...    297   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010023793.1|  PREDICTED: ammonium transporter 1 member 1-like    296   1e-94    Eucalyptus grandis [rose gum]
gb|AGK25010.1|  ammonium transporter                                    296   2e-94    Sorghum bicolor [broomcorn]
ref|XP_006296802.1|  hypothetical protein CARUB_v10016472mg             296   2e-94    Capsella rubella
ref|XP_004497799.1|  PREDICTED: ammonium transporter 1 member 1-like    296   2e-94    Cicer arietinum [garbanzo]
ref|XP_002885635.1|  ATAMT1_3                                           296   2e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_008441800.1|  PREDICTED: ammonium transporter 1 member 2-like    296   4e-94    Cucumis melo [Oriental melon]
ref|XP_006414895.1|  hypothetical protein EUTSA_v10024967mg             295   4e-94    Eutrema salsugineum
ref|XP_002446777.1|  hypothetical protein SORBIDRAFT_06g022230          296   5e-94    Sorghum bicolor [broomcorn]
ref|XP_010440571.1|  PREDICTED: ammonium transporter 1 member 1         295   8e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010435254.1|  PREDICTED: ammonium transporter 1 member 1-like    295   8e-94    Camelina sativa [gold-of-pleasure]
ref|NP_001140828.1|  uncharacterized protein LOC100272903               294   8e-94    Zea mays [maize]
emb|CAH67993.1|  OSIGBa0157K09-H0214G12.4                               294   9e-94    Oryza sativa Indica Group [Indian rice]
gb|EYU43783.1|  hypothetical protein MIMGU_mgv1a026927mg                294   9e-94    Erythranthe guttata [common monkey flower]
ref|NP_189073.1|  ammonium transporter 1;3                              294   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|KJB28554.1|  hypothetical protein B456_005G055200                    294   1e-93    Gossypium raimondii
ref|NP_001053280.1|  Os04g0509600                                       294   1e-93    
gb|AAU84432.1|  ammonium transporter                                    295   2e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AAD54638.1|AF083035_1  ammonium transporter                          294   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193087.1|  ammonium transporter 1;1                              293   2e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AAL05612.1|AF289477_1  ammonium transporter 1-1                      294   2e-93    Oryza sativa [red rice]
ref|XP_010450199.1|  PREDICTED: ammonium transporter 1 member 1-like    293   4e-93    Camelina sativa [gold-of-pleasure]
gb|AAD54639.1|AF083036_1  ammonium transporter                          293   4e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDY52657.1|  BnaA05g35560D                                          293   4e-93    Brassica napus [oilseed rape]
gb|KJB72483.1|  hypothetical protein B456_011G180700                    292   5e-93    Gossypium raimondii
ref|XP_007035320.1|  Ammonium transporter 1,5                           295   5e-93    Theobroma cacao [chocolate]
ref|XP_002870394.1|  AMT1_1                                             292   5e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_002868352.1|  AMT1_1                                             292   5e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_009124614.1|  PREDICTED: ammonium transporter 1 member 1         292   7e-93    Brassica rapa
ref|XP_004290002.1|  PREDICTED: ammonium transporter 1 member 4-like    291   8e-93    Fragaria vesca subsp. vesca
ref|XP_008342559.1|  PREDICTED: ammonium transporter 1 member 1-like    293   9e-93    Malus domestica [apple tree]
gb|AAD16012.1|  ammonium transporter                                    286   1e-92    Nepenthes alata
gb|EYU39773.1|  hypothetical protein MIMGU_mgv1a004701mg                292   1e-92    Erythranthe guttata [common monkey flower]
ref|XP_006285083.1|  hypothetical protein CARUB_v10006416mg             291   2e-92    Capsella rubella
ref|XP_006418768.1|  hypothetical protein EUTSA_v10002494mg             291   2e-92    Eutrema salsugineum
ref|XP_011073733.1|  PREDICTED: ammonium transporter 1 member 1-like    290   3e-92    Sesamum indicum [beniseed]
ref|XP_006296773.1|  hypothetical protein CARUB_v10015818mg             290   3e-92    Capsella rubella
emb|CDY06463.1|  BnaC06g11810D                                          290   3e-92    Brassica napus [oilseed rape]
ref|NP_189072.1|  ammonium transporter 1;5                              290   4e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAG28780.1|AF306518_1  high-affinity ammonium transporter AMT1;2     290   7e-92    Brassica napus [oilseed rape]
ref|XP_004976182.1|  PREDICTED: ammonium transporter 1 member 1-like    289   1e-91    Setaria italica
ref|XP_011024510.1|  PREDICTED: ammonium transporter 1 member 4-like    288   1e-91    Populus euphratica
gb|ADJ68003.1|  AMT1;1 ammonium/proton co-transporter                   289   1e-91    Phaseolus vulgaris [French bean]
gb|KFK36236.1|  hypothetical protein AALP_AA4G095900                    288   2e-91    Arabis alpina [alpine rockcress]
gb|KDP26448.1|  hypothetical protein JCGZ_17606                         287   2e-91    Jatropha curcas
gb|KJB42399.1|  hypothetical protein B456_007G150700                    288   2e-91    Gossypium raimondii
emb|CDY18755.1|  BnaC08g08610D                                          288   2e-91    Brassica napus [oilseed rape]
ref|XP_007145350.1|  hypothetical protein PHAVU_007G231700g             288   2e-91    Phaseolus vulgaris [French bean]
ref|XP_002301837.1|  ammonium transporter 3 family protein              287   4e-91    Populus trichocarpa [western balsam poplar]
ref|XP_007050113.1|  Ammonium transporter 1 member 4                    288   4e-91    Theobroma cacao [chocolate]
gb|KFK39729.1|  hypothetical protein AALP_AA3G280600                    287   4e-91    Arabis alpina [alpine rockcress]
ref|XP_008441797.1|  PREDICTED: ammonium transporter 1 member 2         288   5e-91    Cucumis melo [Oriental melon]
ref|XP_004152863.1|  PREDICTED: ammonium transporter 1 member 2-like    287   8e-91    Cucumis sativus [cucumbers]
emb|CDY07159.1|  BnaCnng01740D                                          287   9e-91    Brassica napus [oilseed rape]
ref|NP_001130456.1|  hypothetical protein                               286   1e-90    Zea mays [maize]
ref|XP_002452468.1|  hypothetical protein SORBIDRAFT_04g026290          286   1e-90    Sorghum bicolor [broomcorn]
ref|XP_006302147.1|  hypothetical protein CARUB_v10020151mg             286   2e-90    Capsella rubella
ref|XP_004155139.1|  PREDICTED: ammonium transporter 1 member 2-like    286   2e-90    
gb|KDP23742.1|  hypothetical protein JCGZ_23575                         286   2e-90    Jatropha curcas
ref|XP_002266663.2|  PREDICTED: uncharacterized protein LOC100263947    297   2e-90    Vitis vinifera
ref|XP_006652500.1|  PREDICTED: ammonium transporter 1 member 1-like    285   4e-90    Oryza brachyantha
ref|XP_009111404.1|  PREDICTED: ammonium transporter 1 member 2         285   5e-90    Brassica rapa
gb|AAS19466.2|  ammonium transporter Amt1;1                             285   5e-90    Triticum aestivum [Canadian hard winter wheat]
emb|CDY48491.1|  BnaA09g00320D                                          285   5e-90    Brassica napus [oilseed rape]
emb|CDX92889.1|  BnaC07g41470D                                          285   8e-90    Brassica napus [oilseed rape]
ref|XP_010273183.1|  PREDICTED: ammonium transporter 1 member 1-like    278   9e-90    Nelumbo nucifera [Indian lotus]
ref|XP_004953126.1|  PREDICTED: ammonium transporter 1 member 2-like    284   1e-89    Setaria italica
ref|XP_009137804.1|  PREDICTED: ammonium transporter 1 member 4-like    284   1e-89    Brassica rapa
gb|AFO70200.1|  putative ammonium transporter AMT1;1                    282   1e-89    Alternanthera philoxeroides
gb|KDP33351.1|  hypothetical protein JCGZ_12900                         283   2e-89    Jatropha curcas
gb|KCW61472.1|  hypothetical protein EUGRSUZ_H04208                     283   3e-89    Eucalyptus grandis [rose gum]
ref|XP_010470323.1|  PREDICTED: ammonium transporter 1 member 2-like    283   3e-89    Camelina sativa [gold-of-pleasure]
gb|AFU34589.1|  ammonium transporter 1;1                                283   4e-89    Alternanthera philoxeroides
gb|AFF18616.1|  ammonium transporter                                    282   4e-89    Puccinellia tenuiflora
ref|XP_002888286.1|  ATAMT1_2                                           283   4e-89    Arabidopsis lyrata subsp. lyrata
gb|EAZ23846.1|  hypothetical protein OsJ_07562                          282   5e-89    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047456.1|  Os02g0620600                                       282   6e-89    
ref|XP_007162624.1|  hypothetical protein PHAVU_001G166900g             281   6e-89    Phaseolus vulgaris [French bean]
gb|AAL05614.1|AF289479_1  ammonium transporter 1-3                      281   7e-89    Oryza sativa [red rice]
ref|XP_003555734.1|  PREDICTED: ammonium transporter 1 member 1-l...    281   1e-88    Glycine max [soybeans]
ref|XP_010511124.1|  PREDICTED: ammonium transporter 1 member 2         281   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010674250.1|  PREDICTED: ammonium transporter 1 member 2-like    281   1e-88    Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CAE01484.1|  high affinity ammonium transporter                     281   2e-88    Lotus japonicus
ref|XP_002516694.1|  ammonium transporter, putative                     280   2e-88    Ricinus communis
gb|KDO55751.1|  hypothetical protein CISIN_1g044248mg                   280   2e-88    Citrus sinensis [Valencia orange]
ref|XP_006648843.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    280   3e-88    
ref|XP_003580115.1|  PREDICTED: ammonium transporter 1 member 1         279   7e-88    Brachypodium distachyon [annual false brome]
emb|CDY35209.1|  BnaA01g08220D                                          279   1e-87    Brassica napus [oilseed rape]
ref|XP_009129394.1|  PREDICTED: ammonium transporter 1 member 4         279   1e-87    Brassica rapa
dbj|BAJ23885.1|  putative ammonium transporter                          273   1e-87    Camellia sinensis [black tea]
emb|CDY38368.1|  BnaC01g09770D                                          278   2e-87    Brassica napus [oilseed rape]
ref|XP_001758599.1|  predicted protein                                  278   2e-87    Physcomitrella patens
ref|XP_010024929.1|  PREDICTED: ammonium transporter 1 member 2         286   2e-87    Eucalyptus grandis [rose gum]
ref|XP_003572721.1|  PREDICTED: ammonium transporter 1 member 2         278   2e-87    Brachypodium distachyon [annual false brome]
ref|XP_009135885.1|  PREDICTED: LOW QUALITY PROTEIN: putative amm...    277   4e-87    Brassica rapa
ref|XP_007207384.1|  hypothetical protein PRUPE_ppa004450mg             277   6e-87    Prunus persica
gb|AHI94951.1|  ammonium transporter 1.1                                277   1e-86    Pinus pinaster [cluster pine]
ref|XP_008447358.1|  PREDICTED: ammonium transporter 1 member 2         275   1e-86    Cucumis melo [Oriental melon]
ref|XP_004493882.1|  PREDICTED: ammonium transporter 1 member 4-like    275   2e-86    Cicer arietinum [garbanzo]
ref|XP_010934227.1|  PREDICTED: ammonium transporter 1 member 2-like    276   2e-86    Elaeis guineensis
ref|XP_010693997.1|  PREDICTED: ammonium transporter 1 member 1-like    275   2e-86    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_001785500.1|  predicted protein                                  275   3e-86    Physcomitrella patens
gb|KFK39731.1|  hypothetical protein AALP_AA3G280700                    274   4e-86    Arabis alpina [alpine rockcress]
dbj|BAD36826.1|  putative ammonium transporter                          274   5e-86    Camellia sinensis [black tea]
ref|XP_004134393.1|  PREDICTED: ammonium transporter 1 member 1-like    273   2e-85    Cucumis sativus [cucumbers]
gb|AAM95453.1|  Ammonium transporter                                    273   2e-85    Lotus japonicus
ref|XP_001786055.1|  predicted protein                                  272   2e-85    Physcomitrella patens
ref|XP_010422098.1|  PREDICTED: putative ammonium transporter 1 m...    270   3e-85    Camelina sativa [gold-of-pleasure]
gb|KGN58313.1|  hypothetical protein Csa_3G611380                       271   3e-85    Cucumis sativus [cucumbers]
ref|XP_001758603.1|  predicted protein                                  272   3e-85    Physcomitrella patens
gb|AHI94953.1|  ammonium transporter 1.3                                272   4e-85    Pinus pinaster [cluster pine]
gb|KGN61309.1|  hypothetical protein Csa_2G079120                       272   5e-85    Cucumis sativus [cucumbers]
ref|XP_004165457.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    272   5e-85    
ref|XP_010513375.1|  PREDICTED: ammonium transporter 1 member 3-like    271   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_004152067.1|  PREDICTED: ammonium transporter 1 member 2-like    273   6e-85    
ref|XP_004173150.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    271   7e-85    
ref|XP_010490105.1|  PREDICTED: putative ammonium transporter 1 m...    266   8e-85    Camelina sativa [gold-of-pleasure]
ref|XP_008438437.1|  PREDICTED: ammonium transporter 1 member 1-like    271   9e-85    Cucumis melo [Oriental melon]
ref|XP_010466828.1|  PREDICTED: putative ammonium transporter 1 m...    271   1e-84    Camelina sativa [gold-of-pleasure]
gb|AES61174.2|  ammonium transporter 1 protein                          271   2e-84    Medicago truncatula
ref|XP_006418766.1|  hypothetical protein EUTSA_v10002502mg             270   2e-84    Eutrema salsugineum
ref|XP_002303104.1|  hypothetical protein POPTR_0002s25640g             270   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_010038760.1|  PREDICTED: ammonium transporter 1 member 4-like    268   1e-83    Eucalyptus grandis [rose gum]
ref|XP_001758600.1|  predicted protein                                  267   3e-83    Physcomitrella patens
ref|XP_009102522.1|  PREDICTED: ammonium transporter 1 member 3         267   3e-83    Brassica rapa
ref|XP_006647528.1|  PREDICTED: ammonium transporter 1 member 3-like    267   4e-83    Oryza brachyantha
ref|XP_003590924.1|  Ammonium transporter                               274   6e-83    
ref|NP_001047455.1|  Os02g0620500                                       266   9e-83    
emb|CDX77438.1|  BnaA07g05760D                                          266   1e-82    Brassica napus [oilseed rape]
ref|XP_004496013.1|  PREDICTED: uncharacterized protein LOC101510142    275   3e-82    
ref|XP_003590923.1|  Ammonium transporter                               275   3e-82    
dbj|BAJ84840.1|  predicted protein                                      264   4e-82    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010527145.1|  PREDICTED: ammonium transporter 1 member 4         262   2e-81    Tarenaya hassleriana [spider flower]
ref|XP_002960883.1|  hypothetical protein SELMODRAFT_163770             263   2e-81    Selaginella moellendorffii
gb|KFK29411.1|  hypothetical protein AALP_AA7G130900                    260   1e-80    Arabis alpina [alpine rockcress]
ref|XP_007016118.1|  Ammonium transporter 1 member 2                    258   3e-80    Theobroma cacao [chocolate]
ref|XP_010033013.1|  PREDICTED: ammonium transporter 1 member 3         258   3e-80    Eucalyptus grandis [rose gum]
ref|XP_006412923.1|  hypothetical protein EUTSA_v10024961mg             259   5e-80    Eutrema salsugineum
ref|NP_001141280.1|  hypothetical protein                               258   8e-80    Zea mays [maize]
gb|AHI94952.1|  ammonium transporter 1.2                                258   9e-80    Pinus pinaster [cluster pine]
ref|XP_001758611.1|  predicted protein                                  258   9e-80    Physcomitrella patens
gb|KJB72485.1|  hypothetical protein B456_011G180800                    257   1e-79    Gossypium raimondii
gb|AAR27052.1|  ammonium transporter                                    258   1e-79    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003625418.1|  Ammonium transporter 1 member                      257   2e-79    Medicago truncatula
gb|AAB58937.1|  putative ammonium transporter OsAMT1p                   258   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008218365.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    263   5e-79    Prunus mume [ume]
dbj|BAJ23884.1|  putative ammonium transporter                          250   7e-79    Camellia sinensis [black tea]
ref|XP_003535981.1|  PREDICTED: ammonium transporter 1 member 1         255   1e-78    
ref|XP_006285981.1|  hypothetical protein CARUB_v10007502mg             255   1e-78    Capsella rubella
ref|XP_002869483.1|  hypothetical protein ARALYDRAFT_913645             254   3e-78    Arabidopsis lyrata subsp. lyrata
ref|XP_010438407.1|  PREDICTED: ammonium transporter 1 member 4 i...    252   4e-78    Camelina sativa [gold-of-pleasure]
gb|KJB08438.1|  hypothetical protein B456_001G081600                    251   6e-78    Gossypium raimondii
ref|XP_003626273.1|  Ammonium transporter 1 member                      253   7e-78    Medicago truncatula
ref|XP_011460944.1|  PREDICTED: ammonium transporter 1 member 3-like    252   7e-78    Fragaria vesca subsp. vesca
ref|XP_010438404.1|  PREDICTED: ammonium transporter 1 member 4         253   1e-77    Camelina sativa [gold-of-pleasure]
ref|NP_194599.1|  ammonium transporter 1;4                              252   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AFB73922.1|  AMT1;5                                                  251   2e-77    Malus hupehensis var. mengshanensis
gb|KJB08437.1|  hypothetical protein B456_001G081600                    251   2e-77    Gossypium raimondii
ref|XP_010424340.1|  PREDICTED: ammonium transporter 1 member 2-like    246   3e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010496836.1|  PREDICTED: ammonium transporter 1 member 2-like    251   4e-77    Camelina sativa [gold-of-pleasure]
emb|CDP03809.1|  unnamed protein product                                251   4e-77    Coffea canephora [robusta coffee]
gb|EPS66627.1|  hypothetical protein M569_08147                         251   5e-77    Genlisea aurea
gb|AFB73921.1|  AMT1;4                                                  251   5e-77    Malus hupehensis
ref|XP_006375864.1|  hypothetical protein POPTR_0013s04710g             248   7e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010467180.1|  PREDICTED: ammonium transporter 1 member 2-like    249   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_008372406.1|  PREDICTED: ammonium transporter 1 member 4-like    248   6e-76    Malus domestica [apple tree]
ref|XP_008218579.1|  PREDICTED: ammonium transporter 1 member 4-like    248   1e-75    Prunus mume [ume]
ref|XP_008355164.1|  PREDICTED: ammonium transporter 1 member 3-like    246   1e-75    Malus domestica [apple tree]
ref|XP_009374250.1|  PREDICTED: ammonium transporter 1 member 3-like    246   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_010684790.1|  PREDICTED: ammonium transporter 1 member 4-like    247   2e-75    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007227340.1|  hypothetical protein PRUPE_ppa015730mg             246   3e-75    Prunus persica
ref|XP_009347569.1|  PREDICTED: ammonium transporter 1 member 3-like    245   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_010496796.1|  PREDICTED: ammonium transporter 1 member 2-like    244   7e-75    Camelina sativa [gold-of-pleasure]
ref|XP_009371506.1|  PREDICTED: ammonium transporter 1 member 3-like    246   8e-75    Pyrus x bretschneideri [bai li]
ref|XP_007200975.1|  hypothetical protein PRUPE_ppa004613mg             245   1e-74    Prunus persica
ref|XP_008384814.1|  PREDICTED: ammonium transporter 1 member 3-like    244   1e-74    Malus domestica [apple tree]
emb|CDY68393.1|  BnaC03g74280D                                          244   1e-74    Brassica napus [oilseed rape]
emb|CDX93005.1|  BnaA03g37270D                                          244   2e-74    Brassica napus [oilseed rape]
ref|XP_004500249.1|  PREDICTED: ammonium transporter 1 member 3-like    242   6e-74    
ref|XP_009370659.1|  PREDICTED: ammonium transporter 1 member 4-like    243   7e-74    Pyrus x bretschneideri [bai li]
gb|AFB73923.1|  AMT1;6                                                  241   1e-73    
ref|XP_006848199.1|  hypothetical protein AMTR_s00029p00240590          241   1e-73    
ref|XP_010650909.1|  PREDICTED: non-specific phospholipase C1 iso...    249   2e-73    
ref|XP_010685576.1|  PREDICTED: ammonium transporter 1 member 3-like    239   7e-73    
ref|XP_002967129.1|  hypothetical protein SELMODRAFT_169094             240   1e-72    
emb|CAN61893.1|  hypothetical protein VITISV_028790                     250   3e-72    
gb|KEH34256.1|  ammonium transporter 1 protein                          236   1e-71    
emb|CDP09182.1|  unnamed protein product                                235   2e-71    
ref|XP_002525633.1|  ammonium transporter, putative                     235   3e-71    
ref|XP_007146759.1|  hypothetical protein PHAVU_006G067500g             234   6e-71    
gb|AFU34590.1|  ammonium transporter 1;3                                234   8e-71    
gb|AFO70202.1|  putative ammonium transporter AMT1;3                    232   1e-70    
gb|EYU23520.1|  hypothetical protein MIMGU_mgv1a005958mg                232   4e-70    
emb|CBI15962.3|  unnamed protein product                                231   4e-70    
gb|KHN02450.1|  Ammonium transporter 1 member 2                         221   1e-69    
ref|XP_010467254.1|  PREDICTED: ammonium transporter 1 member 2-like    232   2e-69    
gb|KDP46505.1|  hypothetical protein JCGZ_08477                         230   2e-69    
ref|XP_002314106.1|  hypothetical protein POPTR_0009s04980g             230   4e-69    
ref|XP_011032126.1|  PREDICTED: ammonium transporter 1 member 3-like    228   2e-68    
ref|XP_010262834.1|  PREDICTED: ammonium transporter 1 member 3-like    228   2e-68    
ref|XP_009629559.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    228   3e-68    
ref|NP_001234216.1|  ammonium transporter 1 member 3                    227   3e-68    
ref|XP_008220722.1|  PREDICTED: ammonium transporter 1 member 3-like    227   4e-68    
ref|XP_011088083.1|  PREDICTED: ammonium transporter 1 member 3         227   4e-68    
ref|XP_007205150.1|  hypothetical protein PRUPE_ppa005341mg             227   5e-68    
ref|XP_006346855.1|  PREDICTED: ammonium transporter 1 member 3-like    226   8e-68    
ref|XP_008799174.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    226   1e-67    
ref|XP_009602703.1|  PREDICTED: ammonium transporter 1 member 3         224   6e-67    
ref|XP_009768027.1|  PREDICTED: ammonium transporter 1 member 3         223   2e-66    
gb|AFG63080.1|  hypothetical protein 0_15050_01                         209   5e-65    
gb|AFG63092.1|  hypothetical protein 0_15050_01                         208   1e-64    
gb|AFG63085.1|  hypothetical protein 0_15050_01                         207   2e-64    
gb|AAL05613.1|AF289478_1  ammonium transporter 1-2                      218   2e-64    
gb|AFG63079.1|  hypothetical protein 0_15050_01                         207   2e-64    
gb|AEW07945.1|  hypothetical protein 0_15050_01                         207   3e-64    
ref|XP_002449577.1|  hypothetical protein SORBIDRAFT_05g019500          210   4e-64    
gb|AEW07946.1|  hypothetical protein 0_15050_01                         205   2e-63    
ref|XP_009402288.1|  PREDICTED: ammonium transporter 1 member 3-like    212   2e-62    
ref|XP_010932683.1|  PREDICTED: LOW QUALITY PROTEIN: ammonium tra...    204   3e-59    
gb|KHN23487.1|  Ammonium transporter 1 member 1                         196   1e-57    
ref|XP_004151520.1|  PREDICTED: ammonium transporter 1 member 2-like    181   4e-51    
gb|AFG57834.1|  hypothetical protein 0_16390_01                         173   4e-51    
gb|AEW07995.1|  hypothetical protein 0_16390_01                         173   5e-51    
gb|EMS52137.1|  Ammonium transporter 1 member 2                         175   5e-49    
emb|CEG00826.1|  Ammonium transporter, conserved site                   164   5e-44    
ref|XP_007508822.1|  ammonium transporter                               164   7e-44    
ref|XP_010445079.1|  PREDICTED: ammonium transporter 1 member 4-like    164   7e-44    
ref|XP_003084401.1|  ammonium transporter (ISS)                         167   1e-43    
ref|XP_006369561.1|  hypothetical protein POPTR_0001s25770g             155   5e-42    
gb|AAT67410.1|  ammonium transporter                                    148   2e-41    
gb|AAT66923.1|  ammonium transporter                                    147   4e-41    
gb|AAT67411.1|  ammonium transporter                                    147   4e-41    
gb|AAT67412.1|  ammonium transporter                                    147   5e-41    
gb|AAT66925.1|  ammonium transporter                                    147   5e-41    
gb|AAT67409.1|  ammonium transporter                                    146   5e-41    
gb|AAT66926.1|  ammonium transporter                                    146   8e-41    
gb|AAT67413.1|  ammonium transporter                                    146   9e-41    
emb|CBI35768.3|  unnamed protein product                                150   2e-40    
gb|AAT66924.1|  ammonium transporter                                    145   3e-40    
gb|AFC35023.1|  hypothetical protein OtV6_115c                          152   5e-40    
ref|XP_002956968.1|  hypothetical protein VOLCADRAFT_67734              153   7e-40    
ref|XP_001422370.1|  Amt family transporter: ammonium                   148   1e-38    
ref|XP_002951167.1|  hypothetical protein VOLCADRAFT_61118              149   2e-38    
ref|XP_002952530.1|  hypothetical protein VOLCADRAFT_75428              148   3e-38    
ref|XP_003062934.1|  ammonium transporter channel family                145   4e-37    
ref|XP_002955193.1|  hypothetical protein VOLCADRAFT_65690              146   4e-37    
ref|XP_007509142.1|  ammonium transporter                               144   5e-37    
ref|XP_010468562.1|  PREDICTED: ammonium transporter 1 member 2-like    140   6e-36    
gb|KHN09394.1|  Ammonium transporter 1 member 2                         130   5e-35    
ref|XP_004346609.1|  ammonium transporter subfamily protein             139   5e-35    
ref|XP_001693464.1|  ammonium transporter                               137   3e-34    
gb|KIY98637.1|  Ammonium transporter 1 member 3                         137   4e-34    
ref|XP_002958308.1|  hypothetical protein VOLCADRAFT_84428              137   4e-34    
gb|AEJ07738.1|  ammonium transporter 1.1                                137   4e-34    
ref|XP_005846324.1|  hypothetical protein CHLNCDRAFT_36096              135   1e-33    
ref|XP_002950617.1|  hypothetical protein VOLCADRAFT_41671              134   1e-33    
ref|XP_002957611.1|  hypothetical protein VOLCADRAFT_77636              134   2e-33    
ref|XP_002958648.1|  hypothetical protein VOLCADRAFT_69712              134   5e-33    
gb|AAM43910.1|AF509496_1  putative amt protein                          134   6e-33    
gb|AFV36360.1|  ammonium transporter                                    133   8e-33    
gb|AAM43911.1|AF509497_1  putative amt protein                          133   1e-32    
gb|AAS55467.2|  putative ammonium transporter                           132   2e-32    
gb|AAS55466.1|  putative ammonium transporter                           132   2e-32    
ref|XP_005708658.1|  ammonium transporter, Amt family                   132   2e-32    
ref|XP_001695207.1|  ammonium transporter                               132   2e-32    
ref|XP_009035630.1|  hypothetical protein AURANDRAFT_37129              130   4e-32    
gb|AAM94623.2|  putative ammonium transporter AMT1;2                    129   2e-31    
ref|XP_005706620.1|  ammonium transporter, Amt family                   130   2e-31    
ref|XP_001692671.1|  ammonium transporter                               129   2e-31    
ref|XP_005774521.1|  putative ammonium transporter                      127   3e-31    
ref|XP_005785348.1|  ammonium transporter                               128   4e-31    
ref|XP_002508410.1|  ammonium transporter channel family                129   5e-31    
ref|XP_009032705.1|  hypothetical protein AURANDRAFT_18463              127   9e-31    
gb|AAM94014.1|  ammonium transporter-like protein AMT1                  120   5e-30    
ref|XP_003063809.1|  rvb1-like protein                                  124   1e-29    
ref|XP_009033199.1|  putative ammonium transporter                      124   1e-29    
ref|XP_005777314.1|  putative ammonium transporter                      123   2e-29    
gb|EFA81012.1|  ammonium transporter                                    125   2e-29    
gb|AEW08709.1|  hypothetical protein CL1331Contig1_03                   114   3e-29    
gb|ADW09020.1|  ammonium transporter 1;2                                123   4e-29    
gb|AFG62172.1|  hypothetical protein CL1331Contig1_03                   114   4e-29    
ref|XP_007512511.1|  ammonium transporter                               122   6e-29    
ref|XP_005652147.1|  Rh-like protein/ammonium transporter               122   7e-29    
ref|XP_005852239.1|  hypothetical protein CHLNCDRAFT_56592              122   9e-29    
ref|XP_002292436.1|  predicted protein                                  120   1e-28    
ref|XP_001697504.1|  ammonium transporter                               120   2e-28    
ref|XP_005647723.1|  ammonium transporter                               120   4e-28    
ref|XP_003295056.1|  ammonium transport protein B                       119   6e-28    
ref|XP_002507516.1|  ammonium transporter channel family                118   9e-28    
ref|XP_004353846.1|  ammonium transporter                               118   1e-27    
dbj|GAM19005.1|  hypothetical protein SAMD00019534_021800               117   1e-27    
ref|XP_005791300.1|  putative ammonium transporter                      118   2e-27    
ref|XP_002292229.1|  ammonium transporter                               117   2e-27    
ref|XP_005789347.1|  putative ammonium transporter                      117   2e-27    
ref|XP_011397539.1|  Ammonium transporter 1 member 1                    117   3e-27    
gb|AEW08710.1|  hypothetical protein CL1331Contig1_03                   109   4e-27    
ref|XP_005831032.1|  ammonium transporter                               115   8e-27    
gb|ADW09021.1|  ammonium transporter 1;1                                117   1e-26    
ref|XP_005789389.1|  ammonium transporter                               115   1e-26    
ref|XP_005771916.1|  tentative ammonium transporter                     117   2e-26    
gb|EJK71331.1|  hypothetical protein THAOC_07247                        116   3e-26    
ref|XP_642123.1|  ammonium transporter                                  114   4e-26    
gb|KIZ07862.1|  Ammonium transporter 1 member 3                         115   4e-26    
ref|XP_005766040.1|  putative ammonium transporter                      114   9e-26    
gb|AEJ07736.1|  ammonium transporter 1.2                                114   9e-26    
gb|EJK75624.1|  hypothetical protein THAOC_02650                        113   1e-25    
ref|XP_011399635.1|  Ammonium transporter 1 member 3                    110   4e-25    
gb|AAV70490.1|  ammonium transporter AMT2a                              111   5e-25    
emb|CBJ33346.1|  ammonium transporter (ISS)                             110   5e-25    
dbj|GAM20042.1|  hypothetical protein SAMD00019534_032170               110   6e-25    
ref|XP_005775636.1|  putative ammonium transporter                      108   1e-24    
ref|XP_005539481.1|  probable ammonium transporter                      110   1e-24    
gb|EJK77494.1|  hypothetical protein THAOC_00672                        110   2e-24    
gb|KDD76492.1|  ammonium transporter                                    109   2e-24    
ref|XP_002287385.1|  ammonium transporter                               108   3e-24    
gb|EJK75364.1|  hypothetical protein THAOC_02914                        109   3e-24    
ref|WP_037464754.1|  ammonium transporter                               107   5e-24    
ref|XP_009836388.1|  hypothetical protein H257_11208                    108   6e-24    
gb|EJK44105.1|  hypothetical protein THAOC_37386                        108   9e-24    
ref|XP_009040553.1|  hypothetical protein AURANDRAFT_69948              107   1e-23    
gb|AAL85930.1|  putative ammonium transporter                           105   1e-23    
emb|CBJ26089.1|  ammonium transporter (ISS)                             106   2e-23    
gb|AAK52491.1|  ammonium transporter-like protein AMT1                  107   2e-23    
emb|CBJ33345.1|  ammonium transporter                                   106   2e-23    
ref|XP_002676019.1|  predicted protein                                  106   2e-23    
ref|XP_008879182.1|  hypothetical protein H310_13451                    106   3e-23    
ref|WP_033165980.1|  adenylate cyclase                                  106   4e-23    
ref|WP_019240610.1|  ammonium transporter                               105   5e-23    
ref|NP_001053281.1|  Os04g0509500                                       101   9e-23    
ref|XP_005824542.1|  ammonium transporter                               104   1e-22    
ref|XP_008619166.1|  hypothetical protein SDRG_14789                    103   3e-22    
ref|WP_017755476.1|  ammonium transporter                               102   3e-22    
ref|WP_022853577.1|  ammonium transporter                               103   3e-22    
ref|WP_044476827.1|  ammonium transporter                               103   3e-22    
ref|WP_044641926.1|  ammonium transporter                               102   3e-22    
ref|WP_008118065.1|  adenylate cyclase [                                103   4e-22    
ref|XP_005845571.1|  hypothetical protein CHLNCDRAFT_136742             103   4e-22    
ref|WP_022361544.1|  hypothetical protein                               103   4e-22    
ref|WP_041060162.1|  ammonium transporter                               102   4e-22    
ref|WP_034763393.1|  ammonium transporter                               102   8e-22    
ref|WP_036177911.1|  ammonium transporter                               101   9e-22    
ref|WP_025911226.1|  hypothetical protein                               102   9e-22    
ref|WP_013655888.1|  adenylate cyclase                                  102   1e-21    
ref|WP_039299744.1|  ammonium transporter                               101   1e-21    
gb|AEJ07737.1|  ammonium transporter 1.3                                100   1e-21    
ref|WP_006837395.1|  ammonium transporter                               100   2e-21    
gb|KFK39730.1|  hypothetical protein AALP_AA3G280600                  99.4    3e-21    
ref|WP_044337722.1|  ammonium transporter                               100   3e-21    
ref|WP_042349681.1|  ammonium transporter                             99.8    3e-21    
gb|KDO24916.1|  hypothetical protein SPRG_09560                         100   3e-21    
ref|XP_002180943.1|  predicted protein                                  100   3e-21    
ref|WP_029326737.1|  hypothetical protein                               100   3e-21    
ref|WP_042235041.1|  ammonium transporter                               100   4e-21    
ref|XP_009033479.1|  hypothetical protein AURANDRAFT_52202              100   5e-21    
ref|XP_002176480.1|  Ammonium_transporter                               100   5e-21    
ref|XP_008616871.1|  hypothetical protein SDRG_12576                    100   5e-21    
gb|AEN91478.1|  ammonium transporter                                  99.4    5e-21    
ref|XP_005824484.1|  ammonium transporter                               100   6e-21    
ref|WP_042135739.1|  ammonium transporter                             99.4    6e-21    
ref|WP_042992335.1|  ammonium transporter                             99.8    7e-21    
ref|WP_028458554.1|  hypothetical protein                             99.4    7e-21    
ref|WP_033578025.1|  ammonium transporter                             99.4    8e-21    
gb|AHF79891.1|  ammonium transporter                                  99.4    8e-21    
ref|WP_042682668.1|  ammonium transporter                             99.4    8e-21    
ref|WP_036710808.1|  ammonium transporter                             98.6    9e-21    
ref|WP_042212039.1|  ammonium transporter                             99.0    9e-21    
ref|WP_015941166.1|  ammonium transporter                             99.4    9e-21    
ref|WP_034275482.1|  ammonium transporter                             99.0    1e-20    
ref|WP_022237243.1|  nitrogen regulatory protein P-II                 99.8    1e-20    
ref|WP_034327384.1|  ammonium transporter                             99.0    1e-20    
ref|WP_025749924.1|  hypothetical protein                             99.0    1e-20    
ref|WP_003529797.1|  adenylate cyclase [                              99.8    1e-20    
ref|WP_034267738.1|  hypothetical protein                             98.6    1e-20    
ref|WP_027094385.1|  ammonium transporter                             98.6    1e-20    
ref|WP_028543753.1|  ammonium transporter                             98.2    1e-20    
ref|WP_002595639.1|  adenylate cyclase [                              99.4    1e-20    
gb|ADE67692.1|  ammonium transporter                                  98.2    1e-20    
ref|WP_022201808.1|  hypothetical protein                             99.4    1e-20    
ref|WP_002583229.1|  ammonium transporter [                           99.4    2e-20    
ref|WP_031459431.1|  hypothetical protein                             98.6    2e-20    
ref|WP_041816496.1|  ammonium transporter                             97.8    2e-20    
ref|WP_033099744.1|  ammonium transporter                             97.8    2e-20    
dbj|BAD66459.1|  ammonium transporter                                 97.8    2e-20    
ref|WP_035205944.1|  ammonium transporter                             97.8    2e-20    
ref|WP_027085258.1|  ammonium transporter                             98.2    2e-20    
ref|XP_002680225.1|  ammonium transporter                             98.2    2e-20    
ref|WP_041824893.1|  ammonium transporter                             97.4    2e-20    
ref|WP_035439416.1|  ammonium transporter                             96.3    2e-20    
gb|ENZ34482.1|  ammonium transporter [ [                              99.0    2e-20    
ref|WP_034768276.1|  ammonium transporter                             97.4    2e-20    
gb|KDO24917.1|  hypothetical protein SPRG_09561                       98.2    3e-20    
ref|WP_038295207.1|  adenylate cyclase [                              98.6    3e-20    
gb|EDP16747.1|  hypothetical protein CLOBOL_02891 [ [                 98.6    3e-20    
emb|CAJ71754.1|  strongly similar to ammonium transporter             98.2    3e-20    
ref|WP_041088344.1|  ammonium transporter                             97.4    3e-20    
ref|WP_018754512.1|  hypothetical protein                             97.1    3e-20    
ref|WP_038281975.1|  adenylate cyclase [                              98.6    3e-20    
ref|XP_005793795.1|  putative ammonium transporter                    97.1    3e-20    
ref|WP_040195936.1|  adenylate cyclase                                98.6    3e-20    
dbj|GAE07935.1|  ammonium transporter                                 94.4    3e-20    
ref|WP_038280742.1|  adenylate cyclase [                              98.2    4e-20    



>ref|XP_009795683.1| PREDICTED: ammonium transporter 1 member 2 [Nicotiana sylvestris]
Length=512

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  287  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCG+WG+IFTGLFAKK+YVNEVYPG
Sbjct  347  AIVCGFVAAWVLIGFNKLAVKLKYDDPLEAAQLHGGCGSWGIIFTGLFAKKAYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGLFMGGGGKLL AQ+IQI+VI GWVS TMGPLFY+LHK KLLRI  EDE  GMD
Sbjct  407  FPDRPYGLFMGGGGKLLGAQIIQILVIIGWVSVTMGPLFYLLHKFKLLRICREDEEAGMD  466

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDED+ SS  PG KM
Sbjct  467  LTRHGGFAYLYHDEDEGSSM-PGFKM  491



>ref|XP_006340472.1| PREDICTED: ammonium transporter 1 member 2-like [Solanum tuberosum]
Length=512

 Score =   331 bits (848),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAIT+GC+VVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITAGCAVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AAWVLIG N LAA  KYDDPLEAAQLHGGCG+WG+IFTGLFAKK YVNEVYPG
Sbjct  348  AIVCGFIAAWVLIGFNALAAKLKYDDPLEAAQLHGGCGSWGIIFTGLFAKKEYVNEVYPG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLL AQ+IQ+VVI GWVS TMGPLFY+LHK KLLRIS +DET GMD
Sbjct  408  FPNRPYGLFMGGGGKLLGAQIIQVVVIIGWVSVTMGPLFYLLHKFKLLRISRDDETAGMD  467

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDED+ SS  PG KM
Sbjct  468  LTRHGGFAYIYHDEDEGSS-MPGFKM  492



>ref|NP_001234253.1| ammonium transporter 1 member 2 [Solanum lycopersicum]
 sp|O04161.1|AMT12_SOLLC RecName: Full=Ammonium transporter 1 member 2; AltName: Full=LeAMT1;2 
[Solanum lycopersicum]
 emb|CAA64475.1| ammonium transporter [Solanum lycopersicum]
Length=514

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLV HWNV+DVCNGLLGGFAAITSGC+VVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFCKRLLVAHWNVVDVCNGLLGGFAAITSGCAVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AAWVLIG N LAA  KYDDPLEAAQLHGGCG+WG+IFTGLFAKK YVNEVYPG
Sbjct  348  AIVCGFIAAWVLIGFNALAAKLKYDDPLEAAQLHGGCGSWGIIFTGLFAKKEYVNEVYPG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLL AQ+IQ+VVI GWVS TMGPLFY+LHK KLLRIS +DET GMD
Sbjct  408  FPNRPYGLFMGGGGKLLGAQVIQVVVIIGWVSVTMGPLFYLLHKFKLLRISRDDETAGMD  467

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDED+ SS  PG KM
Sbjct  468  LTRHGGFAYIYHDEDEGSSM-PGFKM  492



>emb|CDP04266.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLL GHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  286  WSAVGRTAVTTTLAGSTAALTTLFGKRLLAGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVL+G NKLAA  KYDDPLEAAQLHGGCGAWGL+FTGLFA K +VNEVY G
Sbjct  346  AIVCGFVAAWVLMGLNKLAAELKYDDPLEAAQLHGGCGAWGLLFTGLFAAKDFVNEVYQG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGLFMGGGGKLLAAQ+IQI+VI GWVSATMGPLF+ LHKL LLRIS++DE  GMD
Sbjct  406  KPDRPYGLFMGGGGKLLAAQIIQILVIIGWVSATMGPLFFGLHKLNLLRISTQDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDEDD S+     KM
Sbjct  466  LTRHGGFAYVYHDEDDGSNLPASFKM  491



>ref|XP_007030324.1| Ammonium transporter 1,2 [Theobroma cacao]
 gb|EOY10826.1| Ammonium transporter 1,2 [Theobroma cacao]
Length=510

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTT+AGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  286  WSAIGRTAVTTTMAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N LA+  KYDDPLEAAQLHGGCGAWGL+FTGLFA ++YVNEVYPG
Sbjct  346  AIICGFVAAWVLIGFNILASKLKYDDPLEAAQLHGGCGAWGLLFTGLFATEAYVNEVYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ+IQI+VI GWV+ATMGPLFY+LHK+KLLRIS  DET GMD
Sbjct  406  RPGRPYGLFMGGGGKLLGAQLIQILVIAGWVTATMGPLFYVLHKMKLLRISENDETAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHDE+D S   PG  M
Sbjct  466  LTRHGGFAYAYHDEEDLSLT-PGFMM  490



>ref|XP_011102181.1| PREDICTED: ammonium transporter 1 member 2-like, partial [Sesamum 
indicum]
Length=364

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR LVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  140  WSAVGRTAVTTTLAGSTAALTTLFGKRFLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  199

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVA+WVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAKK+YVNEVYP 
Sbjct  200  AIICGFVASWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGVLFTGLFAKKAYVNEVYPD  259

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLLAAQ+IQI+VI GWV+ATM PLF  LHKLKLLR+SSEDE  GMD
Sbjct  260  RPNRPYGLFMGGGGKLLAAQIIQILVIVGWVTATMAPLFLALHKLKLLRVSSEDEMAGMD  319

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGG AY YHD+DD  S+ P  +M
Sbjct  320  MTRHGGMAYIYHDQDDH-SNLPQFRM  344



>gb|EYU39527.1| hypothetical protein MIMGU_mgv1a004766mg [Erythranthe guttata]
Length=511

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  286  WSAIGRTAVTTTLAGSTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVL+G NKLA   +YDDPLEAAQLHGGCGAWGL+FTGLFAKKSYVNEVYPG
Sbjct  346  AIVCGFVAAWVLMGFNKLADKLEYDDPLEAAQLHGGCGAWGLLFTGLFAKKSYVNEVYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LPDRPYGLFMGGGGKLLAAQ++QI+V+ GWV+ATM PLFY LHK+ LLR+S++DE  GMD
Sbjct  406  LPDRPYGLFMGGGGKLLAAQIVQILVVAGWVTATMAPLFYGLHKMGLLRVSAKDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGG AY YHDEDD S+
Sbjct  466  MTRHGGMAYLYHDEDDTSN  484



>ref|XP_010042334.1| PREDICTED: putative ammonium transporter 1 member 5 [Eucalyptus 
grandis]
Length=402

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  178  WSAVGRTAVTTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  237

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA  C YDDPLEAAQLHGGCGAWGL+FTGLFAK  YV+EVY G
Sbjct  238  AIVCGFVAAWVLIGCNKLAEKCNYDDPLEAAQLHGGCGAWGLLFTGLFAKGVYVDEVYGG  297

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGG+LLAAQ++QI+VI GWVS TMGPLFY LHKLKLLRISSEDE  GMD
Sbjct  298  PGKRPHGLFMGGGGRLLAAQIVQILVICGWVSVTMGPLFYGLHKLKLLRISSEDEMQGMD  357

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAYAYHDEDD S    G+ M
Sbjct  358  MTRHGGFAYAYHDEDDLSMKPSGVMM  383



>ref|XP_008350942.1| PREDICTED: ammonium transporter 1 member 2-like [Malus domestica]
Length=504

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRISSEDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISSEDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|AEZ06604.1| AMT1;2 [Pyrus pyrifolia]
Length=504

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAV TTLAGCTAALTTLFGKRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVATTLAGCTAALTTLFGKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|AEZ06602.1| AMT1;2 [Pyrus calleryana]
 gb|AFH74975.1| ammonium transporter AMT1;2 [Pyrus calleryana]
Length=504

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|AEZ06601.1| AMT1;2 [Pyrus betulifolia]
Length=504

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|KJB44784.1| hypothetical protein B456_007G273100 [Gossypium raimondii]
Length=509

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N LAA  KYDDPLEAAQLHGGCGAWGL+FTGLFA K+YVNEVYPG
Sbjct  344  AIICGFVAAWVLIGFNMLAAKFKYDDPLEAAQLHGGCGAWGLLFTGLFATKAYVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            L  RPYG+FMGGGGKLL AQ+IQI+VI GWV+ATMGPLFY+L K+ LLRIS EDET GMD
Sbjct  404  LSGRPYGMFMGGGGKLLGAQIIQILVITGWVTATMGPLFYVLKKMNLLRISREDETAGMD  463

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHDE+D S
Sbjct  464  LTRHGGFAYVYHDEEDIS  481



>gb|AEZ06605.1| AMT1;2 [Pyrus ussuriensis]
Length=504

 Score =   320 bits (820),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|AFO66661.1| AMT1;2 [Citrus trifoliata]
Length=505

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCG WG++FTGLFA+++YV EVYPG
Sbjct  344  AIICGFVAAWVLIGCNKLAEKLKYDDPLEAAQLHGGCGTWGILFTGLFAREAYVGEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAAQ+IQI+VI GWV+ATMGPLFY L K+ LLRIS EDE  GMD
Sbjct  404  RPGRPYGLFMGGGGRLLAAQIIQILVIGGWVTATMGPLFYGLEKINLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHDEDD SS  P   M
Sbjct  464  LTRHGGFAYAYHDEDD-SSQKPAFAM  488



>gb|AEZ06603.1| AMT1;2 [Pyrus x bretschneideri]
Length=504

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVC+GLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCSGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEELKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|AEY75247.1| ammonium transporter [Malus hupehensis]
 gb|AFD63113.1| high-affinity ammonium transporter [Malus hupehensis var. mengshanensis]
Length=504

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AAWV+IG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA + YVNEVY G
Sbjct  348  AIVCGFMAAWVMIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>gb|KDO52481.1| hypothetical protein CISIN_1g043627mg [Citrus sinensis]
Length=504

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKL    KYDDPLEAAQLHGGCG WG++FTGLFA+++YV EVYPG
Sbjct  344  AIICGFVAAWVLIGCNKLGEKLKYDDPLEAAQLHGGCGTWGILFTGLFAREAYVGEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAAQ+IQI+VI GWV+ATMGPLFY L K+ LLRIS++DE  GMD
Sbjct  404  RPGRPYGLFMGGGGRLLAAQIIQILVIAGWVTATMGPLFYGLKKINLLRISTDDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHDEDD SS  P   M
Sbjct  464  LTRHGGFAYAYHDEDD-SSQKPAFAM  488



>ref|XP_006443272.1| hypothetical protein CICLE_v10019808mg [Citrus clementina]
 gb|ESR56512.1| hypothetical protein CICLE_v10019808mg [Citrus clementina]
Length=504

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WTAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCG WG++FTGLFA+++YV EVYPG
Sbjct  344  AIICGFVAAWVLIGCNKLAEKLKYDDPLEAAQLHGGCGTWGILFTGLFAREAYVGEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAAQ+IQI+VI GWV+ATMGPLFY L K+ LLRIS +DE  GMD
Sbjct  404  RPGRPYGLFMGGGGRLLAAQIIQILVIAGWVTATMGPLFYGLKKINLLRISRDDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHDEDD SS  P   M
Sbjct  464  LTRHGGFAYAYHDEDD-SSQKPAFAM  488



>ref|XP_002325790.2| ammonium transporter 2 family protein [Populus trichocarpa]
 gb|EEF00172.2| ammonium transporter 2 family protein [Populus trichocarpa]
Length=506

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLL GHWNVIDVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  282  WSAVGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVIDVCNGLLGGFAAITAGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA   +YDDPLEAAQLHGGCG WGL+FTGLFAK++YVNEVY  
Sbjct  342  AIICGFVAAWVLIGCNKLADKLQYDDPLEAAQLHGGCGMWGLLFTGLFAKETYVNEVYSN  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAAQ+I+I+VI GWVSATMGPLFY LHKLKLLRIS+EDE  GMD
Sbjct  402  KPGRPYGLFMGGGGKLLAAQIIEILVIVGWVSATMGPLFYGLHKLKLLRISAEDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAYAY +EDD S
Sbjct  462  LTRHGGFAYAYDEEDDVS  479



>ref|XP_010043315.1| PREDICTED: ammonium transporter 1 member 1-like [Eucalyptus grandis]
 gb|KCW85321.1| hypothetical protein EUGRSUZ_B02160 [Eucalyptus grandis]
Length=510

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  286  WSAVGRTAVTTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA  C YDDPLEAAQLHGGCGAWGL+FTGLFAK  YV+EVY G
Sbjct  346  AIVCGFVAAWVLIGCNKLAEKCNYDDPLEAAQLHGGCGAWGLLFTGLFAKGVYVDEVYGG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGG+LLAAQ++QI+VI GWVS TMGPLFY LHKLKLLRISSEDE  GMD
Sbjct  406  PGKRPHGLFMGGGGRLLAAQIVQILVICGWVSVTMGPLFYGLHKLKLLRISSEDEMQGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAYAYHDEDD S    G+ M
Sbjct  466  MTRHGGFAYAYHDEDDLSMKPSGVMM  491



>gb|AEZ06606.1| AMT1;2 [Pyrus communis]
Length=504

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLL GHWNV+DVCNGLLGGFAAITSGCSV EPWA
Sbjct  288  WSAIGRTAVTTTLAGCTAALTTLFSKRLLAGHWNVLDVCNGLLGGFAAITSGCSVAEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGL+FTGLFA + YVNEVY G
Sbjct  348  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLVFTGLFATEKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+V+ GWVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  408  RSGRPYGLFMGGGGRLLAAQIVQILVVAGWVSATMGPLFYGLHKLKLLRISREDETQGMD  467

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  468  MTRHGGFAYVYHDEDDPS  485



>emb|CAG26715.1| ammonium transporter [Populus tremula x Populus tremuloides]
Length=507

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLL GHWNVIDVCNGLL GFAAIT+GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVIDVCNGLLRGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA   +YDDPLEAAQLHGGCG WGL+FTGLFAKK+YVNEVY  
Sbjct  343  AIICGFVAAWVLIGCNKLAEKLQYDDPLEAAQLHGGCGMWGLLFTGLFAKKAYVNEVYSN  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAAQ+I+I+VI GWVSATMGPLFY LHKLKLLRISSEDE  GMD
Sbjct  403  KPGRPYGLFMGGGGKLLAAQIIEILVIVGWVSATMGPLFYGLHKLKLLRISSEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAYAY  EDD S
Sbjct  463  LTRHGGFAYAYDAEDDVS  480



>ref|XP_011077134.1| PREDICTED: uncharacterized protein LOC105161213 [Sesamum indicum]
Length=983

 Score =   327 bits (839),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR LVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  756  WSAVGRTAVTTTLAGSTAALTTLFGKRFLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  815

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAKK YVNEVYPG
Sbjct  816  AIICGFMAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGVLFTGLFAKKDYVNEVYPG  875

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGLFMGGGG+LLAAQ+IQI+VI GWV+ATM PLF +LHKL+LLRISSEDE  GMD
Sbjct  876  KPDRPYGLFMGGGGRLLAAQVIQILVIIGWVTATMAPLFLVLHKLRLLRISSEDEMAGMD  935

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGG AY YHDE  ++S+ P  KM
Sbjct  936  LTRHGGMAYIYHDE-GENSNLPQFKM  960



>gb|EYU39526.1| hypothetical protein MIMGU_mgv1a004778mg [Erythranthe guttata]
Length=511

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLFG+R+LVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  287  WSAIGRTAVTTTLAGSTAALTTLFGRRILVGHWNVMDVCNGLLGGFAAITSGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWGL+FTGLFAKK YVNEVYPG
Sbjct  347  AIVCGFVAAWVLIGLNKLAKKLKYDDPLEAAQLHGGCGAWGLLFTGLFAKKIYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGLFMGGGGKLLAAQ++QI+V+ GWV+ATM PLF  LHK+ LLR+S +DET GMD
Sbjct  407  RPDRPYGLFMGGGGKLLAAQLVQILVVIGWVTATMAPLFLALHKMGLLRVSFKDETAGMD  466

Query  543  LTRHGGFAYAYHDEDDQSS  599
            L RHGG AY Y DED+ S+
Sbjct  467  LARHGGMAYVYEDEDENSA  485



>ref|XP_008801272.1| PREDICTED: ammonium transporter 1 member 2-like [Phoenix dactylifera]
Length=511

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  288  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVLIG NKLAA  K+DDPLEA QLHGGCGAWG+IFTGLFA++ YVNEVYPG
Sbjct  348  AVICGFVAAWVLIGLNKLAAKVKFDDPLEATQLHGGCGAWGIIFTGLFAREKYVNEVYPG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAAQ++QI+VI GWVS TMGPLFY LH++ LLRIS EDE  GMD
Sbjct  408  RPGRPYGLFMGGGGRLLAAQIVQILVIAGWVSCTMGPLFYALHRMGLLRISPEDEMAGMD  467

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LTRHGGFAY YHD+DD  +
Sbjct  468  LTRHGGFAYIYHDDDDSGT  486



>ref|XP_007030323.1| Ammonium transporter 1,2 [Theobroma cacao]
 gb|EOY10825.1| Ammonium transporter 1,2 [Theobroma cacao]
Length=562

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTT+AGCTA LTTLF KRLLV +W+VIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  257  WSAIGRTAVTTTMAGCTAGLTTLFSKRLLVSNWSVIDVCNGLLGGFAAITSGCSVVEPWA  316

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N LA+  KYDDPLEAAQLHGGCGAWGL+FTGLFA ++YVNEVYPG
Sbjct  317  AIICGFVAAWVLIGFNILASKWKYDDPLEAAQLHGGCGAWGLLFTGLFATEAYVNEVYPG  376

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ+IQI+VI GWV+ATMGPLFY+LHK+KLLRIS  DET GMD
Sbjct  377  RPGRPYGLFMGGGGKLLGAQIIQILVIAGWVTATMGPLFYVLHKMKLLRISENDETAGMD  436

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHD +D S   PG  M
Sbjct  437  LTRHGGFAYAYHDAEDLSLT-PGFMM  461



>ref|XP_011466031.1| PREDICTED: ammonium transporter 1 member 2 [Fragaria vesca subsp. 
vesca]
Length=805

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  588  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  647

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWGL+FTGLFA + YVNEVY G
Sbjct  648  AIVCGFVAAWVLIGFNKLAEKVKYDDPLEAAQLHGGCGAWGLLFTGLFATERYVNEVYSG  707

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAAQ++QI+V+ GWV+ TMGPLFY LHKLKLLR+S +DET GMD
Sbjct  708  RPGRPYGLFMGGGGKLLAAQVVQILVVMGWVTVTMGPLFYGLHKLKLLRVSDKDETAGMD  767

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY Y+DED+ S
Sbjct  768  LTRHGGFAYVYNDEDEAS  785



>ref|XP_006420410.1| hypothetical protein CICLE_v10004812mg [Citrus clementina]
 gb|ESR33650.1| hypothetical protein CICLE_v10004812mg [Citrus clementina]
Length=500

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFAK+ +VNEVYPG
Sbjct  344  AIVCGFVAAVVLIACNKLAEKAKYDDPLEAAQLHGGCGAWGVIFTALFAKEKFVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA +IQI+V+ GWVSATMGPLF++LHKLKLLRIS EDE  GMD
Sbjct  404  KPGRPYGLFMGGGGKLLAAHVIQILVVAGWVSATMGPLFFVLHKLKLLRISPEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+DD  S+  GI++
Sbjct  464  LTRHGGFAYVYHDDDDVQSN--GIQL  487



>ref|NP_176658.1| ammonium transporter 1;2 [Arabidopsis thaliana]
 sp|Q9ZPJ8.1|AMT12_ARATH RecName: Full=Ammonium transporter 1 member 2; Short=AtAMT1;2 
[Arabidopsis thaliana]
 gb|AAD38253.1|AC006193_9 Ammonium transporter ATM1;2 [Arabidopsis thaliana]
 gb|AAD17001.1| ammonium transporter [Arabidopsis thaliana]
 gb|AAL32649.1| Ammonium transporter ATM1 [Arabidopsis thaliana]
 gb|AAM13373.1| ammonium transporter ATM1;2 [Arabidopsis thaliana]
 gb|AEE34288.1| ammonium transporter 1;2 [Arabidopsis thaliana]
Length=514

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 184/207 (89%), Gaps = 6/207 (3%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCTAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWGLIFTGLFA+K YVNE+Y G
Sbjct  353  AIVCGFVASWVLIGFNLLAKKLKYDDPLEAAQLHGGCGAWGLIFTGLFARKEYVNEIYSG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLFMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS----HYPG  611
            +TRHGGFAYAY+DEDD S+    H+ G
Sbjct  471  MTRHGGFAYAYNDEDDVSTKPWGHFAG  497



>gb|AFO66660.1| AMT1;1 [Citrus trifoliata]
Length=500

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L G WNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGRWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFAK+ +VNEVYPG
Sbjct  344  AIVCGFVAAVVLIACNKLAEKAKYDDPLEAAQLHGGCGAWGVIFTALFAKEKFVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA +IQI+V+ GWVSATMGPLF++LHKLKLLRIS EDE  GMD
Sbjct  404  KPGRPYGLFMGGGGKLLAAHVIQILVVAGWVSATMGPLFFVLHKLKLLRISPEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+DD  S+  GI++
Sbjct  464  LTRHGGFAYVYHDDDDVQSN--GIQL  487



>gb|AGG68788.1| putative ammonium transporter, partial [Populus alba x Populus 
glandulosa]
Length=198

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  84   LLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLIGANKLAAVCKYDDP  263
            LL GHWNVIDVCNGLLGGFAAIT+GCSVVEPWAAI+CGFVAAWVLIG NKLA   +YDDP
Sbjct  1    LLSGHWNVIDVCNGLLGGFAAITAGCSVVEPWAAIICGFVAAWVLIGCNKLADKLQYDDP  60

Query  264  LEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPGLPDRPYGLFMGGGGKLLAAQMIQIVVI  443
            LEAAQLHGGCG WGL+FTGLFAK++YVNEVYP  P RPYGLFMGGGGKLLAAQ+I+I+VI
Sbjct  61   LEAAQLHGGCGMWGLLFTGLFAKEAYVNEVYPNKPGRPYGLFMGGGGKLLAAQIIEILVI  120

Query  444  FGWVSATMGPLFYMLHKLKLLRISSEDETHGMDLTRHGGFAYAYHDEDDQS  596
             GWVSATMGPLFY LHKLKLLRIS+EDE  GMDLTRHGGFAYAY  EDD S
Sbjct  121  LGWVSATMGPLFYGLHKLKLLRISTEDEMAGMDLTRHGGFAYAYDAEDDVS  171



>ref|XP_008224012.1| PREDICTED: ammonium transporter 1 member 1-like [Prunus mume]
Length=502

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGR AVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  284  WSAVGRPAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFA K YVNEVYPG
Sbjct  344  AIVCGFVAAIVLISCNKLAEKMKYDDPLEAAQLHGGCGAWGIIFTALFATKKYVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDR YGLFMGGGGK+L A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  404  KPDRHYGLFMGGGGKMLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHD++D 
Sbjct  464  LTRHGGFAYVYHDDEDS  480



>dbj|BAD29977.1| putative ammonium transporter [Camellia sinensis]
Length=513

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 182/206 (88%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  288  WSAVGRTAVTTTLAGCTAALTTLFGKRLLDGHWNVVDVCNGLLGGFAAITSGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG NK+A   KYDDPLEAAQLHGGCG+WG++FTGLFAKK YV+EVY  
Sbjct  348  AIVCGFVSAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGSWGILFTGLFAKKKYVDEVYSA  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAAQ+I+I+VIFGWVS TMGPLFY L KLKLLRIS EDE  GMD
Sbjct  408  --GRPYGLFMGGGGKLLAAQLIEILVIFGWVSVTMGPLFYGLKKLKLLRISREDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y DEDD ++  PG  M
Sbjct  466  LTRHGGFAYIYRDEDDLANR-PGFMM  490



>ref|XP_009411384.1| PREDICTED: ammonium transporter 1 member 1-like [Musa acuminata 
subsp. malaccensis]
Length=504

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWNV+DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  276  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITSGCSVVDPWA  335

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG NKLAA  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  336  ALICGFVSAWVLIGFNKLAATLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  395

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAA ++QI+VI GWVS TMGPLF+ LHKL LLRISSEDE  GMD
Sbjct  396  RQGRPYGLFMGGGGRLLAAHIVQILVITGWVSCTMGPLFFALHKLGLLRISSEDEMAGMD  455

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  456  LTRHGGFAYVYHDED  470



>ref|XP_009601082.1| PREDICTED: ammonium transporter 1 member 1, partial [Nicotiana 
tomentosiformis]
Length=488

 Score =   307 bits (786),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG NKLA + KYDDPLEAAQLHGGCGAWG+IFT LFAK SYV++VYPG
Sbjct  339  AIICGFVAALVLIGCNKLAEIFKYDDPLEAAQLHGGCGAWGIIFTALFAKGSYVDQVYPG  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL A +IQI+VIFGWV+ATMGPLFY+LHK KLLRISSEDE  GMD
Sbjct  399  RPGRPHGLFMGGGGKLLGAHIIQILVIFGWVTATMGPLFYILHKFKLLRISSEDEMAGMD  458

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  459  LTRHGGFAY-YHDED  472



>ref|XP_009382197.1| PREDICTED: ammonium transporter 1 member 2-like [Musa acuminata 
subsp. malaccensis]
Length=504

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWNV+DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  276  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVLDVCNGLLGGFAAITSGCSVVDPWA  335

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG NKLAA  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  336  AIVCGFVSAWVLIGLNKLAAKFKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  395

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++QI+VI GWVS TMGPLF+ LHKL LLRIS+EDE  GMD
Sbjct  396  RPGRPYGLFMGGGGRLLGAHIVQILVITGWVSCTMGPLFFALHKLNLLRISAEDELAGMD  455

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHDED  +
Sbjct  456  LTRHGGFAYDYHDEDPSA  473



>ref|XP_011102198.1| PREDICTED: ammonium transporter 1 member 2-like [Sesamum indicum]
Length=510

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR LVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAVGRTAVTTTLAGSTAALTTLFGKRFLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+    A+WVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAKK+YVNEVYP 
Sbjct  346  AIIWVLWASWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGVLFTGLFAKKAYVNEVYPD  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLLAAQ+IQI+VI GWV+ATM PLF  LHKLKLLR+SSEDE  GMD
Sbjct  406  RPNRPYGLFMGGGGKLLAAQIIQILVIVGWVTATMAPLFLALHKLKLLRVSSEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGG AY YHD+DD  S+ P  +M
Sbjct  466  MTRHGGMAYIYHDQDDH-SNLPQFRM  490



>ref|XP_009784484.1| PREDICTED: ammonium transporter 1 member 1 [Nicotiana sylvestris]
Length=490

 Score =   307 bits (786),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  281  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  340

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AA VLIG NKLA + KYDDPLEAAQLHGGCGAWG+IFT LFAK SYV++VYPG
Sbjct  341  AIICGFIAALVLIGCNKLAEIFKYDDPLEAAQLHGGCGAWGIIFTALFAKGSYVDQVYPG  400

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL A +IQI+VIFGWV+ATMGPLFY+LHK KLLRISSEDE  GMD
Sbjct  401  KPGRPHGLFMGGGGKLLGAHIIQILVIFGWVTATMGPLFYILHKFKLLRISSEDEMAGMD  460

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  461  LTRHGGFAY-YHDED  474



>gb|AEY75246.1| ammonium transporter [Malus hupehensis]
 gb|AFD63112.1| high-affinity ammonium transporter [Malus hupehensis var. mengshanensis]
Length=505

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AIVCGFVAAIVLISCNKLAEKLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  407  KQGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHD++D+ 
Sbjct  467  LTRHGGFAYVYHDDEDEQ  484



>ref|XP_009384059.1| PREDICTED: ammonium transporter 1 member 1-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWN +DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  276  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNAVDVCNGLLGGFAAITSGCSVVDPWA  335

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG NKLAA  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVY G
Sbjct  336  AIICGFVSAWVLIGLNKLAATLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYQG  395

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAA +IQI+VI GWVS TMGPLF+ LHKL LLRIS+EDE  GMD
Sbjct  396  RPGRPYGLFMGGGGRLLAAHVIQILVILGWVSCTMGPLFFALHKLGLLRISAEDEMAGMD  455

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHDED  +
Sbjct  456  LTRHGGFAYVYHDEDSSA  473



>ref|XP_007223306.1| hypothetical protein PRUPE_ppa004542mg [Prunus persica]
 gb|EMJ24505.1| hypothetical protein PRUPE_ppa004542mg [Prunus persica]
Length=504

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  286  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFA K YVNEVY G
Sbjct  346  AIVCGFVAAIVLISCNKLAEKVKYDDPLEAAQLHGGCGAWGIIFTALFATKKYVNEVYGG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGGK+L A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  406  KSDRPYGLFMGGGGKMLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHD++D 
Sbjct  466  LTRHGGFAYVYHDDEDS  482



>gb|AFH74974.1| ammonium transporter AMT1;1 [Pyrus calleryana]
Length=505

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AIVCGFAAAIVLISCNKLAEKLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  407  KDGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHDE+D+ 
Sbjct  467  LTRHGGFAYVYHDEEDEQ  484



>ref|XP_006478972.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2-like [Citrus sinensis]
Length=813

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 184/210 (88%), Gaps = 5/210 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  589  WTAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  648

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAK----KSYVNE  350
            AI+CGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCG WG++FTGLFA+    ++YV E
Sbjct  649  AIICGFVAAWVLIGCNKLAEKLKYDDPLEAAQLHGGCGTWGILFTGLFARVIRPEAYVGE  708

Query  351  VYPGLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDET  530
            VYPG P RPYGLFMGGGG+LLAAQ+IQI+VI GWV+ATMGPLFY L K+ LLRIS +DE 
Sbjct  709  VYPGRPGRPYGLFMGGGGRLLAAQIIQILVIAGWVTATMGPLFYGLKKINLLRISRDDEM  768

Query  531  HGMDLTRHGGFAYAYHDEDDQSSHYPGIKM  620
             GMDLTRHGGFAYAYHDEDD SS  P   M
Sbjct  769  AGMDLTRHGGFAYAYHDEDD-SSQKPAFAM  797



>gb|AHJ60273.1| ammonium transporter AMT1;1 [Pyrus betulifolia]
Length=505

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAA TTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  286  WSAVGRTAVTTTLAGCTAAPTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  346  AIVCGFIAAIVLISCNKLAEKLKYDDPLEAAQLHGGCGAWGIIFTALFATEKYVNEVYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  406  KEGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHD++D 
Sbjct  466  LTRHGGFAYVYHDDEDS  482



>ref|XP_009602795.1| PREDICTED: ammonium transporter 1 member 2 [Nicotiana tomentosiformis]
Length=512

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGC+VVEPWA
Sbjct  287  WSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVVDVCNGLLGGFAAITSGCAVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCG+WG+IFTGLFAKK+YVNEVYPG
Sbjct  347  AIVCGFVAAWVLIGFNKLAVKLKYDDPLEAAQLHGGCGSWGIIFTGLFAKKTYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGL MGGGGKLL AQ+IQ+VVI GWVS TMGPLFY+LHK KLLRI  EDE  GMD
Sbjct  407  FPDRPYGLLMGGGGKLLGAQIIQVVVIIGWVSVTMGPLFYLLHKFKLLRICREDEEAGMD  466

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDED+ SS  PG KM
Sbjct  467  LTRHGGFAYLYHDEDEGSSM-PGFKM  491



>ref|XP_010264809.1| PREDICTED: ammonium transporter 1 member 1-like [Nelumbo nucifera]
Length=504

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  280  WSAVGRTAVTTTLAGCTAALTTLFGKRLISGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  339

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG NKLA   KYDDPLEAAQLHGGCG WGLIFTGLFA+  YV EVY  
Sbjct  340  AIVCGFVASWVLIGCNKLAEKFKYDDPLEAAQLHGGCGTWGLIFTGLFARDIYVQEVYQA  399

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAAQ+IQI+ I GWVSATMGPLFY+L+K+ LLRIS+EDE  G+D
Sbjct  400  -TWRPYGLFMGGGGKLLAAQIIQILTIVGWVSATMGPLFYVLNKMNLLRISAEDEMAGID  458

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAY YHDEDDQS    G+ M
Sbjct  459  ITRHGGFAYVYHDEDDQSQKQGGLMM  484



>ref|XP_009341599.1| PREDICTED: ammonium transporter 1 member 1-like [Pyrus x bretschneideri]
Length=505

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AIVCGFVAAIVLISCNKLAEKLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  407  KEGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHD+ D+ 
Sbjct  467  LTRHGGFAYVYHDDGDEQ  484



>ref|XP_008391280.1| PREDICTED: ammonium transporter 1 member 1 [Malus domestica]
Length=505

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AIVCGFVAAIVLISCNKLAEKLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  407  KEGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDD  590
            LTRHGGFAY YHD +D
Sbjct  467  LTRHGGFAYVYHDHED  482



>ref|XP_008367234.1| PREDICTED: ammonium transporter 1 member 1-like [Malus domestica]
Length=505

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AIVCGFVAAIVLISCNKLAEKLKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  407  KEGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDD  590
            LTRHGGFAY YHD +D
Sbjct  467  LTRHGGFAYVYHDHED  482



>emb|CDO99362.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  286  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVY--  356
            AI+CGFVAA VLIG N LA   K+DDPLEAAQLHGGCGAWG+IFT LFA + YVNEVY  
Sbjct  346  AIICGFVAALVLIGCNMLAEKVKFDDPLEAAQLHGGCGAWGVIFTALFAAEKYVNEVYPI  405

Query  357  PGLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHG  536
            PG   RPYGLFMGGGG+LLAA +IQ++VI GWVSATMGPLF++LHKLKLLRIS+EDET G
Sbjct  406  PGKSTRPYGLFMGGGGRLLAAHVIQVLVILGWVSATMGPLFFILHKLKLLRISAEDETAG  465

Query  537  MDLTRHGGFAYAYHDEDDQSSH  602
            MD+TRHGGFAY YHDE+D + +
Sbjct  466  MDMTRHGGFAYVYHDEEDSNKN  487



>emb|CDY18058.1| BnaA01g23190D [Brassica napus]
Length=332

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  124  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  183

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  184  AIVCGFVAALVLIGCNKLAEMVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  243

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ +QI+VI GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  244  TPGRPYGLFMGGGGKLLGAQFVQILVIAGWVSATMGTLFFILKKLDLLRISEKDEMAGMD  303

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+D DD+S
Sbjct  304  MTRHGGFAYMYYDNDDES  321



>emb|CAC10555.1| ammonium transporter (AMT1.1) [Lotus japonicus]
Length=502

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRIISGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  N LA   +YDDPLEAAQLHGGCGAWG+IFT LFAK+ YVN+VYPG
Sbjct  345  AIVCGFVAAVVLIACNMLAEKVRYDDPLEAAQLHGGCGAWGIIFTALFAKEEYVNQVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L+K+KLLRIS+EDE  GMD
Sbjct  405  KPGRPYGLFMGGGGKLLGAHVIQILVIIGWVSATMGPLFFILNKMKLLRISTEDELAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAY D++   SH PGI++
Sbjct  465  LTRHGGFAYAYEDDE---SHKPGIQL  487



>gb|AAG24944.1| putative ammonium transporter AMT1;1 [Lotus japonicus]
Length=501

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFGKRIISGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  N LA   +YDDPLEAAQLHGGCGAWG+IFT LFAK+ YVN+VYPG
Sbjct  344  AIVCGFVAAVVLIACNMLAEKVRYDDPLEAAQLHGGCGAWGIIFTALFAKEEYVNQVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L+K+KLLRIS+EDE  GMD
Sbjct  404  KPGRPYGLFMGGGGKLLGAHVIQILVIIGWVSATMGPLFFILNKMKLLRISTEDELAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAY D++   SH PGI++
Sbjct  464  LTRHGGFAYAYEDDE---SHKPGIQL  486



>ref|XP_011462429.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
1 [Fragaria vesca subsp. vesca]
Length=498

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  281  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  340

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+  NKLA   +YDDPLEAAQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  341  AIICGFVAAVVLVSCNKLAEKMRYDDPLEAAQLHGGCGAWGIIFTALFASEKYVNEVYPG  400

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++QI+VI GWVSATMGPLF++LHK+ LLRIS+EDE  GMD
Sbjct  401  KPGRPYGLFMGGGGRLLGAHVVQILVIIGWVSATMGPLFFILHKMNLLRISAEDEMAGMD  460

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY YHDEDD 
Sbjct  461  MTRHGGFAYVYHDEDDS  477



>gb|ABI52423.2| ammonium transporter [Citrus sinensis x Citrus trifoliata]
Length=502

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGG AAIT+GCSVVEPWA
Sbjct  286  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGLAAITAGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVC F AA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFAK+ +VNEVYPG
Sbjct  346  AIVCRFGAAVVLIACNKLAEKAKYDDPLEAAQLHGGCGAWGVIFTALFAKEKFVNEVYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA +IQI+V+ GWVSATMGPLF++LHKLKLLRIS EDE  GMD
Sbjct  406  KPGRPYGLFMGGGGKLLAAHVIQILVVAGWVSATMGPLFFVLHKLKLLRISPEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+DD  S+  GI++
Sbjct  466  LTRHGGFAYVYHDDDDVQSN--GIQL  489



>gb|AGG68787.1| putative high affinity ammonium transporter, partial [Populus 
simonii x (Populus nigra x Salix matsudana)]
Length=198

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  84   LLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLIGANKLAAVCKYDDP  263
            LL GHWNVIDVCNGLLGGFAAIT+GCSVVEPWAAI+CGFVAAWVLIG NKLA   +YDDP
Sbjct  1    LLSGHWNVIDVCNGLLGGFAAITAGCSVVEPWAAIICGFVAAWVLIGCNKLADKLQYDDP  60

Query  264  LEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPGLPDRPYGLFMGGGGKLLAAQMIQIVVI  443
            LEAAQLHGGCG WGL+FTGLFAK++YVNEVY   P RPYGLFMGGGGKLLAAQ+I+I+VI
Sbjct  61   LEAAQLHGGCGMWGLLFTGLFAKETYVNEVYSNKPGRPYGLFMGGGGKLLAAQIIEILVI  120

Query  444  FGWVSATMGPLFYMLHKLKLLRISSEDETHGMDLTRHGGFAYAYHDEDDQS  596
             GWVS TMGPLFY LHKLKLLRIS+EDE  GMDLTRHGGFAYAY  EDD S
Sbjct  121  VGWVSVTMGPLFYGLHKLKLLRISAEDEMAGMDLTRHGGFAYAYDAEDDVS  171



>ref|XP_010550782.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2 [Tarenaya hassleriana]
Length=523

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRL+VGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  300  WSAIGRTAVTTTLAGCTAALTTLFSKRLMVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  359

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF A+WVL G N +A   K+DDPLEAAQLHGGCGAWGL+FTGLFA K YVNEVY G
Sbjct  360  AIVCGFFASWVLTGCNFIAKKLKFDDPLEAAQLHGGCGAWGLLFTGLFATKKYVNEVYSG  419

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              +RPYGLFMGGGG+LLAAQ+IQI+VI GWVSATMGPLFY LHK+KLLRIS EDE  GMD
Sbjct  420  DGERPYGLFMGGGGRLLAAQVIQILVIAGWVSATMGPLFYGLHKIKLLRISPEDEMAGMD  479

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+DEDD S
Sbjct  480  MTRHGGFAYMYNDEDDVS  497



>ref|XP_011029719.1| PREDICTED: ammonium transporter 1 member 1-like [Populus euphratica]
 ref|XP_011029720.1| PREDICTED: ammonium transporter 1 member 1-like [Populus euphratica]
Length=504

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF  R+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFSNRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFVA+ VLIG NKLA + K+DDP+EAAQLHGGCG WG+IFT LFA + YV EVYP 
Sbjct  345  AVVCGFVASLVLIGCNKLAEIFKFDDPIEAAQLHGGCGTWGVIFTALFATEKYVGEVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAAQ+IQ++VI GWVSAT GPLF++LHKLKLLRIS+EDE  GMD
Sbjct  405  KPGRPYGLFMGGGGKLLAAQLIQVLVIIGWVSATTGPLFFVLHKLKLLRISAEDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+DD+S     I++
Sbjct  465  LTRHGGFAYIYHDDDDESQKPGTIQL  490



>ref|XP_002311703.1| ammonium transporter family protein [Populus trichocarpa]
 gb|EEE89070.1| ammonium transporter family protein [Populus trichocarpa]
Length=506

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 179/203 (88%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  286  WSAIGRTAVTTTLAGCTAALTTLFCKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + K+DDPLEAAQLHGGCG WG+IFT LFA + YV EVYP 
Sbjct  346  AIVCGFVASLVLIGCNKLAEIFKFDDPLEAAQLHGGCGTWGVIFTALFATEKYVGEVYPK  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG LLAA +IQ++VI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  406  KPGRPYGLFMGGGGNLLAAHLIQVLVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSSHYPG  611
            LTRHGGFAY YHD+DD+S   PG
Sbjct  466  LTRHGGFAYIYHDDDDESQR-PG  487



>gb|AHA42545.1| ammonium transporter 1.1 [Populus nigra x Populus x canadensis]
Length=498

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  282  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVA+ VLIG NKLA + K+DDPLEAAQLHGGCG WG+IFT LFA K YV EVYP 
Sbjct  342  AIICGFVASLVLIGCNKLAEILKFDDPLEAAQLHGGCGTWGVIFTALFATKKYVREVYPN  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLL A +IQIVVI GWVSATMGPLF++L KLKLLRISSEDE  GMD
Sbjct  402  KPNRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMGPLFFVLRKLKLLRISSEDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY YHD++  
Sbjct  462  MTRHGGFAYIYHDDESN  478



>ref|XP_011041472.1| PREDICTED: ammonium transporter 1 member 1 [Populus euphratica]
 ref|XP_011041473.1| PREDICTED: ammonium transporter 1 member 1 [Populus euphratica]
Length=501

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF A+ VLIG NKLA + K+DDPLEAAQLHGGCG WG+IFT LFA K YV EVYP 
Sbjct  345  AIICGFFASLVLIGCNKLAEILKFDDPLEAAQLHGGCGTWGVIFTALFATKKYVREVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L KLKLLRISSEDE  GMD
Sbjct  405  KPNRPYGLFMGGGGKLLGAHLIQILVIIGWVSATMGPLFFVLRKLKLLRISSEDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
            +TRHGGFAY YHD+D      P
Sbjct  465  MTRHGGFAYIYHDDDSNKHGIP  486



>ref|XP_004147178.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis sativus]
 ref|XP_004166752.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis sativus]
 gb|KGN61536.1| Ammonium transporter [Cucumis sativus]
Length=500

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA K YVNEVY G
Sbjct  344  AVICGFVAAVVLISCNKLAEKVKFDDPLEAAQLHGGCGAWGIIFTALFASKKYVNEVYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGGKLL A +IQI+VI GWVSATMGPLFY LHKLKLLRISSEDE  GMD
Sbjct  404  DAGRPHGLFMGGGGKLLGAHLIQILVIIGWVSATMGPLFYGLHKLKLLRISSEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            +TRHGGFAY YHDED+  ++
Sbjct  464  MTRHGGFAYVYHDEDESPTN  483



>ref|XP_002522012.1| ammonium transporter, putative [Ricinus communis]
 gb|EEF40416.1| ammonium transporter, putative [Ricinus communis]
Length=510

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLF KRLLVGHWNV+DVCNGLLGGFAAITSGC+VVEPWA
Sbjct  285  WSAVGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVLDVCNGLLGGFAAITSGCAVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVA+WVLIG NKLA   KYDDPLEAAQLHGGCGAWGL+FTGLFA K+YVNEVYP 
Sbjct  345  AIICGFVASWVLIGCNKLAEKFKYDDPLEAAQLHGGCGAWGLLFTGLFAAKNYVNEVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYG+FMGGGGKLLAAQ+IQI+VI GWV+ATM PLFY L+KL+LLRISS DET GMD
Sbjct  405  KPGRPYGVFMGGGGKLLAAQIIQIIVIAGWVTATMAPLFYGLNKLRLLRISSADETAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHDEDD S   P I M
Sbjct  465  LTRHGGFAYAYHDEDDPSLK-PSIMM  489



>ref|XP_003536150.1| PREDICTED: ammonium transporter 1 member 2-like [Glycine max]
Length=505

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 180/206 (87%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  283  WSAIGRTAVTTTLAGSTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLAA  +YDDPLEAAQLHGGCGAWG+ FTGLFAKK YV E+Y G
Sbjct  343  AIVCGFVAAWVLIGLNKLAAKVEYDDPLEAAQLHGGCGAWGVFFTGLFAKKEYVEEIYGG  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+G  MGGGG+LLAAQ+IQI+V+ GWV+ATM PLFY LHK+KLLRIS +DET GMD
Sbjct  403  --GRPFGALMGGGGRLLAAQVIQILVVCGWVTATMAPLFYGLHKMKLLRISRDDETAGMD  460

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHD++D SS   G  +
Sbjct  461  LTRHGGFAYAYHDDEDGSSRGVGFML  486



>gb|KDO65757.1| hypothetical protein CISIN_1g040022mg [Citrus sinensis]
Length=490

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA+TTTLAGC+AALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAITTTLAGCSAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAW+LIG NKLA   KYDDPLEAAQLHGGCGAWG+IFTGLFAK+SYVNEVYPG
Sbjct  345  AIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTGLFAKESYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA ++QI+VI GWVS TMG LF++L+KLKLLRIS+++E  GMD
Sbjct  405  KPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LT HGG AYAYHD+ D + 
Sbjct  465  LTSHGGLAYAYHDDLDSTQ  483



>ref|XP_006443698.1| hypothetical protein CICLE_v10023800mg [Citrus clementina]
 ref|XP_006479408.1| PREDICTED: ammonium transporter 1 member 4-like [Citrus sinensis]
 gb|ESR56938.1| hypothetical protein CICLE_v10023800mg [Citrus clementina]
Length=490

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA+TTTLAGC+AALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAITTTLAGCSAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAW+LIG NKLA   KYDDPLEAAQLHGGCGAWG+IFTGLFAK+SYVNEVYPG
Sbjct  345  AIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTGLFAKESYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA ++QI+VI GWVS TMG LF++L+KLKLLRIS+++E  GMD
Sbjct  405  KPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LT HGG AYAYHD+ D + 
Sbjct  465  LTSHGGLAYAYHDDLDSTQ  483



>ref|XP_010103468.1| Ammonium transporter 1 member 1 [Morus notabilis]
 gb|EXB95961.1| Ammonium transporter 1 member 1 [Morus notabilis]
Length=505

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 178/207 (86%), Gaps = 3/207 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVA+ VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA K YVNEVYP 
Sbjct  347  AIICGFVASVVLITCNKLAEKAKFDDPLEAAQLHGGCGAWGIIFTALFATKKYVNEVYPT  406

Query  363  LP-DRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGM  539
                RPYGLFMGGGGKLLAA +IQIVVIF WVS TMGPLFY+LH+LKLLRIS EDE  GM
Sbjct  407  EKGHRPYGLFMGGGGKLLAAHLIQIVVIFAWVSVTMGPLFYILHRLKLLRISPEDEMAGM  466

Query  540  DLTRHGGFAYAYHDEDDQSSHYPGIKM  620
            DLTRHGGFAY YHDED+  S  PG  +
Sbjct  467  DLTRHGGFAYIYHDEDE--SQKPGFPL  491



>ref|XP_010102194.1| Ammonium transporter 1 member 2 [Morus notabilis]
 gb|EXB93137.1| Ammonium transporter 1 member 2 [Morus notabilis]
Length=516

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 178/195 (91%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  286  WSGVGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLI +NKLA + KYDDPLEAAQLHGGCGAWGL+FTGLFA K YV EVY G
Sbjct  346  AIVCGFVAAWVLITSNKLAELVKYDDPLEAAQLHGGCGAWGLLFTGLFATKEYVGEVYGG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGG+L+AAQ++QI+V+ GWV+ATMGPLFY L+KL+LLRIS +DE  G+D
Sbjct  406  -DDRPYGLFMGGGGRLVAAQVVQILVVAGWVTATMGPLFYGLNKLRLLRISKDDEMAGLD  464

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  465  LTRHGGFAYLYHDED  479



>ref|XP_002314518.2| ammonium transporter family protein [Populus trichocarpa]
 gb|EEF00689.2| ammonium transporter family protein [Populus trichocarpa]
Length=501

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVA+ VLIG NKLA + K+DDPLEAAQLHGGCG WG+IFT LFA + YV EVYP 
Sbjct  345  AIICGFVASLVLIGCNKLAEILKFDDPLEAAQLHGGCGTWGVIFTALFATEKYVREVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L KLKLLRISSEDE  GMD
Sbjct  405  KPNRPYGLFMGGGGKLLGAHLIQILVIIGWVSATMGPLFFVLRKLKLLRISSEDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY YHD++  
Sbjct  465  MTRHGGFAYIYHDDESN  481



>ref|XP_010920277.1| PREDICTED: ammonium transporter 1 member 2-like [Elaeis guineensis]
Length=510

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCT ALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  288  WSAVGRTAVTTTLAGCTGALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVLIG NKLAA  K+DDPLEA QLHGGCGAWG+IFTGLFA++ YVNEVY G
Sbjct  348  AVICGFVAAWVLIGLNKLAAKVKFDDPLEATQLHGGCGAWGIIFTGLFAREKYVNEVYSG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL AQ++QI+VI GWVS TMGPLFY LH++ LLRIS+EDE  GMD
Sbjct  408  RPGRPYGLFMGGGGRLLGAQVVQILVIAGWVSCTMGPLFYALHRMGLLRISAEDEMAGMD  467

Query  543  LTRHGGFAYAYHDE  584
            LTRHGGFAY Y DE
Sbjct  468  LTRHGGFAYVYQDE  481



>ref|XP_010527181.1| PREDICTED: ammonium transporter 1 member 1-like [Tarenaya hassleriana]
Length=502

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIFT LFA + YV EVYPG
Sbjct  344  AIICGFVAALVLIGCNKLAEMLKYDDPLEAAQLHGGCGAWGLIFTALFATEKYVEEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL AQ+IQI+VI GWVSATMG LFY+L KL LLRIS+EDE  GMD
Sbjct  404  KPGRPYGLFMGGGGRLLGAQVIQILVIVGWVSATMGTLFYVLRKLGLLRISAEDEMQGMD  463

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAY Y D D   S
Sbjct  464  MTRHGGFAYMYSDHDGDVS  482



>ref|XP_011015290.1| PREDICTED: ammonium transporter 1 member 1-like [Populus euphratica]
Length=504

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFCKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFVA+ VLIG NKLA + K+DDP+EAAQLHGGCG WG+IFT LFA + YV EVYP 
Sbjct  345  AVVCGFVASLVLIGCNKLAEIFKFDDPIEAAQLHGGCGTWGVIFTALFATEKYVGEVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAAQ+IQ++VI GWVSAT GPLF++LHKLKLLRIS+EDE  G+D
Sbjct  405  KPGRPYGLFMGGGGKLLAAQLIQVLVIIGWVSATTGPLFFVLHKLKLLRISAEDEMAGLD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LT+HGGFAY YHD+DD+S     I++
Sbjct  465  LTQHGGFAYIYHDDDDESQKPGTIQL  490



>ref|XP_010674578.1| PREDICTED: uncharacterized protein LOC104890698 [Beta vulgaris 
subsp. vulgaris]
Length=1012

 Score =   312 bits (800),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAV RTAVTTTLAG TAALTTLFGKR+LVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  792  WSAVARTAVTTTLAGSTAALTTLFGKRMLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  851

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG NKLA   KYDDPLEAAQLHGGCGAWGLIFTGLFA K +V EVYP 
Sbjct  852  AIICGFVSAWVLIGFNKLAEKVKYDDPLEAAQLHGGCGAWGLIFTGLFASKKFVQEVYPL  911

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ++QI+VIFGWV+A M PLF  L  L LLRISS+DE  GMD
Sbjct  912  DTQRPYGLFMGGGGRLLAAQVVQILVIFGWVTALMVPLFLTLKSLGLLRISSKDEMEGMD  971

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
            +T+HGGFAY YHDEDDQS + P
Sbjct  972  VTKHGGFAYLYHDEDDQSHNSP  993



>ref|XP_007143995.1| hypothetical protein PHAVU_007G120200g [Phaseolus vulgaris]
 gb|ESW15989.1| hypothetical protein PHAVU_007G120200g [Phaseolus vulgaris]
Length=510

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 182/206 (88%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  279  WSAIGRTAVTTTLAGSTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLI  NKLAA  +YDDPLEAAQLHGGCGAWG++FTGLFAK+ YV E+Y G
Sbjct  339  AIVCGFVAAWVLIALNKLAAKVEYDDPLEAAQLHGGCGAWGVLFTGLFAKREYVEEIY-G  397

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +  RP+G  M GGGKLLAAQ+I+IVV+ GWV+ATMGPLFY LHK+ LLRIS +DET GMD
Sbjct  398  I-GRPFGALMNGGGKLLAAQLIEIVVVCGWVTATMGPLFYGLHKMNLLRISRDDETAGMD  456

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHD++D SS   G+ M
Sbjct  457  LTRHGGFAYAYHDDEDGSSRGVGLMM  482



>ref|XP_008785143.1| PREDICTED: ammonium transporter 1 member 2-like [Phoenix dactylifera]
Length=515

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  287  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAW+LIG NKLAA  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  347  AVICGFVAAWLLIGLNKLAAKVKFDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++QI+VI GWVS TMGPLFY LH++ LLRIS EDE  GMD
Sbjct  407  RPGRPYGLFMGGGGRLLGAHIVQILVIAGWVSCTMGPLFYALHRIGLLRISPEDEMAGMD  466

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY Y  ED  S
Sbjct  467  LTRHGGFAYVYDAEDSGS  484



>gb|AFO66662.1| AMT1;3 [Citrus trifoliata]
Length=490

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA+TTTLAGC AALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAITTTLAGCAAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAW+LIG NKLA   KYDDPLEAAQLHGGCG WG+IFTGLFAK+SYVNEVYPG
Sbjct  345  AIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGVWGVIFTGLFAKESYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLLAA ++QI+VI GWVS TMG LF++L+KLKLLRIS+++E  GMD
Sbjct  405  KPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LT HGG AYAYHD+ D + 
Sbjct  465  LTSHGGLAYAYHDDLDSTQ  483



>ref|XP_011091369.1| PREDICTED: ammonium transporter 1 member 1-like [Sesamum indicum]
Length=498

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 178/206 (86%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLIG NKLA   K+DDPLEAAQLHGGCG WG+IFT LFA + YVNEVYPG
Sbjct  345  AVICGFVAALVLIGCNKLAEKVKFDDPLEAAQLHGGCGTWGVIFTALFATEKYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAA +IQI+VI GWV+ATMGPLFY LHKL LLRIS +DE  GMD
Sbjct  405  KPGRPYGLFMGGGGRLLAAHIIQILVIIGWVTATMGPLFYALHKLNLLRISEDDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y D+    +H  G++M
Sbjct  465  LTRHGGFAYVYEDD----AHKNGLQM  486



>sp|P58905.1|AMT11_SOLLC RecName: Full=Ammonium transporter 1 member 1; AltName: Full=LeAMT1;1 
[Solanum lycopersicum]
Length=488

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG N LA   KYDDPLEAAQLHGGCGAWG+IFTGLFAK  +V++VYPG
Sbjct  339  AIICGFVAALVLIGFNMLAEKFKYDDPLEAAQLHGGCGAWGIIFTGLFAKGEFVDQVYPG  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL A +IQI+VI GWVSATMGPLFY+LHK KLLRISSEDE  GMD
Sbjct  399  KPGRPHGLFMGGGGKLLGAHIIQILVIIGWVSATMGPLFYILHKFKLLRISSEDEMAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YH+ED +
Sbjct  459  LTRHGGFAY-YHEEDPK  474



>ref|XP_004247774.1| PREDICTED: ammonium transporter 1 member 1 [Solanum lycopersicum]
Length=490

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  281  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  340

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG N LA   KYDDPLEAAQLHGGCGAWG+IFTGLFAK  +V++VYPG
Sbjct  341  AIICGFVAALVLIGFNMLAEKFKYDDPLEAAQLHGGCGAWGIIFTGLFAKGEFVDQVYPG  400

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL A +IQI+VI GWVSATMGPLFY+LHK KLLRISSEDE  GMD
Sbjct  401  KPGRPHGLFMGGGGKLLGAHIIQILVIIGWVSATMGPLFYILHKFKLLRISSEDEMAGMD  460

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YH+ED +
Sbjct  461  LTRHGGFAY-YHEEDPK  476



>ref|XP_006851356.1| hypothetical protein AMTR_s00050p00217870 [Amborella trichopoda]
 gb|ERN12937.1| hypothetical protein AMTR_s00050p00217870 [Amborella trichopoda]
Length=291

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+LVGHWNV+DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  72   WSAVGRTAVTTTLAGCTAALTTLFGKRILVGHWNVLDVCNGLLGGFAAITSGCSVVDPWA  131

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLI  NKLA   K DDPLEAAQLHGGCGAWG+IFT LFA+++YV++VY G
Sbjct  132  AIICGFVAAIVLISCNKLAEKLKLDDPLEAAQLHGGCGAWGIIFTALFARETYVSQVYGG  191

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGG+LL A ++ I+ I GWVSATMGPLF+ LHKL LLRIS+EDE  GMD
Sbjct  192  NSDRPYGLFMGGGGRLLGAHLVLILAIIGWVSATMGPLFFGLHKLGLLRISAEDEMAGMD  251

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY YHDED  S
Sbjct  252  LTRHGGFAYVYHDEDSHS  269



>emb|CAN76352.1| hypothetical protein VITISV_044207 [Vitis vinifera]
Length=502

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  282  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVY-P  359
            AI+CGFVAA VLI  NKLA   K+DDPLEA QLHGGCGAWG+IFT LFA K YV++VY  
Sbjct  342  AIICGFVAAVVLISCNKLAEKVKFDDPLEATQLHGGCGAWGIIFTALFATKDYVSQVYNS  401

Query  360  GLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGM  539
            G P RPYGLFMGGGG+LLAA +IQI+VI GWVSATMG LF++LHKLKLLRIS+EDE  GM
Sbjct  402  GQPGRPYGLFMGGGGRLLAAHIIQILVITGWVSATMGTLFFILHKLKLLRISAEDEMAGM  461

Query  540  DLTRHGGFAYAYHDEDDQSSH  602
            DLTRHGGFAY YH++DD + H
Sbjct  462  DLTRHGGFAYMYHEDDDSNKH  482



>ref|XP_002885634.1| hypothetical protein ARALYDRAFT_899005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61893.1| hypothetical protein ARALYDRAFT_899005 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  
Sbjct  342  AIVCGFMASLVLIGCNKLAELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGGKLL AQ++QI+VI GWVSATMG LF+ML KL LLRIS+EDE  GMD
Sbjct  402  SPGRHYGLFMGGGGKLLGAQLVQIIVIVGWVSATMGTLFFMLKKLNLLRISNEDEMQGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPG  611
            + RHGGFAY YHD DD S   PG
Sbjct  462  IARHGGFAYIYHDNDDDSIRVPG  484



>ref|XP_003590177.1| Ammonium transporter 1 member [Medicago truncatula]
 gb|AES60428.1| ammonium transporter 1 protein [Medicago truncatula]
Length=503

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AA VLI  NKLA   +YDDPLEAAQLHGGCGAWG+IFT LFAK+ YVN+VYPG
Sbjct  344  AIVCGFIAAVVLIACNKLAEKMRYDDPLEAAQLHGGCGAWGIIFTALFAKEEYVNQVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L+KLKLLRIS+EDE  GMD
Sbjct  404  KLGRPYGLFMGGGGKLLGAHVIQILVIIGWVSATMGPLFFVLNKLKLLRISTEDELAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAY DE    SH  G ++
Sbjct  464  LTRHGGFAYAYEDE---GSHRNGTQL  486



>ref|XP_003536149.1| PREDICTED: ammonium transporter 1 member 2-like [Glycine max]
Length=505

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 179/206 (87%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  283  WSAIGRTAVTTTLAGSTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLAA  +YDDPLEAAQLHGGCGAWG+ FTGLFAKK YV E+Y  
Sbjct  343  AIVCGFVAAWVLIGLNKLAAKVEYDDPLEAAQLHGGCGAWGVFFTGLFAKKVYVEEIYG-  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+G  MGGGG+LLAAQ+IQI+V+ GWV+ATM PLFY LHK+KLLRIS +DET GMD
Sbjct  402  -VGRPFGALMGGGGRLLAAQVIQILVVCGWVTATMAPLFYGLHKMKLLRISRDDETAGMD  460

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHD++D SS   G  +
Sbjct  461  LTRHGGFAYAYHDDEDGSSRGVGFML  486



>ref|XP_006340957.1| PREDICTED: ammonium transporter 1 member 1-like, partial [Solanum 
tuberosum]
Length=486

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  277  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  336

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG N LA   KYDDPLEAAQLHGGCGAWG+IFT LFAK  +V++VYPG
Sbjct  337  AIICGFVAALVLIGCNMLAEKFKYDDPLEAAQLHGGCGAWGIIFTALFAKGEFVDQVYPG  396

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P RP+GLFMGGGGKLL A +IQI+VI GWVSATMGPLFY+LH+ KLLRISSEDE  GMD
Sbjct  397  IPGRPHGLFMGGGGKLLGAHVIQILVIIGWVSATMGPLFYILHRFKLLRISSEDEMAGMD  456

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YH+ED +
Sbjct  457  LTRHGGFAY-YHEEDSK  472



>ref|XP_002518202.1| ammonium transporter, putative [Ricinus communis]
 gb|EEF44335.1| ammonium transporter, putative [Ricinus communis]
Length=502

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 183/206 (89%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AA VLIG NKLA + K+DDPLEAAQLHGGCG WG+IFT LFA+K YV++VY  
Sbjct  345  AIICGFIAALVLIGCNKLAEIFKFDDPLEAAQLHGGCGTWGVIFTALFARKKYVDQVYG-  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  404  -VGRPYGLFMGGGGKLLAAHVIQILVITGWVSATMGPLFFILHKLKLLRISAEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+D+  SH  GI++
Sbjct  463  LTRHGGFAYIYHDDDE--SHKHGIQL  486



>ref|XP_002285558.1| PREDICTED: ammonium transporter 1 member 1 [Vitis vinifera]
Length=502

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  282  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVY-P  359
            AI+CGFVAA VLI  NKLA   K+DDPLEA QLHGGCGAWG+IFT LFA K YV++VY  
Sbjct  342  AIICGFVAAVVLISCNKLAEKVKFDDPLEATQLHGGCGAWGIIFTALFATKDYVSQVYNS  401

Query  360  GLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGM  539
            G P RPYGLFMGGGG+LLAA +IQI+VI GWVSATMG LF++LHKLKLLRIS+EDE  GM
Sbjct  402  GQPGRPYGLFMGGGGRLLAAHIIQILVITGWVSATMGTLFFILHKLKLLRISAEDEMAGM  461

Query  540  DLTRHGGFAYAYHDEDDQSSH  602
            DLTRHGGFAY YH++DD + H
Sbjct  462  DLTRHGGFAYMYHEDDDSNKH  482



>ref|XP_008460720.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis melo]
Length=500

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA K YVNEVY G
Sbjct  344  AVICGFVAAIVLISCNKLAEKVKFDDPLEAAQLHGGCGAWGIIFTALFATKKYVNEVYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGGKLL A +IQI+VI GWVS TMGPLFY LHKLKLLRIS EDE  GMD
Sbjct  404  DAGRPHGLFMGGGGKLLGAHLIQILVIIGWVSVTMGPLFYGLHKLKLLRISPEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            +TRHGGFAY YHDED+  ++
Sbjct  464  MTRHGGFAYVYHDEDESPTN  483



>ref|XP_011038587.1| PREDICTED: uncharacterized protein LOC105135422 [Populus euphratica]
Length=1148

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3     WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
             WSAVGRTAVTTTLAGCTAALTTLFGKRLLVGHWNV+DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  923   WSAVGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVLDVCNGLLGGFAAITAGCSVVEPWA  982

Query  183   AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
             AI+CGFVA+WVLI  NKLA   KYDDPLEAAQLHGGCG WGL+FTGLFAK+++VNEVYP 
Sbjct  983   AIICGFVASWVLIVCNKLAEKLKYDDPLEAAQLHGGCGTWGLLFTGLFAKEAFVNEVYPN  1042

Query  363   LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
                RPYGL MGGG KLLAAQ+IQI+VI GWV+ TMGPLFY L KL LLRISSEDE  GMD
Sbjct  1043  KAGRPYGLLMGGGRKLLAAQIIQILVISGWVTMTMGPLFYGLKKLNLLRISSEDEMAGMD  1102

Query  543   LTRHGGFAYAYHDEDDQS  596
             LTRHGGFAY YHD+DDQS
Sbjct  1103  LTRHGGFAYIYHDDDDQS  1120



>ref|XP_002875166.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51425.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA+K Y+N+VY  
Sbjct  339  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAEKKYLNQVYGD  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ+IQI+VI GWVS TMG LF++L K+KLLRISSEDE  GMD
Sbjct  399  RPGRPYGLFMGGGGKLLGAQLIQIIVITGWVSVTMGTLFFILKKMKLLRISSEDEMAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY YHD+D+ 
Sbjct  459  MTRHGGFAYMYHDDDES  475



>ref|XP_010263964.1| PREDICTED: ammonium transporter 1 member 1-like [Nelumbo nucifera]
Length=505

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 176/202 (87%), Gaps = 4/202 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA+TTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAIGRTAITTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N+LA   KYDDPLEAAQLHGGCGAWG+IFT LFA+K+YV EVY  
Sbjct  344  AIICGFVAAWVLIGCNRLADKYKYDDPLEAAQLHGGCGAWGIIFTALFARKAYVEEVYAA  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG LLAA +IQI+VI GWVSATMGPLFY LH+L LLRIS EDE  GMD
Sbjct  404  --GRPYGLFMGGGGTLLAAHIIQILVIIGWVSATMGPLFYALHRLNLLRISGEDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
            +TRHGGFAY YHD+D  SS  P
Sbjct  462  MTRHGGFAYVYHDDD--SSQKP  481



>ref|XP_010466830.1| PREDICTED: ammonium transporter 1 member 3 [Camelina sativa]
Length=498

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASLVLIGCNKLAELLRYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVVIGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>gb|EYU32608.1| hypothetical protein MIMGU_mgv1a024059mg [Erythranthe guttata]
Length=488

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 174/200 (87%), Gaps = 2/200 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLF KR++ GHW V DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFTKRVISGHWVVTDVCNGLLGGFAAITSGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLIG NKLA   KYDDPLEAAQLHGGCGAWG+IFTGLFA K YVNEVYPG
Sbjct  344  AVICGFVAALVLIGCNKLAQKVKYDDPLEAAQLHGGCGAWGIIFTGLFATKKYVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGG  LLAA +IQIVVI GWVS TMGPLFY+LHKL LLRIS +DE  GMD
Sbjct  404  QPGRPYGLFMGGGYGLLAAHIIQIVVIIGWVSLTMGPLFYILHKLNLLRISPDDELSGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGGFAYAY  EDD  +H
Sbjct  464  LTRHGGFAYAY--EDDPQNH  481



>ref|XP_010488522.1| PREDICTED: ammonium transporter 1 member 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010488524.1| PREDICTED: ammonium transporter 1 member 3-like isoform X2 [Camelina 
sativa]
 ref|XP_010488525.1| PREDICTED: ammonium transporter 1 member 3-like isoform X3 [Camelina 
sativa]
Length=498

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASLVLIGCNKLADLVRYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVVIGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>ref|XP_009106012.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
3-like [Brassica rapa]
Length=509

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  
Sbjct  343  AIVCGFVAALVLIGCNKLAEMVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ +QI+VI GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  APGRPYGLFMGGGGKLLGAQFVQILVIAGWVSATMGTLFFILKKLDLLRISEKDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+D DD+S
Sbjct  463  MTRHGGFAYMYYDNDDES  480



>emb|CDY67718.1| BnaUnng02430D [Brassica napus]
Length=493

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  285  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLIG N+LA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  
Sbjct  345  AIVCGFVAALVLIGCNRLAEMVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGA  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ +QI+VI GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  405  TPGRPYGLFMGGGGKLLGAQFVQILVIAGWVSATMGTLFFILKKLDLLRISEKDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+D DD+S
Sbjct  465  MTRHGGFAYMYYDNDDES  482



>ref|XP_006589215.1| PREDICTED: ammonium transporter 1 member 2-like [Glycine max]
Length=525

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 179/206 (87%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  304  WSAIGRTAVTTTLAGSTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  363

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLI  NKLAA  +YDDPLEAAQLHGGCGAWG+ FTGLFAKK YV E+Y  
Sbjct  364  AIVCGFVAAWVLIWLNKLAAKVEYDDPLEAAQLHGGCGAWGVFFTGLFAKKVYVEEIYG-  422

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+G  MGGGG+LLAAQ+IQI+V+ GWV+ATM PLFY LHK+KLLRIS +DET GMD
Sbjct  423  -VGRPFGALMGGGGRLLAAQVIQILVVCGWVTATMAPLFYGLHKMKLLRISRDDETAGMD  481

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAYHD++D SS   G  M
Sbjct  482  LTRHGGFAYAYHDDEDGSSRGVGFMM  507



>ref|XP_009389982.1| PREDICTED: ammonium transporter 1 member 2 [Musa acuminata subsp. 
malaccensis]
Length=499

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGC AALTTLFGKRL  GHWNV+DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  273  WSAVGRTAVTTTLAGCAAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITSGCAVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG N LAA  KYDDPLEAAQLH GCGAWG++FT LFAK+ YVNE YPG
Sbjct  333  AIVCGFVSAWVLIGLNTLAAKLKYDDPLEAAQLHAGCGAWGILFTALFAKEKYVNEAYPG  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A +I I+V  GWVS TMGPLF++LHKL LLRIS EDE  GMD
Sbjct  393  RPGRPYGLFMGGGGRLLGAHIIAILVNIGWVSCTMGPLFFILHKLGLLRISREDELKGMD  452

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YH+ED
Sbjct  453  LTRHGGFAYVYHNED  467



>ref|XP_010488526.1| PREDICTED: ammonium transporter 1 member 3-like isoform X4 [Camelina 
sativa]
Length=512

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  297  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  356

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  357  AIVCGFMASLVLIGCNKLADLVRYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  416

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  417  TPGRPYGLFMGGGGKLLGAQLVQILVVIGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  476

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  477  MTRHGGFAYIYHDNDDES  494



>ref|XP_010023793.1| PREDICTED: ammonium transporter 1 member 1-like [Eucalyptus grandis]
 gb|KCW60162.1| hypothetical protein EUGRSUZ_H02886 [Eucalyptus grandis]
Length=484

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  271  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  330

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLI  NK+A   +YDDPLEAAQLHGGCGAWG+IFT LFA K YV ++Y  
Sbjct  331  AIICGFVAALVLISCNKIAEKVRYDDPLEAAQLHGGCGAWGVIFTALFADKEYVAQIYGA  390

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGGKLLAA +IQI+VI GWVSATMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  391  --DRPYGLFMGGGGKLLAAHVIQILVIIGWVSATMGPLFFVLHKLKLLRISAEDEMAGMD  448

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+D+   +  GI++
Sbjct  449  LTRHGGFAYVYHDDDESPKN--GIQL  472



>gb|AGK25010.1| ammonium transporter [Sorghum bicolor]
Length=496

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 172/195 (88%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  273  WSAVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVEPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFV+AWVLIGAN LAA  K+DDPLEAAQLHGGCGAWG++FTGLFA + YV E+Y  
Sbjct  333  AVVCGFVSAWVLIGANALAARLKFDDPLEAAQLHGGCGAWGVLFTGLFASQKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAAQ+IQI+VI GWVS TMGPLFY L KL LLRIS++DE  GMD
Sbjct  392  -SGRPYGLFMGGGGKLLAAQIIQILVIAGWVSCTMGPLFYALKKLDLLRISADDEMSGMD  450

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  451  LTRHGGFAYVYHDED  465



>ref|XP_006296802.1| hypothetical protein CARUB_v10016472mg [Capsella rubella]
 gb|EOA29700.1| hypothetical protein CARUB_v10016472mg [Capsella rubella]
Length=498

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASLVLIGCNKLAELLQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVVIGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD +D+S
Sbjct  463  MTRHGGFAYIYHDNEDES  480



>ref|XP_004497799.1| PREDICTED: ammonium transporter 1 member 1-like [Cicer arietinum]
Length=502

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+A VLI  NKLA   ++DDPLEAAQLHGGCGAWG+IFT LFAK+ YVN+VY G
Sbjct  344  AIVCGFVSAIVLISCNKLAEKVRFDDPLEAAQLHGGCGAWGIIFTALFAKEEYVNQVYSG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL A +IQI+VI GWVSATMGPLF++L+K+KLLRIS EDE  GMD
Sbjct  404  KPGRPYGLFMGGGGKLLGAHVIQILVIIGWVSATMGPLFFILNKMKLLRISPEDELAGMD  463

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAYAY DE+  +
Sbjct  464  MTRHGGFAYAYEDEEHTN  481



>ref|XP_002885635.1| ATAMT1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61894.1| ATAMT1_3 [Arabidopsis lyrata subsp. lyrata]
Length=499

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAV TTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVNTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGL+F GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASLVLIGCNKLAELVQYDDPLEAAQLHGGCGAWGLVFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVIAGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQSSHYPG  611
            +TRHGGFAY YHD +D  S+  G
Sbjct  463  MTRHGGFAYIYHDNNDDDSNRVG  485



>ref|XP_008441800.1| PREDICTED: ammonium transporter 1 member 2-like [Cucumis melo]
Length=511

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFTKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLI  NKLA    YDDPLEAAQLHGGCGAWGLIFTGLFA+K YV EVY  
Sbjct  346  AVICGFVASWVLISFNKLAEKVNYDDPLEAAQLHGGCGAWGLIFTGLFARKEYVAEVYQA  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAAQ+I+I+ I GWVS TMG LFY L K+KLLRIS EDE  GMD
Sbjct  406  --GRPYGLFMGGGGRLLAAQLIEILAIIGWVSVTMGGLFYALKKVKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DEDD S    G  M
Sbjct  464  LTRHGGFAYVYNDEDDPSGKPSGFMM  489



>ref|XP_006414895.1| hypothetical protein EUTSA_v10024967mg [Eutrema salsugineum]
 gb|ESQ56348.1| hypothetical protein EUTSA_v10024967mg [Eutrema salsugineum]
Length=504

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   +YDDPLEAAQLHGGCGAWGLIFTGLFAK+ Y+N++Y  
Sbjct  344  AIICGFVAALVLLGCNKLAEKLRYDDPLEAAQLHGGCGAWGLIFTGLFAKEKYLNQIYGA  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQMIQI+VI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  404  KPGRPHGLFMGGGGKLLGAQMIQILVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  464  MTRHGGFAYMYFDDDES  480



>ref|XP_002446777.1| hypothetical protein SORBIDRAFT_06g022230 [Sorghum bicolor]
 gb|EES11105.1| hypothetical protein SORBIDRAFT_06g022230 [Sorghum bicolor]
Length=533

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 172/195 (88%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  273  WSAVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVEPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFV+AWVLIGAN LAA  K+DDPLEAAQLHGGCGAWG++FTGLFA + YV E+Y  
Sbjct  333  AVVCGFVSAWVLIGANALAARLKFDDPLEAAQLHGGCGAWGVLFTGLFASQKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAAQ+IQI+VI GWVS TMGPLFY L KL LLRIS++DE  GMD
Sbjct  392  -SGRPYGLFMGGGGKLLAAQIIQILVIAGWVSCTMGPLFYALKKLDLLRISADDEMSGMD  450

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  451  LTRHGGFAYVYHDED  465



>ref|XP_010440571.1| PREDICTED: ammonium transporter 1 member 1 [Camelina sativa]
Length=505

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLLAAQ+IQI+VI GWVSATMG LF++L K+KLLRISSEDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLAAQLIQILVITGWVSATMGTLFFILKKMKLLRISSEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  463  MTRHGGFAYMYFDDDES  479



>ref|XP_010435254.1| PREDICTED: ammonium transporter 1 member 1-like [Camelina sativa]
Length=505

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLLAAQ+IQI+VI GWVSATMG LF++L K+KLLRISSEDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLAAQLIQILVITGWVSATMGTLFFILKKMKLLRISSEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  463  MTRHGGFAYMYFDDDES  479



>ref|NP_001140828.1| uncharacterized protein LOC100272903 [Zea mays]
 gb|ACF84745.1| unknown [Zea mays]
 gb|AFW58821.1| hypothetical protein ZEAMMB73_636934 [Zea mays]
Length=498

 Score =   294 bits (753),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 173/195 (89%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  273  WSAVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVEPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIGAN LAA  ++DDPLEAAQLHGGCGAWG++FTGLFA++ YV E+Y  
Sbjct  333  AVICGFVSAWVLIGANALAARFRFDDPLEAAQLHGGCGAWGVLFTGLFARRKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAAQ+IQI+VI GWVS TMGPLFY L KL LLRIS++DE  GMD
Sbjct  392  -AGRPYGLFMGGGGKLLAAQIIQILVIAGWVSCTMGPLFYALKKLGLLRISADDEMSGMD  450

Query  543  LTRHGGFAYAYHDED  587
            LTRHGGFAY YHDED
Sbjct  451  LTRHGGFAYVYHDED  465



>emb|CAH67993.1| OSIGBa0157K09-H0214G12.4 [Oryza sativa Indica Group]
Length=498

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 171/197 (87%), Gaps = 2/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLA   AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAASVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y  
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VIFGWVS TMGPLFY L KL LLRIS+EDET GMD
Sbjct  392  -AGRPYGLFMGGGGKLLAAHVIQILVIFGWVSCTMGPLFYGLKKLGLLRISAEDETSGMD  450

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHDED+ 
Sbjct  451  LTRHGGFAYVYHDEDEH  467



>gb|EYU43783.1| hypothetical protein MIMGU_mgv1a026927mg [Erythranthe guttata]
Length=499

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 178/206 (86%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFVAA VLIG N++A   K+DDPLEAAQLHGGCGAWG++FT LFA + YVNEVYPG
Sbjct  345  AVVCGFVAALVLIGCNRVAERVKFDDPLEAAQLHGGCGAWGVVFTALFATEKYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAA +IQI+VI GWVS TMGPLF+ LHK+ LLRIS +DE  GMD
Sbjct  405  KPGRPYGLFMGGGGRLLAAHLIQILVIIGWVSVTMGPLFFGLHKMNLLRISEDDELAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAY Y DE  +   + GI+M
Sbjct  465  MTRHGGFAYVYEDEAHK---HNGIQM  487



>ref|NP_189073.1| ammonium transporter 1;3 [Arabidopsis thaliana]
 sp|Q9SQH9.2|AMT13_ARATH RecName: Full=Ammonium transporter 1 member 3; Short=AtAMT1;3 
[Arabidopsis thaliana]
 dbj|BAB02929.1| ammonium transporter [Arabidopsis thaliana]
 dbj|BAE99780.1| ammonium transporter [Arabidopsis thaliana]
 gb|AEE76886.1| ammonium transporter 1;3 [Arabidopsis thaliana]
Length=498

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAV TTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVNTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASVVLIGCNKLAELVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L +L LLRIS + E  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVIVGWVSATMGTLFFILKRLNLLRISEQHEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>gb|KJB28554.1| hypothetical protein B456_005G055200 [Gossypium raimondii]
Length=485

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  271  WSAVGRTAVTTTLAGCTAALTTLFGKRILTGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  330

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG NKLA   KYDDPLEAAQLHGGCGAWG+IFTGLFA +  V +VYP 
Sbjct  331  AIICGFVAALVLIGCNKLAEKVKYDDPLEAAQLHGGCGAWGVIFTGLFASEKLVKQVYPS  390

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P + YGLFMGGGGKL AAQ+IQI+VI GWVSATMG LFY LHK  LLRIS EDE  GMD
Sbjct  391  RPAK-YGLFMGGGGKLFAAQIIQILVIVGWVSATMGTLFYFLHKFGLLRISVEDEMAGMD  449

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGG AY YHDED+  S   GI+M
Sbjct  450  LTRHGGLAYVYHDEDE--SQKNGIQM  473



>ref|NP_001053280.1| Os04g0509600 [Oryza sativa Japonica Group]
 sp|Q7XQ12.1|AMT11_ORYSJ RecName: Full=Ammonium transporter 1 member 1; Short=OsAMT1;1 
[Oryza sativa Japonica Group]
 emb|CAE03364.1| OSJNBb0065L13.7 [Oryza sativa Japonica Group]
 dbj|BAF15194.1| Os04g0509600 [Oryza sativa Japonica Group]
 gb|EAY94813.1| hypothetical protein OsI_16598 [Oryza sativa Indica Group]
 gb|EAZ31310.1| hypothetical protein OsJ_15423 [Oryza sativa Japonica Group]
 dbj|BAG93605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=498

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 172/197 (87%), Gaps = 2/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y  
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VIFGWVS TMGPLFY L KL LLRIS+EDET GMD
Sbjct  392  -AGRPYGLFMGGGGKLLAAHVIQILVIFGWVSCTMGPLFYGLKKLGLLRISAEDETSGMD  450

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHDED+ 
Sbjct  451  LTRHGGFAYVYHDEDEH  467



>gb|AAU84432.1| ammonium transporter [Oryza sativa Japonica Group]
Length=532

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 172/197 (87%), Gaps = 2/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y  
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYGA  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VIFGWVS TMGPLFY L KL LLRIS+EDET GMD
Sbjct  393  --GRPYGLFMGGGGKLLAAHVIQILVIFGWVSCTMGPLFYGLKKLGLLRISAEDETSGMD  450

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHDED+ 
Sbjct  451  LTRHGGFAYVYHDEDEH  467



>gb|AAD54638.1|AF083035_1 ammonium transporter [Arabidopsis thaliana]
Length=519

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAV TTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVNTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASVVLIGCNKLAELVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L +L LLRIS + E  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVIVGWVSATMGTLFFILKRLNLLRISEQHEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>ref|NP_193087.1| ammonium transporter 1;1 [Arabidopsis thaliana]
 sp|P54144.1|AMT11_ARATH RecName: Full=Ammonium transporter 1 member 1; Short=AtAMT1;1 
[Arabidopsis thaliana]
 emb|CAA53473.1| amt1 [Arabidopsis thaliana]
 emb|CAB41109.1| ammonium transport protein (AMT1) [Arabidopsis thaliana]
 emb|CAB78393.1| ammonium transport protein (AMT1) [Arabidopsis thaliana]
 gb|AEE83287.1| ammonium transporter 1;1 [Arabidopsis thaliana]
Length=501

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  339  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRISSEDE  GMD
Sbjct  399  KPGRPHGLFMGGGGKLLGAQLIQIIVITGWVSATMGTLFFILKKMKLLRISSEDEMAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  459  MTRHGGFAYMYFDDDES  475



>gb|AAL05612.1|AF289477_1 ammonium transporter 1-1 [Oryza sativa]
Length=532

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 172/197 (87%), Gaps = 2/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y  
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYGA  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VIFGWVS TMGPLFY L KL LLRIS+EDET GMD
Sbjct  393  --GRPYGLFMGGGGKLLAAHVIQILVIFGWVSCTMGPLFYGLKKLGLLRISAEDETSGMD  450

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHDED+ 
Sbjct  451  LTRHGGFAYVYHDEDEH  467



>ref|XP_010450199.1| PREDICTED: ammonium transporter 1 member 1-like [Camelina sativa]
Length=505

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLLAAQ+IQI+VI GWVS TMG LF++L K+KLLRISSEDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLAAQLIQILVITGWVSVTMGTLFFILKKMKLLRISSEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  463  MTRHGGFAYMYFDDDES  479



>gb|AAD54639.1|AF083036_1 ammonium transporter [Arabidopsis thaliana]
Length=514

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCT+ALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTSALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWGLIFTGLFA+K YVNE+Y G
Sbjct  353  AIVCGFVASWVLIGFNLLAKKLKYDDPLEAAQLHGGCGAWGLIFTGLFARKEYVNEIYSG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLFMGGGGKLLAAQIVQIIVIIGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAYAY+DEDD S+
Sbjct  471  MTRHGGFAYAYNDEDDVST  489



>emb|CDY52657.1| BnaA05g35560D [Brassica napus]
Length=503

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAREKYLNQIYGE  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLGAQLIQILVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y+D+D+ 
Sbjct  463  MTRHGGFAYMYYDDDES  479



>gb|KJB72483.1| hypothetical protein B456_011G180700 [Gossypium raimondii]
Length=485

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  271  WSAVGRTAVTTTLAGCTAALTTLFGKRILTGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  330

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFA + YV EVYP 
Sbjct  331  AIICGFVAAWVLISCNKLAEKVKFDDPLEAAQLHGGCGAWGIIFTALFASEKYVREVYPS  390

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGG+LLAA +IQI+VI GWVS TMG LFY LHK  LLRIS++DE  GMD
Sbjct  391  RPVR-YGLFMGGGGRLLAAHIIQILVIVGWVSVTMGTLFYFLHKFGLLRISADDEMAGMD  449

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGG AY YHDED+  S   G +M
Sbjct  450  LTRHGGLAYVYHDEDE--SQKQGTQM  473



>ref|XP_007035320.1| Ammonium transporter 1,5 [Theobroma cacao]
 gb|EOY06246.1| Ammonium transporter 1,5 [Theobroma cacao]
Length=591

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 177/206 (86%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  376  WSAVGRTAVTTTLAGCTAALTTLFGKRILTGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  435

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLIG NKLA   K+DDPLEAAQLHGGCGAWG++FTGLFA K YV EVYP 
Sbjct  436  AVICGFVAALVLIGCNKLAEKVKFDDPLEAAQLHGGCGAWGVLFTGLFATKKYVREVYPS  495

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
                 YGLFMGGGG+L AAQ+IQI+VI GWVSATMG LFY+LHK  LLRIS++DE  GMD
Sbjct  496  SRPVKYGLFMGGGGRLFAAQIIQILVIVGWVSATMGTLFYLLHKFGLLRISADDEMAGMD  555

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGG AY YHDED+  SH  GI+M
Sbjct  556  LTRHGGLAYIYHDEDE--SHKQGIQM  579


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  276  QLHGGCGAWGLIFTGLFAKKSYVNEVYPGLPDRPYGLFMGGGGKLLAA  419
            +LHGGCGAWG+IFTGL A + YV EVY   P R YGLFMGGG  LLAA
Sbjct  33   KLHGGCGAWGVIFTGLLASEKYVKEVYTTRPVR-YGLFMGGGANLLAA  79



>ref|XP_002870394.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46653.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  339  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  399  RPGRPHGLFMGGGGKLLGAQLIQIIVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  459  MTRHGGFAYMYFDDDES  475



>ref|XP_002868352.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44611.1| AMT1_1 [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  339  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  399  RPGRPHGLFMGGGGKLLGAQLIQIIVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  459  MTRHGGFAYMYFDDDES  475



>ref|XP_009124614.1| PREDICTED: ammonium transporter 1 member 1 [Brassica rapa]
Length=503

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVSDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAREKYLNQIYGE  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLGAQLIQILVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y+D+D+ 
Sbjct  463  MTRHGGFAYMYYDDDES  479



>ref|XP_004290002.1| PREDICTED: ammonium transporter 1 member 4-like [Fragaria vesca 
subsp. vesca]
Length=492

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGC AALTTLFGKR+L GHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  282  WSAVGRTAVTTTLAGCAAALTTLFGKRMLSGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CG VAAWVLIG NKLA   K+DDPLEAAQLHGGCG WG+IFT LFAKK+YVNEVYPG
Sbjct  342  AIICGIVAAWVLIGCNKLAEKLKFDDPLEAAQLHGGCGTWGIIFTALFAKKAYVNEVYPG  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RP+GLF+GGG KLLAA ++QIV +  +VS TMG LF++LHKL+LLRISS+DE  GMD
Sbjct  402  HPERPFGLFIGGGAKLLAAHLVQIVAVAAFVSVTMGTLFFLLHKLELLRISSDDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHY  605
            +T HGG AY Y D DD +S Y
Sbjct  462  VTSHGGLAYVYTDGDDMNSGY  482



>ref|XP_008342559.1| PREDICTED: ammonium transporter 1 member 1-like [Malus domestica]
Length=534

 Score =   293 bits (749),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  315  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  374

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPL  AQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  375  AIVCGFVAAVVLISCNKLAEKLKYDDPLXXAQLHGGCGAWGIIFTALFATEKYVNEVYPG  434

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLL A +IQIVVI GWVSATM PLF++LHKLKLLRIS+EDE  GMD
Sbjct  435  KEGRPYGLFMGGGGKLLGAHLIQIVVIIGWVSATMVPLFFVLHKLKLLRISAEDEMAGMD  494

Query  543  LTRHGGFAYAYHDEDDQ  593
            LT HGGFAY Y D++D 
Sbjct  495  LTWHGGFAYVYRDDEDS  511



>gb|AAD16012.1| ammonium transporter [Nepenthes alata]
Length=335

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  150  WSAVGRTAVTTTLAGSTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  209

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV++WVLIG NKLA   KYDDPLEAAQLHGGCG WGLIFTGLFA K YV+EVY G
Sbjct  210  AIICGFVSSWVLIGFNKLAEKVKYDDPLEAAQLHGGCGMWGLIFTGLFATKKYVSEVYGG  269

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRP+GLFMGGGGKLLAAQ+IQIVVIFGWV+ATMGPLFY L  LKLLR+ SE E  GMD
Sbjct  270  SPDRPHGLFMGGGGKLLAAQLIQIVVIFGWVTATMGPLFYGLKWLKLLRVKSEHEMAGMD  329

Query  543  LTRHGG  560
            +T HGG
Sbjct  330  MTSHGG  335



>gb|EYU39773.1| hypothetical protein MIMGU_mgv1a004701mg [Erythranthe guttata]
Length=514

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG TAALTTLF KR+LVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  290  WSAIGRTAVTTTLAGSTAALTTLFSKRVLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCG VAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFA K YVNEVYPG
Sbjct  350  AIVCGLVAAWVLIGLNKLAERLKYDDPLEAAQLHGGCGAWGVLFTGLFATKDYVNEVYPG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGLFMGGGG+LLAAQ+++++VI GWV+ATM PLF  L KLKLLR+S+EDET GMD
Sbjct  410  RPDRPYGLFMGGGGRLLAAQIVEVLVIIGWVTATMAPLFLALRKLKLLRVSNEDETAGMD  469

Query  543  LTRHGGFAYAYHDEDD----QSSHYPGIKM  620
            +TRHGG AY YHDE D     +S+ P  KM
Sbjct  470  MTRHGGMAYIYHDEGDDYNNNNSNLPQFKM  499



>ref|XP_006285083.1| hypothetical protein CARUB_v10006416mg [Capsella rubella]
 gb|EOA17981.1| hypothetical protein CARUB_v10006416mg [Capsella rubella]
Length=505

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   +YDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFVAALVLLGCNKLAEKLRYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGN  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+KLLRISSEDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLGAQLIQILVITGWVSATMGTLFFILKKMKLLRISSEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  463  MTRHGGFAYMYFDDDES  479



>ref|XP_006418768.1| hypothetical protein EUTSA_v10002494mg [Eutrema salsugineum]
 gb|ESQ37204.1| hypothetical protein EUTSA_v10002494mg [Eutrema salsugineum]
Length=497

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  282  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VL G NKLA + ++DDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  342  AIVCGFVAALVLFGCNKLAEMVQFDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P RPYGLFMGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  402  VPGRPYGLFMGGGGKLLGAQLVQILVVAGWVSATMGTLFFILKKLNLLRISEKDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            +TRHGGFAY Y++ +++S  
Sbjct  462  MTRHGGFAYMYYENEEESQR  481



>ref|XP_011073733.1| PREDICTED: ammonium transporter 1 member 1-like [Sesamum indicum]
Length=497

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLF KR+L GHWNV+DVCNGLL GFAAITSGCSVVEPWA
Sbjct  279  WSAVGRTAVTTTLAGCTAALTTLFVKRILSGHWNVLDVCNGLLAGFAAITSGCSVVEPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLIG NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  339  ALICGFVAALVLIGCNKLAEKVKYDDPLEAAQLHGGCGAWGIIFTALFARERYVNEVYPG  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGG  LLAA +IQI+VI GWVSATMGPLFY+L +L LLRIS +DE  GMD
Sbjct  399  KPGRPFGLFMGGGWSLLAAHIIQILVIVGWVSATMGPLFYILRRLDLLRISPDDELAGMD  458

Query  543  LTRHGGFAYAYHDED  587
            LTRHGG AYAY D+D
Sbjct  459  LTRHGGLAYAYDDDD  473



>ref|XP_006296773.1| hypothetical protein CARUB_v10015818mg [Capsella rubella]
 gb|EOA29671.1| hypothetical protein CARUB_v10015818mg [Capsella rubella]
Length=491

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRLISGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + K+DDPLEAAQLHGGCGAWGLIF GLFA++ YVNEVY  
Sbjct  342  AIVCGFVASLVLIGCNKLAELLKFDDPLEAAQLHGGCGAWGLIFVGLFAREKYVNEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               R YGLFMGGGGKLLAAQ++QI+VI GWVSATMG LF++L KL LLRIS  DE  GMD
Sbjct  402  NQGRHYGLFMGGGGKLLAAQLVQIIVIVGWVSATMGTLFFILKKLDLLRISETDEMQGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPGI  614
            + RHGGFAY YHD DD S   P +
Sbjct  462  IARHGGFAYIYHDNDDDSIQLPRV  485



>emb|CDY06463.1| BnaC06g11810D [Brassica napus]
Length=503

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AA VL+G NKLA   KYDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFIAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAREKYLNQIYGE  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI  WVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLGAQLIQILVITAWVSATMGTLFFILKKMKLLRISAEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y+D+D+ 
Sbjct  463  MTRHGGFAYMYYDDDES  479



>ref|NP_189072.1| ammonium transporter 1;5 [Arabidopsis thaliana]
 sp|Q9LK16.1|AMT15_ARATH RecName: Full=Putative ammonium transporter 1 member 5; Short=AtAMT1;5 
[Arabidopsis thaliana]
 dbj|BAB02928.1| ammonium transporter [Arabidopsis thaliana]
 gb|AEE76885.1| ammonium transporter 1;5 [Arabidopsis thaliana]
Length=496

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  342  AIVCGFVASLVLIGCNKLAELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYINEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L KL LLRIS + E  GMD
Sbjct  402  SPGRHYGLFMGGGGKLLGAQLVQIIVIVGWVSATMGTLFFILKKLNLLRISEQHEMRGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPG  611
            L  HGGFAY YHD DD S   PG
Sbjct  462  LAGHGGFAYIYHDNDDDSIGVPG  484



>gb|AAG28780.1|AF306518_1 high-affinity ammonium transporter AMT1;2 [Brassica napus]
Length=519

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAV TTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVNTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+ + VLIG NKLA + +Y DPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMTSLVLIGCNKLAELVQYGDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L +L LLRIS + E  GMD
Sbjct  403  TPGRPYGLFMGGGGKLLGAQLVQILVIVGWVSATMGTLFFILKRLNLLRISEQHEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>ref|XP_004976182.1| PREDICTED: ammonium transporter 1 member 1-like [Setaria italica]
Length=495

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSAVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIGAN LAA  ++DDPLEAAQLHGGCGAWG++FT LFA+K YV E+Y  
Sbjct  333  AVICGFVSAWVLIGANALAARLRFDDPLEAAQLHGGCGAWGILFTALFARKRYVEEIYGA  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAA +IQI+VI GWVS TMGPLFY L KL LLRIS++DE  GMD
Sbjct  393  --GRPYGLFMGGGGRLLAAHVIQILVIAGWVSCTMGPLFYALKKLDLLRISADDEMAGMD  450

Query  543  LTRHGGFAYAYHDED  587
            +TRHGGFAY YHDED
Sbjct  451  MTRHGGFAYVYHDED  465



>ref|XP_011024510.1| PREDICTED: ammonium transporter 1 member 4-like [Populus euphratica]
Length=489

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA TTTLAGCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAATTTLAGCTAALTTLFGKRLVAGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG NKLA    YDDPLEA QLHGGCG+WG+IFT LFAK++YVNEVYPG
Sbjct  345  AVLCGFVSAWVLIGCNKLAEKFHYDDPLEATQLHGGCGSWGIIFTALFAKEAYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGG +LLAA ++QI+VI  WVS TMG +F++LHKLKLLRIS+E+E  GMD
Sbjct  405  QPGRPYGLFMGGGARLLAAHIVQILVIVAWVSVTMGTVFFVLHKLKLLRISAEEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGI  614
            LT HGG AY Y D +D+     G+
Sbjct  465  LTSHGGLAYVYTDHEDEVKKQLGV  488



>gb|ADJ68003.1| AMT1;1 ammonium/proton co-transporter [Phaseolus vulgaris]
Length=500

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GC+VVEPWA
Sbjct  284  WSAVGRTAVTTTLAGSTAALTTLFGKRVLSGHWNVTDVCNGLLGGFAAITAGCAVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLI  NKLA   ++DDPLEAAQLHGGCGAWG+IFT LFAKK YV E Y G
Sbjct  344  AIVCGFVASVVLIACNKLAERVRFDDPLEAAQLHGGCGAWGVIFTALFAKKEYVFEAYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGG+LLAA +IQI+VI GWVSATMGPLF++L KL LLRISSEDE  GMD
Sbjct  404  DASRPHGLFMGGGGRLLAAHLIQILVIVGWVSATMGPLFWLLKKLNLLRISSEDELAGMD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAYAY D++ Q
Sbjct  464  MTRHGGFAYAYEDDETQ  480



>gb|KFK36236.1| hypothetical protein AALP_AA4G095900 [Arabis alpina]
Length=502

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  282  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VL+G NKLA   +YDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  342  AIICGFVAACVLLGCNKLAEKLRYDDPLEAAQLHGGCGAWGLIFTALFAEEKYLNQIYGS  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQI+VI GWVSATMG LF++L K+ LLRIS+EDE  GMD
Sbjct  402  KPGRPHGLFMGGGGKLLGAQLIQILVITGWVSATMGTLFFILKKMNLLRISAEDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAY Y D+D+ 
Sbjct  462  MTRHGGFAYMYFDDDES  478



>gb|KDP26448.1| hypothetical protein JCGZ_17606 [Jatropha curcas]
Length=452

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  250  WSAIGRTGVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  309

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +++CGFVAAWVLIG NKLA + +YDDPLEAAQLHGGCG+WG+IFT LFAK++YV EVYPG
Sbjct  310  SVICGFVAAWVLIGFNKLAEIFRYDDPLEAAQLHGGCGSWGIIFTALFAKQAYVEEVYPG  369

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGG +LLAA ++QI+VI  WVS TMG LF++LHKLKLLRI+ E+E  GMD
Sbjct  370  HEGRPYGLLMGGGARLLAAHIVQILVIVAWVSLTMGTLFWVLHKLKLLRITEEEEMAGMD  429

Query  543  LTRHGGFAYAYHDEDDQSSHY  605
            LT HGG AYAY D D+    +
Sbjct  430  LTSHGGHAYAYGDIDNAQKEF  450



>gb|KJB42399.1| hypothetical protein B456_007G150700 [Gossypium raimondii]
Length=499

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTT++G +AALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  286  WSAIGRTAVTTTISGSSAALTTLFGKRLLTGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AAWVLIG NKLA + KYDDPLEAAQLHGGCGAWG+IFT LFAKK YVNE+YPG
Sbjct  346  AIICGFIAAWVLIGCNKLAEMLKYDDPLEAAQLHGGCGAWGIIFTALFAKKDYVNEIYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GL MGGG +LLAA +IQI+V+ GWVS TMG +F++L    LLRIS+++E  G+D
Sbjct  406  KPGRPHGLLMGGGARLLAAHLIQILVVIGWVSVTMGSVFWLLKVFGLLRISADEEMAGLD  465

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            +T HGG AYAYHDE++  S 
Sbjct  466  VTSHGGLAYAYHDENNDQSE  485



>emb|CDY18755.1| BnaC08g08610D [Brassica napus]
Length=503

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHW V DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWKVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AA VL+G NKLA   +YDDPLEAAQLHGGCGAWGLIFT LFA++ Y+N++Y  
Sbjct  343  AIICGFLAALVLLGCNKLAERLRYDDPLEAAQLHGGCGAWGLIFTALFAEEKYLNQIYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GLFMGGGGKLL AQ+IQIVVI GWVSATMG LF++L K+KLLRIS+EDE  GMD
Sbjct  403  KPGRPHGLFMGGGGKLLGAQLIQIVVITGWVSATMGTLFFILKKMKLLRISAEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDD  590
            +TRHGGFAY Y D+D+
Sbjct  463  MTRHGGFAYMYFDDDE  478



>ref|XP_007145350.1| hypothetical protein PHAVU_007G231700g [Phaseolus vulgaris]
 gb|ESW17344.1| hypothetical protein PHAVU_007G231700g [Phaseolus vulgaris]
Length=500

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GC+VVEPWA
Sbjct  284  WSAVGRTAVTTTLAGSTAALTTLFGKRVLSGHWNVTDVCNGLLGGFAAITAGCAVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLI  NKLA   ++DDPLEAAQLHGGCGAWG+IFT LFAKK YV E Y G
Sbjct  344  AIVCGFVASVVLIACNKLAERVRFDDPLEAAQLHGGCGAWGVIFTALFAKKEYVFEAYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGG+LLAA +IQI+VI GWVSATMGPLF++L KL LLRISSEDE  GMD
Sbjct  404  DASRPHGLFMGGGGRLLAAHVIQILVIVGWVSATMGPLFWLLKKLNLLRISSEDELAGMD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGGFAYAY D++ Q
Sbjct  464  MTRHGGFAYAYEDDETQ  480



>ref|XP_002301837.1| ammonium transporter 3 family protein [Populus trichocarpa]
 gb|EEE81110.1| ammonium transporter 3 family protein [Populus trichocarpa]
Length=489

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTA TTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAATTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG N LA    YDDPLEA QLHGGCG+WG+IFT LFAK++YVNEVYPG
Sbjct  345  AVLCGFVSAWVLIGCNMLAEKFHYDDPLEATQLHGGCGSWGIIFTALFAKEAYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGG +LLAA ++QI+VI  WVS TMG +F++LHKLKLLRIS+E+E  GMD
Sbjct  405  QPGRPYGLFMGGGARLLAAHIVQILVIVAWVSVTMGTVFFILHKLKLLRISAEEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGI  614
            LT HGG AY Y D +D+     G+
Sbjct  465  LTSHGGLAYVYTDHEDEVKKQLGV  488



>ref|XP_007050113.1| Ammonium transporter 1 member 4 [Theobroma cacao]
 gb|EOX94270.1| Ammonium transporter 1 member 4 [Theobroma cacao]
Length=517

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTT+LAGC AALTTLFGKRLLVGHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  313  WSAVGRTAVTTSLAGCAAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  372

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGF+AAWVLIG NKLA    YDDPLEAAQLHGGCGAWG+IFT LFAK+ YVNEVYPG
Sbjct  373  AVLCGFIAAWVLIGFNKLAEKFHYDDPLEAAQLHGGCGAWGIIFTALFAKEKYVNEVYPG  432

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGG +LLAA ++QI+VI  WV+ TMG LF+ L KL LLRISSE+E  GMD
Sbjct  433  QPGRPYGLFMGGGTRLLAAHLVQILVIVAWVTVTMGTLFFTLQKLNLLRISSEEEMAGMD  492

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
            +T HGG AY Y+D ++ ++  P
Sbjct  493  MTSHGGQAYEYNDHENNANKPP  514



>gb|KFK39729.1| hypothetical protein AALP_AA3G280600 [Arabis alpina]
Length=496

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 173/205 (84%), Gaps = 4/205 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFA K YVNEVY  
Sbjct  342  AIVCGFVASLVLIGCNKLAELLKYDDPLEAAQLHGGCGAWGLIFVGLFASKKYVNEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGGKLL AQ++QI+VI GWVSATMG LF++L KLKLLRIS +DE  GMD
Sbjct  402  SPGRHYGLFMGGGGKLLGAQLVQILVIVGWVSATMGTLFFILKKLKLLRISEQDEMKGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIK  617
            + RHGGFAY     DD+S H+  + 
Sbjct  462  IARHGGFAY----NDDESVHFSRVN  482



>ref|XP_008441797.1| PREDICTED: ammonium transporter 1 member 2 [Cucumis melo]
 ref|XP_008441798.1| PREDICTED: ammonium transporter 1 member 2 [Cucumis melo]
Length=511

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFAKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLIG NKLA    +DDPLEAAQLHGGCGAWGLIFTGLFA K YV EVY  
Sbjct  346  AVICGFVASWVLIGFNKLAERLSFDDPLEAAQLHGGCGAWGLIFTGLFATKKYVGEVYQ-  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGG +LLAAQ+++IV IFGWVS TMG LFY L K KLLRIS EDE  GMD
Sbjct  405  -VGRPYGLLMGGGWRLLAAQVVEIVAIFGWVSLTMGGLFYGLMKGKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DE+D S    G  M
Sbjct  464  LTRHGGFAYVYNDEEDISEKSSGFMM  489



>ref|XP_004152863.1| PREDICTED: ammonium transporter 1 member 2-like [Cucumis sativus]
 gb|KGN61307.1| hypothetical protein Csa_2G079100 [Cucumis sativus]
Length=511

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFAKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLIG NKLA    +DDPLEAAQLHGGCGAWGLIFTGLFA K YV EVY  
Sbjct  346  AVICGFVASWVLIGFNKLAERLSFDDPLEAAQLHGGCGAWGLIFTGLFATKKYVGEVYQ-  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGG KLLAAQ+++IV IFGWVS TMG LFY L K KLLRIS EDE  GMD
Sbjct  405  -LGRPYGLLMGGGWKLLAAQVVEIVAIFGWVSLTMGGLFYGLMKGKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DE+D S    G  M
Sbjct  464  LTRHGGFAYVYNDEEDFSEKASGFVM  489



>emb|CDY07159.1| BnaCnng01740D [Brassica napus]
Length=511

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCT+ALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  292  WSAVGRTAVTTTLAGCTSALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  351

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N +A   KYDDPLEAAQLHGGCGAWG+IFTGLFA K YVNEVY G
Sbjct  352  AIVCGFVASWVLIGFNLVAKKLKYDDPLEAAQLHGGCGAWGVIFTGLFATKRYVNEVYSG  411

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ +QIVVI GWVS TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  412  DGDRPYGLLMGGGGKLLAAQFVQIVVIIGWVSVTMGPLFYGLHKMNLLRISTEDEMAGMD  471

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAYAY+DEDD S
Sbjct  472  MTRHGGFAYAYNDEDDVS  489



>ref|NP_001130456.1| hypothetical protein [Zea mays]
 gb|ACF78671.1| unknown [Zea mays]
 gb|ACF78672.1| unknown [Zea mays]
 gb|AFW72378.1| hypothetical protein ZEAMMB73_406202 [Zea mays]
Length=488

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  272  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  331

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  ++DDPLEAAQLHGGCGAWG++FTGLFA++ YV ++Y G
Sbjct  332  AIICGFVSAWVLIGLNALAARLRFDDPLEAAQLHGGCGAWGVLFTGLFARREYVEQIY-G  390

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAA ++ I+VI  WVS TM PLF  L+K+ LLR+S+EDE  GMD
Sbjct  391  TPGRPYGLFMGGGGRLLAANVVMILVIAAWVSVTMAPLFLALNKMGLLRVSAEDEMAGMD  450

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
             TRHGGFAYAYHD+D   S  P
Sbjct  451  QTRHGGFAYAYHDDDLSLSSRP  472



>ref|XP_002452468.1| hypothetical protein SORBIDRAFT_04g026290 [Sorghum bicolor]
 gb|EES05444.1| hypothetical protein SORBIDRAFT_04g026290 [Sorghum bicolor]
 gb|AGK25003.1| ammonium transporter [Sorghum bicolor]
Length=489

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG N LAA  ++DDPLEAAQLHGGCGAWG++FT LFA++ YV ++Y G
Sbjct  333  AVICGFVSAWVLIGLNALAARLRFDDPLEAAQLHGGCGAWGVLFTALFARREYVEQIY-G  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LLAA ++ I+VI  WVS TM PLF  L+KL LLR+S+EDE  GMD
Sbjct  392  TPGRPYGLFMGGGGRLLAANVVMILVIAAWVSVTMAPLFLALNKLGLLRVSAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
             TRHGGFAYAYHDED   S  P
Sbjct  452  QTRHGGFAYAYHDEDMSLSSRP  473



>ref|XP_006302147.1| hypothetical protein CARUB_v10020151mg [Capsella rubella]
 gb|EOA35045.1| hypothetical protein CARUB_v10020151mg [Capsella rubella]
Length=514

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCTAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWGLIFTGLFA K YVNEVY G
Sbjct  353  AIVCGFVASWVLIGFNLLAKKLKYDDPLEAAQLHGGCGAWGLIFTGLFATKRYVNEVYTG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLLMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAYAY+DEDD S+
Sbjct  471  MTRHGGFAYAYNDEDDVST  489



>ref|XP_004155139.1| PREDICTED: ammonium transporter 1 member 2-like [Cucumis sativus]
Length=511

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFAKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLIG NKLA    +DDPLEAAQLHGGCGAWGLIFTGLFA K YV EVY  
Sbjct  346  AVICGFVASWVLIGFNKLAERLSFDDPLEAAQLHGGCGAWGLIFTGLFATKKYVGEVYQ-  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGG KLLA+Q+++IV IFGWVS TMG LFY L K KLLRIS EDE  GMD
Sbjct  405  -LGRPYGLLMGGGWKLLASQVVEIVAIFGWVSLTMGGLFYGLMKGKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DE+D S    G  M
Sbjct  464  LTRHGGFAYVYNDEEDFSEKASGFVM  489



>gb|KDP23742.1| hypothetical protein JCGZ_23575 [Jatropha curcas]
Length=510

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG NKLA   KYDDPLEAAQLHGGCGAWGL+FTGLFA K YVNEVYP 
Sbjct  345  AIVCGFVASWVLIGCNKLAEKFKYDDPLEAAQLHGGCGAWGLLFTGLFATKKYVNEVYPN  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGGKLLAAQ+IQI+VI GWV+ TMGPLFY L+KL+LLRISS DE  GMD
Sbjct  405  KLGRPYGLLMGGGGKLLAAQIIQILVISGWVTVTMGPLFYGLNKLRLLRISSGDEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY Y DEDD S
Sbjct  465  LTRHGGFAYIYDDEDDPS  482



>ref|XP_002266663.2| PREDICTED: uncharacterized protein LOC100263947 [Vitis vinifera]
Length=1063

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3     WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
             WSAVGRTAVTTTLAGCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  841   WSAVGRTAVTTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITSGCSVVEPWA  900

Query  183   AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
             AIVCGFVAAWVLIG NKLA   +YDDPLEAAQLHGGCGAWGL+FTGLFA K YV EVY G
Sbjct  901   AIVCGFVAAWVLIGCNKLAERVEYDDPLEAAQLHGGCGAWGLLFTGLFATKKYVREVYAG  960

Query  363   LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               DRPYGL MGGGGKLLAAQ IQI+V+ GWV+ TMGPLFY LHKLKLLRISSEDE  GMD
Sbjct  961   PSDRPYGLLMGGGGKLLAAQFIQIIVVSGWVTVTMGPLFYALHKLKLLRISSEDEMAGMD  1020

Query  543   LTRHGGFAYAYHDEDDQSSHYPGIKM  620
             LTRHGGFAY Y +EDD+S+  PG+ +
Sbjct  1021  LTRHGGFAYVY-NEDDESTFKPGLPL  1045



>ref|XP_006652500.1| PREDICTED: ammonium transporter 1 member 1-like [Oryza brachyantha]
Length=498

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 170/197 (86%), Gaps = 2/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y  
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYG-  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGGKLLAA +IQI+VIFGWVS TMGPLF+ L KL LLRIS++DET GMD
Sbjct  392  -AGRPYGLFMGGGGKLLAAHIIQILVIFGWVSCTMGPLFFGLKKLGLLRISADDETSGMD  450

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGG A  YHDED+ 
Sbjct  451  LTRHGGVADVYHDEDEH  467



>ref|XP_009111404.1| PREDICTED: ammonium transporter 1 member 2 [Brassica rapa]
Length=512

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCT+ALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  292  WSAVGRTAVTTTLAGCTSALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  351

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWG+IFTGLFA K YVNEVY G
Sbjct  352  AIVCGFVASWVLIGFNFLAKKLKYDDPLEAAQLHGGCGAWGVIFTGLFATKRYVNEVYSG  411

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ +QIVVI GWVS TMGPLFY LHK+ LLRIS EDE  GMD
Sbjct  412  DGDRPYGLLMGGGGKLLAAQFVQIVVIIGWVSVTMGPLFYGLHKMNLLRISREDEMAGMD  471

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAYAY+DE+D S
Sbjct  472  MTRHGGFAYAYNDEEDVS  489



>gb|AAS19466.2| ammonium transporter Amt1;1 [Triticum aestivum]
Length=503

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGR AVTTTLAG TAALTTLFGKRL  GHWNV+DVCNGLLGGFAA+T+GCSVV+PWA
Sbjct  273  WSAVGRAAVTTTLAGSTAALTTLFGKRLQTGHWNVLDVCNGLLGGFAAVTAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG NKLAA  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YV ++Y G
Sbjct  333  AIICGFVSAWVLIGLNKLAARFKFDDPLEAAQLHGGCGAWGVIFTALFARREYVEQIY-G  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++ I+VI  WVS TMGPLF  L+KL LLRIS+EDE  GMD
Sbjct  392  APGRPYGLFMGGGGRLLGAHVVLILVIAAWVSCTMGPLFLALNKLGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDEDDQS  596
             TRHGGFAYAY DED  S
Sbjct  452  QTRHGGFAYAYTDEDSSS  469



>emb|CDY48491.1| BnaA09g00320D [Brassica napus]
Length=512

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCT+ALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  292  WSAVGRTAVTTTLAGCTSALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  351

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWG+IFTGLFA K YVNEVY G
Sbjct  352  AIVCGFVASWVLIGFNFLAKKLKYDDPLEAAQLHGGCGAWGVIFTGLFATKRYVNEVYSG  411

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ +QIVVI GWVS TMGPLFY LHK+ LLRIS EDE  GMD
Sbjct  412  DGDRPYGLLMGGGGKLLAAQFVQIVVIIGWVSVTMGPLFYGLHKMNLLRISREDEMAGMD  471

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAYAY+DE+D S
Sbjct  472  MTRHGGFAYAYNDEEDVS  489



>emb|CDX92889.1| BnaC07g41470D [Brassica napus]
Length=509

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  291  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  350

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   ++DDPLEAAQLHGGCGAWG+IFTGLFA K+YV+E+Y G
Sbjct  351  AVICGFVAAWVLMGFNKLADKLRFDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEIYGG  410

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RP+GLFMGGGG+LLAA ++QIVVI GWVS TMG LF++LHK++LLRI SEDE  GMD
Sbjct  411  DPNRPFGLFMGGGGRLLAAHVVQIVVIVGWVSVTMGTLFFVLHKMELLRIPSEDEVAGMD  470

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +E+ ++
Sbjct  471  PTSHGGLAYMYTEEEIKN  488



>ref|XP_010273183.1| PREDICTED: ammonium transporter 1 member 1-like [Nelumbo nucifera]
Length=306

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 152/189 (80%), Gaps = 7/189 (4%)
 Frame = +3

Query  72   FGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLIGANKLAAVCK  251
            FGKRL+  HWN+ DVCNGLLG F AITSGCSVVEPWAAIVCGF+A+WVLIG NKLA   K
Sbjct  106  FGKRLISKHWNITDVCNGLLGEFVAITSGCSVVEPWAAIVCGFIASWVLIGCNKLAKKFK  165

Query  252  YDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPGLPDRPYGLFMGGGGKLLAAQMIQ  431
            YDDPLEAAQLHGGC  WGLIFTGLF +  YV EVY     RPYGLFMGGGGKLLAAQ+IQ
Sbjct  166  YDDPLEAAQLHGGCECWGLIFTGLFVRGIYVQEVYQA-TGRPYGLFMGGGGKLLAAQIIQ  224

Query  432  IVVIFGWVS------ATMGPLFYMLHKLKLLRISSEDETHGMDLTRHGGFAYAYHDEDDQ  593
            I+ I GWVS      ATMGPLFY+L+K+ LLRIS+EDE  GMD+TRHGGFAY YHDED+Q
Sbjct  225  ILTIGGWVSATMGPLATMGPLFYVLNKMNLLRISAEDEMAGMDMTRHGGFAYVYHDEDEQ  284

Query  594  SSHYPGIKM  620
            S    G+ M
Sbjct  285  SLKQGGLMM  293



>ref|XP_004953126.1| PREDICTED: ammonium transporter 1 member 2-like [Setaria italica]
Length=491

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  274  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVLDVCNGLLGGFAAITAGCSVVDPWA  333

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVY-P  359
            A++CGFV+AWVLIG N LAA  ++DDPLEAAQLHGGCGAWG+IFTGLFA++ YV ++Y  
Sbjct  334  AVICGFVSAWVLIGLNALAARLRFDDPLEAAQLHGGCGAWGVIFTGLFARREYVEQIYGG  393

Query  360  GLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGM  539
            G P RPYGLFMGGGG+LLAA ++ ++VI  WVS TM PLF  L K+ LLR+S+EDE  GM
Sbjct  394  GAPGRPYGLFMGGGGRLLAANVVMVLVIAAWVSVTMAPLFLALSKMGLLRVSAEDEMAGM  453

Query  540  DLTRHGGFAYAYHDEDDQS  596
            D TRHGGFAYAYHD++D S
Sbjct  454  DQTRHGGFAYAYHDDEDPS  472



>ref|XP_009137804.1| PREDICTED: ammonium transporter 1 member 4-like [Brassica rapa]
Length=509

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  291  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  350

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   ++DDPLEAAQLHGGCGAWG+IFTGLFA K+YV+E+Y G
Sbjct  351  AVICGFVAAWVLMGFNKLADKLQFDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEIYGG  410

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RP+GLFMGGGG+LLAA ++QIVVI GWVS TMG LF++LHK++LLRI SEDE  GMD
Sbjct  411  DPNRPFGLFMGGGGRLLAAHVVQIVVIVGWVSVTMGTLFFVLHKMELLRIPSEDEVAGMD  470

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +E+ ++
Sbjct  471  PTSHGGLAYMYTEEEIKN  488



>gb|AFO70200.1| putative ammonium transporter AMT1;1, partial [Alternanthera 
philoxeroides]
Length=448

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTA+TTTLAGCTAALTTLFGKR++ GHW V DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  224  WSAVGRTALTTTLAGCTAALTTLFGKRIISGHWIVTDVCNGLLGGFAAITSGCSVVEPWA  283

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+A VLIG+NKLA   KYDDPLEAAQLHGGCGAWG++FT LFA K YVNEVYPG
Sbjct  284  AIICGFVSAGVLIGSNKLAEKLKYDDPLEAAQLHGGCGAWGVVFTALFASKKYVNEVYPG  343

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P+RPYGLFMGGGG+LLAA ++QI+ I GWVS TMGPLF +LHKLKLLR+S +D+  GMD
Sbjct  344  VPNRPYGLFMGGGGRLLAAHVVQILSIIGWVSLTMGPLFLLLHKLKLLRVSPDDKMSGMD  403

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGGFAYAYHDE+D +  
Sbjct  404  LTRHGGFAYAYHDEEDSNQR  423



>gb|KDP33351.1| hypothetical protein JCGZ_12900 [Jatropha curcas]
Length=501

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GC+VVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCAVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG NKLA   KYDDPLEAAQLHGGCGAWG+IFT LFA++ YV ++Y  
Sbjct  344  AIICGFVAALVLIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTALFAREKYVAQIYGA  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              +  +GLFMGGGG+LLAA +IQI+VI GWVS TMGPLF +LHKLKLLRIS+EDE  GMD
Sbjct  404  GVN--HGLFMGGGGRLLAAHVIQILVIIGWVSVTMGPLFLVLHKLKLLRISAEDEMAGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHDE++      GIK+
Sbjct  462  LTRHGGFAYIYHDEEETQKQ--GIKL  485



>gb|KCW61472.1| hypothetical protein EUGRSUZ_H04208 [Eucalyptus grandis]
Length=516

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLF KRLLVGHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  288  WSAVGRTAVTTTLAGSTAALTTLFSKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG NKLA + K+DDPLEAAQLHGGCGAWGLIFTGLFA++ YV+EVY G
Sbjct  348  AIVCGFVSAWVLIGCNKLAELAKFDDPLEAAQLHGGCGAWGLIFTGLFARRRYVDEVYGG  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               R YG F+GG G+LLAAQ+++++ I GWV+ATMGPLFY LH+L+LLR+S +DE  GMD
Sbjct  408  -SGRRYGWFVGGDGRLLAAQVVEVLAIAGWVTATMGPLFYGLHRLELLRVSGDDEKEGMD  466

Query  543  LTRHGGFAYAYHDE  584
            LTRHGG AY YHD+
Sbjct  467  LTRHGGLAYVYHDD  480



>ref|XP_010470323.1| PREDICTED: ammonium transporter 1 member 2-like [Camelina sativa]
Length=514

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCTAALTTLF +RLLVGHWNVIDVCNGLLGGF AITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTAALTTLFSRRLLVGHWNVIDVCNGLLGGFVAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCGAWGL+FTGLFA K YVNEVY G
Sbjct  353  AIVCGFVASWVLIGFNLLAKKFKYDDPLEAAQLHGGCGAWGLVFTGLFATKRYVNEVYIG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLLMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKINLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAYAY+DEDD S+
Sbjct  471  MTRHGGFAYAYNDEDDVST  489



>gb|AFU34589.1| ammonium transporter 1;1 [Alternanthera philoxeroides]
Length=513

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTA+TTTLAGCTAALTTLFGKR++ GHW V DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  289  WSAVGRTALTTTLAGCTAALTTLFGKRIISGHWIVTDVCNGLLGGFAAITSGCSVVEPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+A VLIG+NKLA   KYDDPLEAAQLHGGCGAWG++FT LFA K YVNEVYPG
Sbjct  349  AIICGFVSAGVLIGSNKLAEKLKYDDPLEAAQLHGGCGAWGVVFTALFASKKYVNEVYPG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P+RPYGLFMGGGG+LLAA ++QI+ I GWVS TMGPLF +LHKLKLLR+S +D+  GMD
Sbjct  409  VPNRPYGLFMGGGGRLLAAHVVQILSIIGWVSLTMGPLFLLLHKLKLLRVSPDDKMSGMD  468

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGGFAYAYHDE+D +  
Sbjct  469  LTRHGGFAYAYHDEEDSNQR  488



>gb|AFF18616.1| ammonium transporter [Puccinellia tenuiflora]
Length=499

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGR AVTTTLAG TAALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSAVGRAAVTTTLAGSTAALTTLFGKRLQTGHWNVLDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N +AA  ++DDPLEAAQLHGGCGAWG++FT LFA++ YV E+Y G
Sbjct  333  AIICGFVSAWVLIGLNTVAARFRFDDPLEAAQLHGGCGAWGVVFTALFARREYVEEIY-G  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P RPYGLFMGGGG+LL A ++ I+VI  WVSATMGPLF +L+K+ LLRIS+EDE  GMD
Sbjct  392  VPGRPYGLFMGGGGRLLGAHVVMILVIAAWVSATMGPLFLVLNKIGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDEDDQSSHYPGI  614
             TRHGGFAYAY+D+D       G+
Sbjct  452  QTRHGGFAYAYNDDDASGKPERGV  475



>ref|XP_002888286.1| ATAMT1_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64545.1| ATAMT1_2 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCTAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCG VA+WVLIG N LA   KYDDPLEAAQLHGGCGAWGLIFTGLFA K YVNEVY G
Sbjct  353  AIVCGSVASWVLIGFNLLAKKLKYDDPLEAAQLHGGCGAWGLIFTGLFASKQYVNEVYSG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLLMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAYAY+DEDD S+
Sbjct  471  MTRHGGFAYAYNDEDDVST  489



>gb|EAZ23846.1| hypothetical protein OsJ_07562 [Oryza sativa Japonica Group]
Length=496

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG+IFT LFA+K YV++++ G
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGVIFTALFARKEYVDQIF-G  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++ I+VI  WVS TM PLF +L+KL LLRIS+EDE  GMD
Sbjct  392  QPGRPYGLFMGGGGRLLGAHIVVILVIAAWVSFTMAPLFLVLNKLGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDED  587
             TRHGGFAYAYHD+D
Sbjct  452  QTRHGGFAYAYHDDD  466



>ref|NP_001047456.1| Os02g0620600 [Oryza sativa Japonica Group]
 sp|Q6K9G1.1|AMT12_ORYSJ RecName: Full=Ammonium transporter 1 member 2; Short=OsAMT1;2 
[Oryza sativa Japonica Group]
 dbj|BAD21534.1| putative ammonium transporter 1-3 [Oryza sativa Japonica Group]
 dbj|BAD21574.1| putative ammonium transporter 1-3 [Oryza sativa Japonica Group]
 dbj|BAF09370.1| Os02g0620600 [Oryza sativa Japonica Group]
 gb|EAY86727.1| hypothetical protein OsI_08109 [Oryza sativa Indica Group]
Length=496

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG+IFT LFA+K YV++++ G
Sbjct  333  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGVIFTALFARKEYVDQIF-G  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++ I+VI  WVS TM PLF +L+KL LLRIS+EDE  GMD
Sbjct  392  QPGRPYGLFMGGGGRLLGAHIVVILVIAAWVSFTMAPLFLVLNKLGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDED  587
             TRHGGFAYAYHD+D
Sbjct  452  QTRHGGFAYAYHDDD  466



>ref|XP_007162624.1| hypothetical protein PHAVU_001G166900g [Phaseolus vulgaris]
 gb|ESW34618.1| hypothetical protein PHAVU_001G166900g [Phaseolus vulgaris]
Length=488

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGC+AALTTLF KRL  GHWNV DVCNGLLGGFAAIT GC+VV+PWA
Sbjct  284  WSAVGRTAVTTTLAGCSAALTTLFAKRLQTGHWNVTDVCNGLLGGFAAITGGCAVVDPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N LA   KYDDPLEAAQLHGGCG WG+IFT LFAKK YVNEVYPG
Sbjct  344  AIICGFVAAWVLIGFNLLAEKLKYDDPLEAAQLHGGCGTWGIIFTALFAKKEYVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            L +RPYGLFMGGGG+LLAA ++QI+ I GWVS T+G +F+ML KL+LLR S ++E  G+D
Sbjct  404  LANRPYGLFMGGGGRLLAAHVVQILSIIGWVSVTIGAVFFMLFKLELLRTSHDEEMAGLD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            LT HGG AY YH++D++
Sbjct  464  LTSHGGMAYEYHEKDER  480



>gb|AAL05614.1|AF289479_1 ammonium transporter 1-3 [Oryza sativa]
Length=495

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  272  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  331

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG+IFT LFA+K YV++++ G
Sbjct  332  AIICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGVIFTALFARKEYVDQIF-G  390

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG+LL A ++ I+VI  WVS TM PLF +L+KL LLRIS+EDE  GMD
Sbjct  391  QPGRPYGLFMGGGGRLLGAHIVVILVIAAWVSFTMAPLFLVLNKLGLLRISAEDEMAGMD  450

Query  543  LTRHGGFAYAYHDED  587
             TRHGGFAYAYHD+D
Sbjct  451  QTRHGGFAYAYHDDD  465



>ref|XP_003555734.1| PREDICTED: ammonium transporter 1 member 1-like isoform 2 [Glycine 
max]
Length=500

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGSTAALTTLFGKRMISGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLI  NKLA   K+DDPLEAAQLHGGCGAWG+IFT LFAKK YV++VY  
Sbjct  345  AIVCGFVASVVLIACNKLAEKVKFDDPLEAAQLHGGCGAWGVIFTALFAKKEYVSQVYG-  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               R +GLFM GGGKLLAA +IQI+VI GWVSATMGPLF+ L+KLKLLRISSEDE  GMD
Sbjct  404  -EGRAHGLFMRGGGKLLAAHVIQILVIVGWVSATMGPLFWGLNKLKLLRISSEDELAGMD  462

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAYAY D++   SH  GI++
Sbjct  463  LTRHGGFAYAYEDDE---SHKHGIQL  485



>ref|XP_010511124.1| PREDICTED: ammonium transporter 1 member 2 [Camelina sativa]
Length=514

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTL+GCT+ALTTLF +RLL GHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  293  WSAVGRTAVTTTLSGCTSALTTLFSRRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  352

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+WVLIG N LA   KYDDPLEAAQLHGGCG WGL+FTGLFA K YVNEVY G
Sbjct  353  AIVCGFVASWVLIGFNLLAKKYKYDDPLEAAQLHGGCGGWGLVFTGLFATKRYVNEVYIG  412

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGGKLLAAQ++QI+VI GWV+ TMGPLFY LHK+ LLRIS+EDE  GMD
Sbjct  413  --DRPYGLLMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMD  470

Query  543  LTRHGGFAYAYHDEDDQSS  599
            +TRHGGFAYAY+DEDD S+
Sbjct  471  MTRHGGFAYAYNDEDDVST  489



>ref|XP_010674250.1| PREDICTED: ammonium transporter 1 member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=501

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS V RTAVTTTLAG TAALTTLFGKRL+VGHWNVIDVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  278  WSGVARTAVTTTLAGSTAALTTLFGKRLMVGHWNVIDVCNGLLGGFAAITAGCSVVEPWA  337

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVL+G NK+A   KYDDPLEAAQLH GCG WGL+FTGLFA   YV EVY  
Sbjct  338  AIVCGFVAAWVLMGLNKVAEKVKYDDPLEAAQLHAGCGMWGLLFTGLFATNRYVGEVYG-  396

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGG+LLAAQ+IQI+VIFGWV+ATM PLF +L KLKLLRISSE E  GMD
Sbjct  397  -PNRPYGLFMGGGGRLLAAQVIQILVIFGWVTATMAPLFLILKKLKLLRISSEHEMAGMD  455

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  456  MTRHGGFAYVYHDEDDPS  473



>emb|CAE01484.1| high affinity ammonium transporter [Lotus japonicus]
Length=506

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGC+AALTTLFGKRL  GHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  287  WSAIGRTAVTTTLAGCSAALTTLFGKRLQTGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG N LA    YDDPLEAAQLHGGCG WG+IFT LFAKK YVNEVY G
Sbjct  347  AIICGFVAAWVLIGCNVLAEKFHYDDPLEAAQLHGGCGTWGIIFTALFAKKQYVNEVYAG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LPDRPYGL MGGG +LLAA ++QI+ I GWVS TMG +F++LHKL LLRIS E+E  G+D
Sbjct  407  LPDRPYGLLMGGGWRLLAAHVVQILTIAGWVSVTMGAVFFVLHKLNLLRISPEEEMAGLD  466

Query  543  LTRHGGFAYAYHDE  584
            +T HGG AY YH++
Sbjct  467  MTSHGGLAYEYHED  480



>ref|XP_002516694.1| ammonium transporter, putative [Ricinus communis]
 gb|EEF45713.1| ammonium transporter, putative [Ricinus communis]
Length=486

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAIT GCSVV+PWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITGGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA    YDDPLEAAQLHGGCGAWG+IFT LFAK++YVNEVYPG
Sbjct  345  AIICGFVAAWVLIGCNKLAEKLHYDDPLEAAQLHGGCGAWGIIFTALFAKEAYVNEVYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMG G +LL A ++QI VI  WVS TMG LF++LHKLKLLRI  E+E  GMD
Sbjct  405  HPGRPYGLFMGSGARLLGAHIVQIFVIVAWVSVTMGTLFFILHKLKLLRIREEEEMAGMD  464

Query  543  LTRHGGFAYAY  575
            LT HGG AY Y
Sbjct  465  LTSHGGQAYEY  475



>gb|KDO55751.1| hypothetical protein CISIN_1g044248mg [Citrus sinensis]
Length=489

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 173/206 (84%), Gaps = 13/206 (6%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLI  NKLA   KYDDPLEAAQLHGGCGAWG+IFT L  ++         
Sbjct  344  AIVCGFVAAVVLIACNKLAEKAKYDDPLEAAQLHGGCGAWGVIFTALLLRR---------  394

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              + PYGLFMGGGGKLLAA +IQI+V+ GWVSATMGPLF++LHKLKLLRIS EDE  GMD
Sbjct  395  --NSPYGLFMGGGGKLLAAHVIQILVVAGWVSATMGPLFFILHKLKLLRISPEDEMAGMD  452

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+DD  S+  GI++
Sbjct  453  LTRHGGFAYVYHDDDDVQSN--GIQL  476



>ref|XP_006648843.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2-like [Oryza brachyantha]
Length=484

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 169/196 (86%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  254  WSAVGRTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  313

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N L+A  K+DDPLEAAQLHGGCGAWG+IFT LFA++ YV +V  G
Sbjct  314  AIICGFVSAWVLIGLNALSARLKFDDPLEAAQLHGGCGAWGVIFTALFARREYVEQVL-G  372

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LL A ++ I+VI  WVS TM PLF +L+KL LLRIS+EDE  GMD
Sbjct  373  QTGRPYGLFMGGGGRLLGAHIVVILVIAAWVSFTMAPLFLVLNKLGLLRISAEDEMAGMD  432

Query  543  LTRHGGFAYAYHDEDD  590
             TRHGGFAYAYHDEDD
Sbjct  433  QTRHGGFAYAYHDEDD  448



>ref|XP_003580115.1| PREDICTED: ammonium transporter 1 member 1 [Brachypodium distachyon]
Length=495

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  273  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG N LAA  KYDDPLEAAQLHGGCGAWG+IFT LFAK+ YV ++Y  
Sbjct  333  AVICGFVSAWVLIGLNALAARLKYDDPLEAAQLHGGCGAWGVIFTALFAKQKYVEQIYGA  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLFMGGGG+LLAA ++QI+VI GWV+ TMGPLFY L KL LLRIS+EDET GMD
Sbjct  393  --GRPYGLFMGGGGRLLAAHVVQILVIAGWVTCTMGPLFYALKKLGLLRISAEDETAGMD  450

Query  543  LTRHGGFAYAY  575
            LTRHGGFAY Y
Sbjct  451  LTRHGGFAYVY  461



>emb|CDY35209.1| BnaA01g08220D [Brassica napus]
Length=502

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  291  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITGGCSVVEPWA  350

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   +YDDPLEAAQLHGGCGAWG+IFTGLFA K+YV+EV+ G
Sbjct  351  AVICGFVAAWVLMGFNKLADKLRYDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEVFGG  410

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGG +LLAA ++QIVVI GWVS TMG LF++LHKL++LRI SEDE  GMD
Sbjct  411  DPNRPYGLLMGGGWRLLAAHVVQIVVITGWVSVTMGTLFFVLHKLEMLRIPSEDEVAGMD  470

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +E+ ++
Sbjct  471  PTSHGGLAYMYTEEEIRN  488



>ref|XP_009129394.1| PREDICTED: ammonium transporter 1 member 4 [Brassica rapa]
Length=501

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  290  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITGGCSVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   +YDDPLEAAQLHGGCGAWG+IFTGLFA K+YV+EV+ G
Sbjct  350  AVICGFVAAWVLMGFNKLADKLRYDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEVFGG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGG +LLAA ++QIVVI GWVS TMG LF++LHKL+LLRI SEDE  GMD
Sbjct  410  DPNRPYGLLMGGGWRLLAAHVVQIVVITGWVSVTMGTLFFVLHKLELLRIPSEDEIAGMD  469

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +E+ ++
Sbjct  470  PTSHGGLAYMYTEEEIRN  487



>dbj|BAJ23885.1| putative ammonium transporter, partial [Camellia sinensis]
Length=311

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLF  R++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  97   WSAVGRTAVTTTLAGSTAALTTLFLNRVVSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  156

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CG VAA VLIG NK+A   K+DDPLEAAQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  157  AVICGLVAALVLIGCNKVAERVKFDDPLEAAQLHGGCGAWGVIFTALFASEKYVNEVYPG  216

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGG+LLAA +IQIVVI GWVS TMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  217  KSDRPYGLLMGGGGRLLAAHVIQIVVIVGWVSVTMGPLFFVLHKLKLLRISAEDEIAGMD  276

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAY Y   D+  S+  G++M
Sbjct  277  MTRHGGFAYVYQYHDEDESNKLGMQM  302



>emb|CDY38368.1| BnaC01g09770D [Brassica napus]
Length=501

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  290  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITGGCSVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   +YDDPLEAAQLHGGCGAWG+IFTGLFA K+YV+E++ G
Sbjct  350  AVICGFVAAWVLMGFNKLADKLRYDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEIFGG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGG +LLAA ++QIVVI GWVS TMG LF++LHKL+LLRI SEDE  GMD
Sbjct  410  DPNRPYGLLMGGGWRLLAAHVVQIVVITGWVSVTMGTLFFVLHKLELLRIPSEDEIAGMD  469

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +E+ ++
Sbjct  470  PTSHGGLAYMYTEEEIRN  487



>ref|XP_001758599.1| predicted protein [Physcomitrella patens]
 gb|EDQ76577.1| predicted protein [Physcomitrella patens]
Length=503

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG TA +TTLFGKRLL GHWNV+DVCNG+LGGFAAIT+ C+VV PWA
Sbjct  289  WSGVGRTAVTTTLAGSTAGVTTLFGKRLLDGHWNVLDVCNGVLGGFAAITASCAVVSPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGF AAWVLIG N+LAA   YDDPLEAAQLH GCGAWGL+F GLFA+K+YV ++Y G
Sbjct  349  SIICGFGAAWVLIGFNRLAARFHYDDPLEAAQLHAGCGAWGLLFVGLFAEKNYVQQIYGG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRP+GLFMGGGG+LLAAQ++QI+ I GWV+ TMGPLF  LH+ +LLRISSEDE  GMD
Sbjct  409  NADRPFGLFMGGGGRLLAAQIVQILAITGWVTVTMGPLFLALHRFRLLRISSEDEIAGMD  468

Query  543  LTRHGGFAYAYHDEDDQSSHYP  608
            LTRHGG AY ++D  +Q  H+ 
Sbjct  469  LTRHGGTAYIHNDGSEQLVHFT  490



>ref|XP_010024929.1| PREDICTED: ammonium transporter 1 member 2 [Eucalyptus grandis]
Length=822

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLF KRLLVGHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  594  WSAVGRTAVTTTLAGSTAALTTLFSKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVDPWA  653

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG NKLA + K+DDPLEAAQLHGGCGAWGLIFTGLFA++ YV+EVY G
Sbjct  654  AIVCGFVSAWVLIGCNKLAELAKFDDPLEAAQLHGGCGAWGLIFTGLFARRRYVDEVYGG  713

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               R YG F+GG G+LLAAQ+++++ I GWV+ATMGPLFY LH+L+LLR+S +DE  GMD
Sbjct  714  -SGRRYGWFVGGDGRLLAAQVVEVLAIAGWVTATMGPLFYGLHRLELLRVSGDDEKEGMD  772

Query  543  LTRHGGFAYAYHDE  584
            LTRHGG AY YHD+
Sbjct  773  LTRHGGLAYVYHDD  786



>ref|XP_003572721.1| PREDICTED: ammonium transporter 1 member 2 [Brachypodium distachyon]
Length=502

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGR AVTTTLAG TAALTTLFGKRL   HWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  274  WSAVGRAAVTTTLAGSTAALTTLFGKRLQTDHWNVLDVCNGLLGGFAAITAGCSVVDPWA  333

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG N+LAA  ++DDPLEAAQLHGGCGAWG++FT LFA+K YV ++Y G
Sbjct  334  AIVCGFVSAWVLIGLNRLAARFRFDDPLEAAQLHGGCGAWGVVFTALFARKEYVEQIYGG  393

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLFMGGGG++L A ++ I+VI  WVS TMGPLF  L+K+ LLR+S+EDE  GMD
Sbjct  394  -PGRPYGLFMGGGGRMLGAHVVLILVIAAWVSCTMGPLFLALNKMGLLRVSAEDEMAGMD  452

Query  543  LTRHGGFAYAYHDEDDQS  596
             TRHGGFAYAY DED  S
Sbjct  453  QTRHGGFAYAYTDEDASS  470



>ref|XP_009135885.1| PREDICTED: LOW QUALITY PROTEIN: putative ammonium transporter 
1 member 5 [Brassica rapa]
Length=500

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKR L GHW V DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRFLSGHWMVSDVCNGLLGGFAAITAGCSVVEPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + KYD PLEAAQLHGGCGAWG +F GLFA ++ VN ++  
Sbjct  342  AIVCGFIASIVLIGCNKLAELLKYDVPLEAAQLHGGCGAWGGVFVGLFANENDVNXLFGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGGKLL AQ++QIVVI GWVSATMG LF++L +L LLRIS+ DE  GMD
Sbjct  402  SPGRHYGLFMGGGGKLLGAQLVQIVVIVGWVSATMGTLFFILKQLNLLRISANDEMRGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIK  617
            + RHGGFAY YHD DD S  +PG+ 
Sbjct  462  IARHGGFAYIYHDNDDDSIQFPGMT  486



>ref|XP_007207384.1| hypothetical protein PRUPE_ppa004450mg [Prunus persica]
 gb|EMJ08583.1| hypothetical protein PRUPE_ppa004450mg [Prunus persica]
Length=509

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLL GHWNV+DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  289  WSAIGRTAVTTTLAGCTAALTTLFSKRLLAGHWNVLDVCNGLLGGFAAITSGCSVVEPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGLIFTGLFA ++YVNEVY G
Sbjct  349  AIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEAYVNEVYAG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RP+GL MGGGGKLLAAQ++Q++V+  WVSATMGPLFY LHKLKLLRIS EDET GMD
Sbjct  409  KPGRPFGLLMGGGGKLLAAQIVQVLVVLVWVSATMGPLFYGLHKLKLLRISREDETQGMD  468

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHDEDD S
Sbjct  469  MTRHGGFAYVYHDEDDPS  486



>gb|AHI94951.1| ammonium transporter 1.1 [Pinus pinaster]
Length=527

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 173/207 (84%), Gaps = 4/207 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAGC+AALTTLFG+RLL GHWNV+DVCNGLLGGFAAIT GCS+V+PWA
Sbjct  290  WTAIGRTAVTTTLAGCSAALTTLFGRRLLTGHWNVLDVCNGLLGGFAAITGGCSIVDPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LA   KYDDPLEAAQLHGGCGAWG+IFT LFAK+ Y+ + Y  
Sbjct  350  AILCGFVSAWVLIGFNILAGKMKYDDPLEAAQLHGGCGAWGIIFTALFAKEEYILQAYGL  409

Query  363  LPD----RPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDET  530
            LP+    RP GLFMGG G+LLAA +IQI+V  GWV+ATM P+FY+LH+ KLLR+S+ DE 
Sbjct  410  LPNGKSSRPSGLFMGGDGRLLAAHVIQIIVTTGWVTATMAPVFYVLHRFKLLRVSAADEM  469

Query  531  HGMDLTRHGGFAYAYHDEDDQSSHYPG  611
             GMD+TRHGG AY YHD DD    +PG
Sbjct  470  AGMDVTRHGGGAYVYHDSDDDKHIHPG  496



>ref|XP_008447358.1| PREDICTED: ammonium transporter 1 member 2 [Cucumis melo]
Length=482

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCAVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK++YVNE+YPG
Sbjct  345  AIVCGFFAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGILFTGLFAKQAYVNEIYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LP+RPYG+ MGGGG LLAA ++QI+ I GWVS TMG +F++LHK +LLRI++E+E  GMD
Sbjct  405  LPERPYGMLMGGGGWLLAAHLVQILSIVGWVSVTMGVVFWLLHKFELLRITAEEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQ  593
            LT HGG AY Y+DE+++
Sbjct  465  LTSHGGLAYVYNDEEEK  481



>ref|XP_004493882.1| PREDICTED: ammonium transporter 1 member 4-like [Cicer arietinum]
Length=493

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKR+  GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRIQTGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAA VLIG N LA   +YDDPLEAAQLHGGCG WG+IFT LFAKK YVNEVY G
Sbjct  345  AMICGFVAACVLIGCNLLAEKFQYDDPLEAAQLHGGCGTWGIIFTALFAKKQYVNEVYSG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGL MGGG +LLAA ++QI+ I  WVS TMG +F++L KL LLRIS E+E  G+D
Sbjct  405  SPDRPYGLLMGGGVRLLAAHVVQILSIVAWVSVTMGTMFFVLQKLNLLRISPEEEMAGLD  464

Query  543  LTRHGGFAYAYHDEDDQS  596
            LT HGG AY YH+E DQ 
Sbjct  465  LTSHGGLAYEYHEEADQE  482



>ref|XP_010934227.1| PREDICTED: ammonium transporter 1 member 2-like [Elaeis guineensis]
Length=514

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL  GHWNVIDVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  286  WSAVGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVLIG NKLAA  K DDPLEAAQLHGGCGAWG+IFT LFA++ YVNEVYPG
Sbjct  346  AVICGFVAAWVLIGLNKLAAKVKLDDPLEAAQLHGGCGAWGIIFTALFAREKYVNEVYPG  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGL MGGGG+LL A +++I+VI GWVS TMGPLF+ LH++ LLRISSEDE  GMD
Sbjct  406  RPGRPYGLLMGGGGRLLGAHIVEILVIAGWVSCTMGPLFFALHRIGLLRISSEDEMAGMD  465

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGFAY Y  ED  S
Sbjct  466  LTRHGGFAYVYDAEDSAS  483



>ref|XP_010693997.1| PREDICTED: ammonium transporter 1 member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=499

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGC AALTTLFGKRLL GHWNV DVCNGLLGGFAAITSGCSVV+PWA
Sbjct  290  WSAIGRTAVTTTLAGCMAALTTLFGKRLLSGHWNVKDVCNGLLGGFAAITSGCSVVDPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLIG+NKLA   KYDDPLEAAQLHGGCGAWG++FT LFA K YVNEVYP 
Sbjct  350  AIICGFVAAGVLIGSNKLAERYKYDDPLEAAQLHGGCGAWGVLFTALFANKQYVNEVYPS  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GL MGGGG+LLAA ++QI+ I GWVS TMGPLF+ LHKLKLLRIS +DE  GMD
Sbjct  410  EHGRPFGLLMGGGGRLLAAHIVQILAIIGWVSFTMGPLFFFLHKLKLLRISPDDEIEGMD  469

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGGFAYAYHDE D +  
Sbjct  470  LTRHGGFAYAYHDEGDSNQR  489



>ref|XP_001785500.1| predicted protein [Physcomitrella patens]
 gb|EDQ49707.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAGCTAA+TTLFGKR L GHWNV+DVCNGLLGGFAAIT+ CSVV PWA
Sbjct  289  WSGVGRTAVTTTLAGCTAAVTTLFGKRFLDGHWNVLDVCNGLLGGFAAITASCSVVAPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGF +AWVLIG NKLAA   +DDPLEAAQLHGGCGAWGL+F GLFA+K+YVN+VY  
Sbjct  349  SILCGFGSAWVLIGLNKLAARLHFDDPLEAAQLHGGCGAWGLLFVGLFAEKNYVNQVYQT  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGLFMGGGGKLLAAQ+I+I+ I  WV+ TMGPLFY LHK +LLRI+ +DE  GMD
Sbjct  409  TFDRPYGLFMGGGGKLLAAQIIEIISIAAWVTVTMGPLFYGLHKFRLLRITPQDEIAGMD  468

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGG AY +HD  + 
Sbjct  469  VTRHGGTAYIHHDNSEH  485



>gb|KFK39731.1| hypothetical protein AALP_AA3G280700 [Arabis alpina]
Length=491

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFVASLVLIGCNKLAEILQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGK  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL +GGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRISSEDET GMD
Sbjct  403  TTGRPYGLLLGGGGKLLGAQLVQILVVVGWVSATMGTLFFILKKLNLLRISSEDETAGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD D++S
Sbjct  463  MTRHGGFAYIYHDNDEES  480



>dbj|BAD36826.1| putative ammonium transporter [Camellia sinensis]
Length=497

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLF  R++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSAVGRTAVTTTLAGSTAALTTLFLNRVVSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CG VAA VLIG NK+A   K+DDPLEAAQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  343  AVICGLVAALVLIGCNKVAERVKFDDPLEAAQLHGGCGAWGVIFTALFASEKYVNEVYPG  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGG+LLAA +IQIVVI GWVS TMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  403  KSDRPYGLLMGGGGRLLAAHVIQIVVIVGWVSVTMGPLFFVLHKLKLLRISAEDEIAGMD  462

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAY Y   D+  S+  G++M
Sbjct  463  MTRHGGFAYVYQYHDEDESNKLGMQM  488



>ref|XP_004134393.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis sativus]
 ref|XP_004166732.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis sativus]
 gb|KGN56796.1| hypothetical protein Csa_3G133960 [Cucumis sativus]
Length=500

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRFLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLI  N++A + KYDDPLEAAQLHGGCGAWG+IFT LFA + YV EVY G
Sbjct  344  AIICGFVAAIVLITCNRIAEIVKYDDPLEAAQLHGGCGAWGVIFTALFATEEYVTEVYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGG+LLAA +IQI+VI GWVSATMGPLFY+LHKLKLLRIS+EDE  GMD
Sbjct  404  -SGRPYGLLMGGGGRLLAAHLIQILVIVGWVSATMGPLFYVLHKLKLLRISTEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDD  590
            LTRHGGFAY YHDED+
Sbjct  463  LTRHGGFAYIYHDEDE  478



>gb|AAM95453.1| Ammonium transporter [Lotus japonicus]
Length=518

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLF KRLL GHW V+DVCNGLLGGFAAITSGCSVVEPW 
Sbjct  290  WSAIGRTAVTTTLAGCTAALTTLFSKRLLEGHWKVLDVCNGLLGGFAAITSGCSVVEPWP  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG N +AA  KYDDPLEAAQLHGGCGAWG++FTGLFAK  YV EVY G
Sbjct  350  AIVCGFVAAWVLIGLNLVAAKMKYDDPLEAAQLHGGCGAWGVLFTGLFAKGEYVAEVY-G  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGGKLLAAQ+I+I+V+ GWV+ATMGPLFY LHK KLLRIS +DET GMD
Sbjct  409  SAGRPYGLLMGGGGKLLAAQVIEILVVCGWVTATMGPLFYGLHKTKLLRISEDDETAGMD  468

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LTRHGGFAYAYHD+DD S+
Sbjct  469  LTRHGGFAYAYHDDDDVST  487



>ref|XP_001786055.1| predicted protein [Physcomitrella patens]
 gb|EDQ49134.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAGCTAA+TTLFGKR L GHWNV+DVCNGLLGGFAAIT+ CSVV PWA
Sbjct  279  WSGVGRTAVTTTLAGCTAAVTTLFGKRFLDGHWNVLDVCNGLLGGFAAITASCSVVAPWA  338

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGF +AWVLIG NKLAA   +DDPLEAAQLHGGCGAWGL+F GLFA+K+YVN+VY  
Sbjct  339  SILCGFGSAWVLIGLNKLAARLHFDDPLEAAQLHGGCGAWGLLFVGLFAEKNYVNQVYQT  398

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              D PYGLFMGGGGKLLAAQ+I+I+ I  WV+ TMGPLFY LHK +LLRI+ +DE  GMD
Sbjct  399  TFDSPYGLFMGGGGKLLAAQIIEIISIAAWVTVTMGPLFYGLHKFRLLRITPQDEIAGMD  458

Query  543  LTRHGGFAYAYHDEDDQ  593
            +TRHGG AY +HD  + 
Sbjct  459  VTRHGGTAYIHHDNSEH  475



>ref|XP_010422098.1| PREDICTED: putative ammonium transporter 1 member 5 [Camelina 
sativa]
Length=425

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  208  WSGIGRTAVTTTLSGCTAALTTLFGKRLISGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  267

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  
Sbjct  268  AIVCGFVASLVLIGCNKLAELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGA  327

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGL MGGGGKLL AQ++QI+VI GWVSATMG LF++L +L LLRIS  DE  GMD
Sbjct  328  SPGRHYGLLMGGGGKLLGAQLVQIIVIVGWVSATMGTLFFILKQLDLLRISEHDEMQGMD  387

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIK  617
            + RHGGFAY YHD DD S  +P + 
Sbjct  388  IARHGGFAYIYHDNDDDSIQFPRVT  412



>gb|KGN58313.1| hypothetical protein Csa_3G611380 [Cucumis sativus]
Length=481

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCAVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK++YVNE+YPG
Sbjct  345  AIVCGFFAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGILFTGLFAKQAYVNEIYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LP+RPYG+ MGGGG LLAA ++QI+ I GWVS TMG +F++LHK +LLRI +E E  GMD
Sbjct  405  LPERPYGMLMGGGGWLLAAHLVQILSIVGWVSVTMGIVFWLLHKFELLRIKAEAEMAGMD  464

Query  543  LTRHGGFAYAYHDEDD  590
            LT HGG AY Y+DE+ 
Sbjct  465  LTSHGGLAYVYNDEEK  480



>ref|XP_001758603.1| predicted protein [Physcomitrella patens]
 gb|EDQ76581.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG TA +TTLFGKRLL GHWNV+DVCNG+LGGFAAIT+ C+VV PWA
Sbjct  289  WSGVGRTAVTTTLAGSTAGVTTLFGKRLLDGHWNVLDVCNGVLGGFAAITASCAVVSPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGF AAWVLIG NKLAA   YDDPLEAAQLH GCGAWGL+F GLFA+K+YV ++Y G
Sbjct  349  SIICGFGAAWVLIGLNKLAARFHYDDPLEAAQLHAGCGAWGLLFVGLFAEKNYVQQIYGG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGLFMGGGGKLLAAQ+++I+ I GWVS TMG LF  L K KLLRIS EDE  GMD
Sbjct  409  DPERPYGLFMGGGGKLLAAQIVEILAITGWVSVTMGLLFLGLQKFKLLRISPEDEVAGMD  468

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIK  617
            LTRHGG AY + D  +   H   I 
Sbjct  469  LTRHGGTAYIHQDGSEHIMHMSTIN  493



>gb|AHI94953.1| ammonium transporter 1.3 [Pinus pinaster]
Length=512

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAGC+AALTTLFG+RL+ GHWNV++VCNGLLGGFAAIT GCS+VEPWA
Sbjct  290  WTAIGRTAVTTTLAGCSAALTTLFGRRLITGHWNVLNVCNGLLGGFAAITGGCSMVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFV+AWVLIG N LAA  KYDDPLEAAQLHGGCGAWG+IFT LFAK+ YV +VY  
Sbjct  350  AIVCGFVSAWVLIGFNILAAKMKYDDPLEAAQLHGGCGAWGIIFTALFAKEEYVFQVYGL  409

Query  363  LPD----RPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDET  530
             PD    RPYGLFMGGGG+LLAA +IQI+V  GWV+ATM P FY+LHK  LLR+S +DE 
Sbjct  410  SPDGISSRPYGLFMGGGGRLLAAHIIQILVTAGWVTATMAPAFYILHKFNLLRVSGDDEM  469

Query  531  HGMDLTRHGGFAYAYHDED  587
             GMD T HGG AY +HD D
Sbjct  470  AGMDKTSHGGVAYVFHDGD  488



>gb|KGN61309.1| hypothetical protein Csa_2G079120 [Cucumis sativus]
Length=511

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 173/206 (84%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFTKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLI  NKLA    YDDPLEAAQLHGGCGAWGL+FTGLFA+K YV EVY  
Sbjct  346  AVICGFVASWVLISFNKLAEKVNYDDPLEAAQLHGGCGAWGLLFTGLFARKEYVAEVYQA  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGG+LLAAQ+I+I+ I GWVS TMGPLFY L  +KLLRIS EDE  GMD
Sbjct  406  --GRPYGLLMGGGGRLLAAQLIEILAIIGWVSVTMGPLFYALKNMKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DEDD S    G  M
Sbjct  464  LTRHGGFAYVYNDEDDLSGKPSGFMM  489



>ref|XP_004165457.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2-like [Cucumis sativus]
Length=511

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 173/206 (84%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNVIDVCNGLLGGFAAITSGC+VVEPWA
Sbjct  286  WSAIGRTGVTTTLAGCTAALTTLFTKRLLVGHWNVIDVCNGLLGGFAAITSGCAVVEPWA  345

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVA+WVLI  NKLA    YDDPLEAAQLHGGCGAWGL+FTGLFA+K YV EVY  
Sbjct  346  AVICGFVASWVLISFNKLAEKVNYDDPLEAAQLHGGCGAWGLLFTGLFARKEYVAEVYQA  405

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGG+LLAAQ+I+I+ I GWVS TMGPLFY L  +KLLRIS EDE  GMD
Sbjct  406  --GRPYGLLMGGGGRLLAAQLIEILAIIGWVSVTMGPLFYALKNMKLLRISREDEMAGMD  463

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y+DEDD S    G  M
Sbjct  464  LTRHGGFAYVYNDEDDLSGKPSGFMM  489



>ref|XP_010513375.1| PREDICTED: ammonium transporter 1 member 3-like [Camelina sativa]
Length=498

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+A+ VLIG NKLA + ++DDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMASLVLIGCNKLAELVRFDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGA  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGL MGGGGKLL AQ++QI+V+ GWVSATMG LF++L KL LLRIS +DE  GMD
Sbjct  403  TPGRPYGLLMGGGGKLLGAQLVQILVVIGWVSATMGTLFFILKKLNLLRISEKDEMQGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY YHD DD+S
Sbjct  463  MTRHGGFAYIYHDNDDES  480



>ref|XP_004152067.1| PREDICTED: ammonium transporter 1 member 2-like [Cucumis sativus]
Length=534

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  285  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCAVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK++YVNE+YPG
Sbjct  345  AIVCGFFAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGILFTGLFAKQAYVNEIYPG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LP+RPYG+ MGGGG LLAA ++QI+ I GWVS TMG +F++LHK +LLRI +E E  GMD
Sbjct  405  LPERPYGMLMGGGGWLLAAHLVQILSIVGWVSVTMGIVFWLLHKFELLRIKAEAEMAGMD  464

Query  543  LTRHGGFAYAYHDEDD  590
            LT HGG AY Y+DE++
Sbjct  465  LTSHGGLAYVYNDEEN  480



>ref|XP_004173150.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2-like [Cucumis sativus]
Length=478

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRLLVGHWNV DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  282  WSAIGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCAVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK++YVNE+YPG
Sbjct  342  AIVCGFFAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGILFTGLFAKQAYVNEIYPG  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            LP+RPYG+ MGGGG LLAA ++QI+ I GWVS TMG +F +LHK +LLRI +E E  GMD
Sbjct  402  LPERPYGMLMGGGGWLLAAHLVQILSIVGWVSVTMGIVFXLLHKFELLRIKAEAEMAGMD  461

Query  543  LTRHGGFAYAYHDEDD  590
            LT HGG AY Y+DE+ 
Sbjct  462  LTSHGGLAYVYNDEEK  477



>ref|XP_010490105.1| PREDICTED: putative ammonium transporter 1 member 5 [Camelina 
sativa]
Length=326

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  12   VGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWAAIV  191
            +GR    TTL+GCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT+GCSVV+PWAAIV
Sbjct  112  IGRHNFATTLSGCTAALTTLFGKRLISGHWNVTDVCNGLLGGFAAITAGCSVVDPWAAIV  171

Query  192  CGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPGLPD  371
            CGF+A+ VLIG NKLA   KYDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  +P 
Sbjct  172  CGFMASLVLIGCNKLAEFLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGAIPG  231

Query  372  RPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMDLTR  551
            R YGL MGGGGKLL AQ++QI+VI GWVSATMG LF++L +L LLRIS  DE  GMD+ R
Sbjct  232  RHYGLLMGGGGKLLGAQLVQIIVIVGWVSATMGTLFFILKQLDLLRISEHDEMQGMDIAR  291

Query  552  HGGFAYAYHDEDDQSSHYPGI  614
            HGGFAY YHD DD+S  +P +
Sbjct  292  HGGFAYIYHDNDDESIQFPRV  312



>ref|XP_008438437.1| PREDICTED: ammonium transporter 1 member 1-like [Cucumis melo]
Length=500

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKR L GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  284  WSAVGRTAVTTTLAGCTAALTTLFGKRFLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLI  N++A   KYDDPLEAAQLHGGCGAWG+IFT LFA + YV EVY G
Sbjct  344  AIICGFVAAVVLISCNRIAEKVKYDDPLEAAQLHGGCGAWGVIFTALFATEEYVTEVYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGG+LLAA +IQI+VI GWVSATMGPLFY+LHKLKLLRIS+EDE  GMD
Sbjct  404  -SGRPYGLLMGGGGRLLAAHLIQILVIVGWVSATMGPLFYVLHKLKLLRISTEDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDD  590
            LTRHGGFAY YHDED+
Sbjct  463  LTRHGGFAYIYHDEDE  478



>ref|XP_010466828.1| PREDICTED: putative ammonium transporter 1 member 5 [Camelina 
sativa]
Length=499

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRL+ GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  282  WSGIGRTAVTTTLSGCTAALTTLFGKRLISGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  341

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFAK+ YVNEVY  
Sbjct  342  AIVCGFVASLVLIGCNKLAELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYVNEVYGA  401

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGL MGGGGKLL AQ++QI+VI GWVSATMG LF++L KL LLRIS  DE  GMD
Sbjct  402  SPGRHYGLLMGGGGKLLGAQLVQIIVIVGWVSATMGTLFFILKKLDLLRISEHDEMQGMD  461

Query  543  LTRHGGFAYAYHDEDDQSSHYPGI  614
            + RHGGFAY YHD DD+S  +P +
Sbjct  462  IARHGGFAYIYHDNDDESIQFPRV  485



>gb|AES61174.2| ammonium transporter 1 protein [Medicago truncatula]
Length=519

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  288  WSAIGRTGVTTTLAGCTAALTTLFSKRLLVGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  347

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK  YV+E+Y  
Sbjct  348  AIVCGFVAAWVLIGLNKLAIKVKYDDPLEAAQLHGGCGAWGVLFTGLFAKGEYVDEIYG-  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGG+L AAQ+++++VI GWV+ TM PLFY L+K+KLLRIS +DET GMD
Sbjct  407  -VGRPYGLLMGGGGRLFAAQVVEVLVICGWVTVTMVPLFYGLNKMKLLRISRDDETAGMD  465

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LTRHGGFAYAYHDE+D  S
Sbjct  466  LTRHGGFAYAYHDEEDDES  484



>ref|XP_006418766.1| hypothetical protein EUTSA_v10002502mg [Eutrema salsugineum]
 gb|ESQ37202.1| hypothetical protein EUTSA_v10002502mg [Eutrema salsugineum]
Length=486

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTL+GCTAALTTLFGKRLL GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  267  WSGIGRTAVTTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVQPWA  326

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLIG NKLA + KYDDPLEAAQLHGGCGAWGLIF GLFA + Y+NEVY  
Sbjct  327  AIVCGFVASLVLIGCNKLAEILKYDDPLEAAQLHGGCGAWGLIFVGLFANEKYINEVYGA  386

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGL MGGGGKLL AQ++QI+VI GWVSATMG LF++L KLKLLRIS +DE  GMD
Sbjct  387  GPGRRYGLLMGGGGKLLGAQVVQILVIVGWVSATMGTLFFILKKLKLLRISEKDEMRGMD  446

Query  543  LTRHGGFAYAYHD-EDDQSSHYPGIK  617
            + RHGGFAY YHD  DD+SS +P + 
Sbjct  447  IARHGGFAYIYHDNNDDESSQFPRVS  472



>ref|XP_002303104.1| hypothetical protein POPTR_0002s25640g [Populus trichocarpa]
 gb|EEE82377.1| hypothetical protein POPTR_0002s25640g [Populus trichocarpa]
Length=495

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAG +AALTTLFGKR+L G+WNV DVCNGLLGGFAAITSGC+VV+PWA
Sbjct  285  WSAIGRTAVTTTLAGSSAALTTLFGKRMLAGNWNVTDVCNGLLGGFAAITSGCAVVDPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA    YDDPLEAAQLHGGCGAWG+IFT LFAK++YVNE+Y G
Sbjct  345  AIICGFVAAWVLIGCNKLADKFHYDDPLEAAQLHGGCGAWGIIFTALFAKETYVNEIYSG  404

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGL MGGGG+LLAA M+QI+VI GWVS TMG LF++LHK KLLRIS+++E  GMD
Sbjct  405  KPGRPYGLLMGGGGRLLAAHMVQILVITGWVSVTMGTLFWILHKFKLLRISADEEMAGMD  464

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LT HGG AYAY+DE D +       M
Sbjct  465  LTSHGGLAYAYYDEHDDAMQKKSFMM  490



>ref|XP_010038760.1| PREDICTED: ammonium transporter 1 member 4-like [Eucalyptus grandis]
 gb|KCW47666.1| hypothetical protein EUGRSUZ_K01403 [Eucalyptus grandis]
Length=484

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKRLLVGHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  284  WSAVGRTAVTTTLAGSTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWGL+FTGLFAKK+YVNEVYPG
Sbjct  344  AIICGFVAAWVLIGFNKLAEKLKYDDPLEAAQLHGGCGAWGLLFTGLFAKKAYVNEVYPG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            + DRPYGL MGGGG LLAAQ++QI+V+  W S TMG LF++LHK+KLLRIS ++E  GMD
Sbjct  404  VEDRPYGLLMGGGGGLLAAQVVQILVVAAWTSVTMGTLFFILHKMKLLRISHDEEAAGMD  463

Query  543  LTRHGGFA  566
            LT HGG A
Sbjct  464  LTSHGGLA  471



>ref|XP_001758600.1| predicted protein [Physcomitrella patens]
 gb|EDQ76578.1| predicted protein [Physcomitrella patens]
Length=504

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG TA +TTLFGKRLL GHWNV+DVCNG+LGGFAAIT+ C+VV PWA
Sbjct  289  WSGVGRTAVTTTLAGSTAGVTTLFGKRLLDGHWNVLDVCNGVLGGFAAITASCAVVSPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGF AAWVLIG N+LAA   YDDPLEAAQLH GCGAWGL+F GLFA+K+YV ++Y G
Sbjct  349  SIICGFGAAWVLIGFNRLAARYHYDDPLEAAQLHAGCGAWGLLFVGLFAEKNYVQQIYGG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RP+GLFMGGGG+LLAAQ++QI+ I GWV+ TMGPLF  LHK +LLRI+ EDE  GMD
Sbjct  409  -DSRPFGLFMGGGGRLLAAQIVQILAITGWVTVTMGPLFLALHKFRLLRITPEDEIAGMD  467

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIK  617
            LTRHGG AY + D  +   H   I 
Sbjct  468  LTRHGGTAYIHQDGSEHVMHLSTIN  492



>ref|XP_009102522.1| PREDICTED: ammonium transporter 1 member 3 [Brassica rapa]
Length=504

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHW V DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWAVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAA VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFVAALVLIGCNKLAEIVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGE  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGL MGGGGKLL AQ++QI+V+ GWVSATMG LF++L +L LLRIS +DE  GMD
Sbjct  403  TPGRPYGLLMGGGGKLLGAQLVQILVVAGWVSATMGTLFFLLKRLGLLRISEKDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+D DD+S
Sbjct  463  MTRHGGFAYMYYDNDDES  480



>ref|XP_006647528.1| PREDICTED: ammonium transporter 1 member 3-like [Oryza brachyantha]
Length=499

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA GRTAVTT++AG  AALTTL+GKR L GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  275  WSAGGRTAVTTSIAGSVAALTTLYGKRWLTGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  334

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVY--  356
            +++CGFV+AWVLIG NKLA + K+DDPLEA QLHGGCGAWG+IFT LFA+K YV ++Y  
Sbjct  335  SVICGFVSAWVLIGCNKLAVMLKFDDPLEATQLHGGCGAWGVIFTALFARKEYVEQIYGQ  394

Query  357  PGLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHG  536
            PG   RPYGLFMGGGG+LLAA ++QI+VI GWVSATMG LFY+LH+L LLR+S+  E  G
Sbjct  395  PG-KKRPYGLFMGGGGRLLAAHIVQILVIVGWVSATMGTLFYVLHRLGLLRVSAAQEMDG  453

Query  537  MDLTRHGGFAYAYHDEDDQ  593
            MD T HGGF Y   DE ++
Sbjct  454  MDPTSHGGFGYVDEDEGER  472



>ref|XP_003590924.1| Ammonium transporter [Medicago truncatula]
Length=824

 Score =   274 bits (701),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  593  WSAIGRTGVTTTLAGCTAALTTLFSKRLLVGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  652

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK  YV+E+Y G
Sbjct  653  AIVCGFVAAWVLIGLNKLAIKVKYDDPLEAAQLHGGCGAWGVLFTGLFAKGEYVDEIY-G  711

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +  RPYGL MGGGG+L AAQ+++++VI GWV+ TM PLFY L+K+KLLRIS +DET GMD
Sbjct  712  V-GRPYGLLMGGGGRLFAAQVVEVLVICGWVTVTMVPLFYGLNKMKLLRISRDDETAGMD  770

Query  543  LTRHGGFAYAYHDEDDQSS  599
            LTRHGGFAYAYHDE+D  S
Sbjct  771  LTRHGGFAYAYHDEEDDES  789



>ref|NP_001047455.1| Os02g0620500 [Oryza sativa Japonica Group]
 sp|Q6K9G3.1|AMT13_ORYSJ RecName: Full=Ammonium transporter 1 member 3; Short=OsAMT1;3 
[Oryza sativa Japonica Group]
 dbj|BAD21532.1| putative ammonium transporter 1-2 [Oryza sativa Japonica Group]
 dbj|BAD21572.1| putative ammonium transporter 1-2 [Oryza sativa Japonica Group]
 dbj|BAF09369.1| Os02g0620500 [Oryza sativa Japonica Group]
 gb|EAY86725.1| hypothetical protein OsI_08108 [Oryza sativa Indica Group]
 gb|EAZ23845.1| hypothetical protein OsJ_07561 [Oryza sativa Japonica Group]
Length=498

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTT+LAG  AALTTL+GKR L GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  275  WSAVGRTAVTTSLAGSVAALTTLYGKRWLTGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  334

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +++CGFV+AWVLIG NKL+ + K+DDPLEA QLH GCGAWG+IFT LFA++ YV  +Y G
Sbjct  335  SVICGFVSAWVLIGCNKLSLILKFDDPLEATQLHAGCGAWGIIFTALFARREYVELIY-G  393

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            +P RPYGLFMGGGG+LLAA ++QI+VI GWVSATMG LFY+LH+  LLR+S   E  GMD
Sbjct  394  VPGRPYGLFMGGGGRLLAAHIVQILVIVGWVSATMGTLFYVLHRFGLLRVSPATEMEGMD  453

Query  543  LTRHGGFAYAYHDEDDQ  593
             T HGGF Y   DE ++
Sbjct  454  PTCHGGFGYVDEDEGER  470



>emb|CDX77438.1| BnaA07g05760D [Brassica napus]
Length=504

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS +GRTAVTTTLAG TAALTTLFGKRLL GHW V DVCNGLLGGFAAIT GCSVVEPWA
Sbjct  283  WSGIGRTAVTTTLAGSTAALTTLFGKRLLSGHWAVTDVCNGLLGGFAAITGGCSVVEPWA  342

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF+AA VLIG NKLA + +YDDPLEAAQLHGGCGAWGLIF GLFAK+ Y+NEVY  
Sbjct  343  AIVCGFMAALVLIGCNKLAEIVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGE  402

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGL MGGGGKLL AQ++QI+V+ GWVSATMG LF++L +L LLRIS +DE  GMD
Sbjct  403  TPGRPYGLLMGGGGKLLGAQLVQILVVAGWVSATMGTLFFLLKRLGLLRISEKDEMAGMD  462

Query  543  LTRHGGFAYAYHDEDDQS  596
            +TRHGGFAY Y+D DD+S
Sbjct  463  MTRHGGFAYMYYDNDDES  480



>ref|XP_004496013.1| PREDICTED: uncharacterized protein LOC101510142 [Cicer arietinum]
Length=1056

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  3     WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
             WSA+GRTAVTTTLAGCTAALTTLF KRLL GHWNVIDVCNGLLGGFAAITSGCSVVEPWA
Sbjct  819   WSAIGRTAVTTTLAGCTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  878

Query  183   AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
             AIVCGFVAAWVLIG NKLA   +YDDPLEAAQLHGGCGAWG++FTGLFAK  YV+E+Y G
Sbjct  879   AIVCGFVAAWVLIGLNKLAVKMEYDDPLEAAQLHGGCGAWGVLFTGLFAKGEYVSEIY-G  937

Query  363   LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             +  RPYGL MGGGG+L+AAQ+I+++V+ GWV+ TM PLFY LHK+KLLRIS ++E+ GMD
Sbjct  938   I-GRPYGLLMGGGGRLIAAQVIEVLVVCGWVTVTMAPLFYGLHKMKLLRISRDEESMGMD  996

Query  543   LTRHGGFAYAYHDEDDQSS  599
             LTRHGGFAY YHDED+  S
Sbjct  997   LTRHGGFAYVYHDEDEDES  1015



>ref|XP_003590923.1| Ammonium transporter [Medicago truncatula]
Length=1109

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  3     WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
             WSA+GRT VTTTLAGCTAALTTLF KRLLVGHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  878   WSAIGRTGVTTTLAGCTAALTTLFSKRLLVGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  937

Query  183   AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
             AIVCGFVAAWVLIG NKLA   KYDDPLEAAQLHGGCGAWG++FTGLFAK  YV+E+Y G
Sbjct  938   AIVCGFVAAWVLIGLNKLAIKVKYDDPLEAAQLHGGCGAWGVLFTGLFAKGEYVDEIY-G  996

Query  363   LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             +  RPYGL MGGGG+L AAQ+++++VI GWV+ TM PLFY L+K+KLLRIS +DET GMD
Sbjct  997   V-GRPYGLLMGGGGRLFAAQVVEVLVICGWVTVTMVPLFYGLNKMKLLRISRDDETAGMD  1055

Query  543   LTRHGGFAYAYHDEDDQSS  599
             LTRHGGFAYAYHDE+D  S
Sbjct  1056  LTRHGGFAYAYHDEEDDES  1074



>dbj|BAJ84840.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 173/206 (84%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  274  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  333

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG N LAA  KYDDPLEAAQLHGGCGAWG+IFT LFAK+ YV E+Y  
Sbjct  334  AVICGFVSAWVLIGLNALAARLKYDDPLEAAQLHGGCGAWGIIFTALFAKRQYVEEIYG-  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P RPYGLF+GGGG+LLAA ++QI+VI G+VS TMGPLF+ L KL LLRIS+EDE  GMD
Sbjct  393  -PGRPYGLFLGGGGRLLAAHIVQILVIAGFVSCTMGPLFFALKKLGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+D+      G  +
Sbjct  452  LTRHGGFAYVYHDDDEHDKSVGGFML  477



>ref|XP_010527145.1| PREDICTED: ammonium transporter 1 member 4 [Tarenaya hassleriana]
Length=478

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS++GRTAVTTTLAGCTAALTTLFGKRLL+GH  V DVCNGLL        GC+VV+PWA
Sbjct  272  WSSIGRTAVTTTLAGCTAALTTLFGKRLLLGHGIVTDVCNGLLXXXXXXXGGCAVVDPWA  331

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVLIG NKLA +  YDDPLEAAQLHGGCGAWG+IFTGLFAKK+YVNE+Y G
Sbjct  332  AVICGFVAAWVLIGFNKLAEMVGYDDPLEAAQLHGGCGAWGIIFTGLFAKKAYVNEIYAG  391

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGL  GGGGKLLAA ++QI+VI  +VSATMGPLFY L KL LLRIS+++E  GMD
Sbjct  392  NPDRPYGLVFGGGGKLLAAHLVQILVIIAFVSATMGPLFYALKKLDLLRISADEEIAGMD  451

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
             T HGG AY Y D++ + + + G KM
Sbjct  452  PTSHGGLAYEYTDDEPKKT-FMGTKM  476



>ref|XP_002960883.1| hypothetical protein SELMODRAFT_163770 [Selaginella moellendorffii]
 gb|EFJ38422.1| hypothetical protein SELMODRAFT_163770 [Selaginella moellendorffii]
Length=513

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+AVGRTAVTTTLAGC+AA+TTLFG+R L GHW V+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  289  WTAVGRTAVTTTLAGCSAAITTLFGRRFLTGHWAVVDVCNGLLGGFAAITAGCSVVDPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +++CGFV+AWVLIG N LA    YDDPLEAAQLHGGCG WGLIFT LFAK+ +V  VY G
Sbjct  349  SLICGFVSAWVLIGLNLLAERFHYDDPLEAAQLHGGCGTWGLIFTALFAKEEHVLNVY-G  407

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
                PYGLFMGGGG+LLAAQ++ I+ I GWV+ TMGPLF+ LH+L LLRIS EDE  GMD
Sbjct  408  RTSTPYGLFMGGGGRLLAAQIVYILAIVGWVTVTMGPLFWTLHRLNLLRISPEDEVAGMD  467

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGG AY + D      H
Sbjct  468  LTRHGGMAYYHQDGSHHDGH  487



>gb|KFK29411.1| hypothetical protein AALP_AA7G130900 [Arabis alpina]
Length=497

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGC+AALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  287  WSAVGRTAVTTTLAGCSAALTTLFGKRLMDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  346

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   K+DDPLEAAQLHGGCGAWG++FTGLFA K+YV E++ G
Sbjct  347  AVICGFVAAWVLMGFNKLAEKLKFDDPLEAAQLHGGCGAWGIVFTGLFADKTYVAEIFGG  406

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGGG+LLAA ++QI+VI GWVS TMG LF++LHKL+LLRI SEDE  GMD
Sbjct  407  DPNRPYGLLMGGGGRLLAAHVVQILVIAGWVSMTMGTLFFVLHKLQLLRIPSEDEIAGMD  466

Query  543  LTRHGGFAYAYHDEDDQS  596
            LT HGG AY Y +++ ++
Sbjct  467  LTSHGGLAYRYTEDEIKN  484



>ref|XP_007016118.1| Ammonium transporter 1 member 2 [Theobroma cacao]
 gb|EOY33737.1| Ammonium transporter 1 member 2 [Theobroma cacao]
Length=462

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAG TA + TLFG+RLLVGHW+ +DVCNGLLGGF AITSGCSVVEPWA
Sbjct  249  WTAIGRTAVTTTLAGSTAGIVTLFGRRLLVGHWDALDVCNGLLGGFVAITSGCSVVEPWA  308

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGF AAWVLIG N LA    +DDPLEAAQLHGGCGAWGLIFTGLFAK+ +V + Y  
Sbjct  309  AIVCGFFAAWVLIGLNFLAVKLNFDDPLEAAQLHGGCGAWGLIFTGLFAKEEFVIQAYDS  368

Query  363  LPD---RPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETH  533
                  RP+GLFMGGG  LL  Q+I+++VI  WV+ TMGPLF+ LH+L++LRIS E+E  
Sbjct  369  GESGVVRPHGLFMGGGWGLLGCQVIEVLVIVSWVTVTMGPLFFALHRLRILRISVEEEIA  428

Query  534  GMDLTRHGGFAYAYHDEDDQ  593
            G+D++ HGG+AY  H ED+Q
Sbjct  429  GLDISSHGGYAYNTHQEDNQ  448



>ref|XP_010033013.1| PREDICTED: ammonium transporter 1 member 3 [Eucalyptus grandis]
 gb|KCW52532.1| hypothetical protein EUGRSUZ_J01919 [Eucalyptus grandis]
Length=464

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+A+GRTAVTTTLAG TA L TLFG+RLLVGHW+ +DVCNGLLGGF AITSGCSVV+PWA
Sbjct  251  WTAIGRTAVTTTLAGSTAGLVTLFGRRLLVGHWDALDVCNGLLGGFVAITSGCSVVDPWA  310

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N  A   ++DDPLEA QLHGGCGAWGLIFTGLFAK+ +V + Y  
Sbjct  311  AIICGFVSAWVLIGLNIAALKLRFDDPLEATQLHGGCGAWGLIFTGLFAKEEFVIQAYDS  370

Query  363  LP---DRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETH  533
                  RPYGLFMGGG  LL AQ+++++ I GWVSATMGPLFY LHKL +LRIS E+E  
Sbjct  371  GESGVSRPYGLFMGGGWALLGAQVVEVLAIVGWVSATMGPLFYALHKLNILRISVEEELA  430

Query  534  GMDLTRHGGFAYAYHDEDDQSSHY  605
            G+D++ HGG+AY  H E+ +   Y
Sbjct  431  GLDISSHGGYAYTGHAEESRPRFY  454



>ref|XP_006412923.1| hypothetical protein EUTSA_v10024961mg [Eutrema salsugineum]
 gb|ESQ54376.1| hypothetical protein EUTSA_v10024961mg [Eutrema salsugineum]
Length=506

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  290  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   ++DDPLEAAQLHGGCGAWG+IFTGLFA K+YV+E+Y G
Sbjct  350  AVICGFVAAWVLMGFNKLADKVRFDDPLEAAQLHGGCGAWGIIFTGLFADKTYVSEIYGG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGGG+LLAA ++QI+VI GWVS TMG LF++LHKLKLLRI SEDE  GMD
Sbjct  410  DPNRPYGLLMGGGGRLLAAHVVQILVITGWVSLTMGTLFFVLHKLKLLRIPSEDEIAGMD  469

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +++ ++
Sbjct  470  PTSHGGLAYRYTEDEIKN  487



>ref|NP_001141280.1| hypothetical protein [Zea mays]
 gb|ACF85949.1| unknown [Zea mays]
 tpg|DAA36930.1| TPA: hypothetical protein ZEAMMB73_246763 [Zea mays]
Length=489

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 170/198 (86%), Gaps = 4/198 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  273  WSAVGRTAVTTTLAGSVAALTTLFGKRLQAGHWNVVDVCNGLLGGFAAITAGCSVVEPWA  332

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A+VCGFV+AWVLIGAN LAA  ++DDPLEAAQLHGGCGAWG++FTGLFA++ YV E+Y  
Sbjct  333  AVVCGFVSAWVLIGANALAARLRFDDPLEAAQLHGGCGAWGVLFTGLFARQEYVEEIYGA  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGL MGGGGKLLAAQ++QIVVI GWVS TMGPLFY L +L LLRIS++DE  GMD
Sbjct  393  --GRPYGLLMGGGGKLLAAQIVQIVVIAGWVSCTMGPLFYALKRLDLLRISADDEMSGMD  450

Query  543  LTRHGGFAYAYHDEDDQS  596
            LTRHGGF  AY D  D +
Sbjct  451  LTRHGGF--AYEDPGDNA  466



>gb|AHI94952.1| ammonium transporter 1.2 [Pinus pinaster]
Length=487

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRLL GHWN +DVCNGLLGGF AITSGCSVV+PWA
Sbjct  277  WSGVGRTAVTTTLAGSMAALTTLFGKRLLSGHWNALDVCNGLLGGFVAITSGCSVVDPWA  336

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYP-  359
            AIVCGFVAAWVLIG N LA   K+DDPLEAAQLHGGCG WG+IFTGLFA ++++ EVYP 
Sbjct  337  AIVCGFVAAWVLIGFNALALRLKFDDPLEAAQLHGGCGVWGVIFTGLFAAENHMVEVYPP  396

Query  360  --GLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETH  533
              G   RP+GL MGGG +LL AQ+++++ I GWV+ TMGPLFY + ++ LLRI  E+ET 
Sbjct  397  ANGDTTRPFGLLMGGGWRLLGAQVVEVLAIVGWVTVTMGPLFYAMQRMDLLRIGREEETA  456

Query  534  GMDLTRHGGFAYAYHDEDDQSSH  602
            GMD++ HGGFAY +   D+  S 
Sbjct  457  GMDISSHGGFAYDHSLPDEGPSR  479



>ref|XP_001758611.1| predicted protein [Physcomitrella patens]
 gb|EDQ76589.1| predicted protein [Physcomitrella patens]
Length=511

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            W+ VGRTAVTTTL+GCTAA+TTLF KRLL  HW+V+DVCNGLLGGFAAIT+GC+VV PWA
Sbjct  289  WTGVGRTAVTTTLSGCTAAVTTLFAKRLLHNHWSVLDVCNGLLGGFAAITAGCAVVAPWA  348

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            +I+CGFV+AWVLIG NKLAA   YDDPLEAAQLH GCGAWGLIF GLFA+++Y+ ++Y G
Sbjct  349  SIICGFVSAWVLIGLNKLAARVHYDDPLEAAQLHAGCGAWGLIFVGLFAQQNYILQIYDG  408

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRP+GLFMGGGGKLLAAQ+I+I+ IFGWV+ TMGPLF++L    LLRIS EDE  G+D
Sbjct  409  AGDRPHGLFMGGGGKLLAAQIIEILAIFGWVTVTMGPLFFLLKLFNLLRISPEDEMAGLD  468

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTRHGG AY +HD  D   H
Sbjct  469  LTRHGGTAYIHHDGSDHPMH  488



>gb|KJB72485.1| hypothetical protein B456_011G180800 [Gossypium raimondii]
Length=476

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 160/200 (80%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCT+ALTTLFGK +L   W+V D C+GLLGGFAAIT+GCSVVEPWA
Sbjct  275  WSAVGRTAVTTTLAGCTSALTTLFGKWILTSRWDVTDFCSGLLGGFAAITAGCSVVEPWA  334

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFVAA VLI  NKLA   KYDDPL AAQLHGGCGAWG+IFT LFA + YV EVYP 
Sbjct  335  AIICGFVAALVLISCNKLAEKVKYDDPLGAAQLHGGCGAWGVIFTALFASEKYVREVYPS  394

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P R YGLFMGGGG+LLAA +IQI+VI GWVSATMG LFY LHK   LR+S++DE   MD
Sbjct  395  RPVR-YGLFMGGGGRLLAAHIIQILVIVGWVSATMGTLFYFLHKFGHLRVSADDEMADMD  453

Query  543  LTRHGGFAYAYHDEDDQSSH  602
            LTR G  AY  HDED+    
Sbjct  454  LTRQGRLAYVDHDEDESQKQ  473



>gb|AAR27052.1| ammonium transporter [Triticum aestivum]
Length=494

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  274  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWA  333

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFV+AWVLIG N LA   KYDDPLEAAQLHGGCGAWG+IFT LFAKK YV E+Y  
Sbjct  334  AVICGFVSAWVLIGLNALAGRLKYDDPLEAAQLHGGCGAWGIIFTALFAKKQYVEEIYGA  393

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
               RPYGLF+GGGG+LLAA ++QI+ I G+VS TMGPLF  L KL LLRIS+EDE  GMD
Sbjct  394  --GRPYGLFLGGGGRLLAAHIVQILAIAGFVSCTMGPLFLALKKLGLLRISAEDEMAGMD  451

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY YHD+D+      G  +
Sbjct  452  LTRHGGFAYVYHDDDEHDKSVGGFML  477



>ref|XP_003625418.1| Ammonium transporter 1 member [Medicago truncatula]
 gb|AES81636.1| ammonium transporter 1 protein [Medicago truncatula]
Length=490

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSA+GRTAVTTTLAGCTAALTTLFGKRL  GHWNV DVCNGLLGGFAAIT+GCSVV+PWA
Sbjct  284  WSAIGRTAVTTTLAGCTAALTTLFGKRLQTGHWNVTDVCNGLLGGFAAITAGCSVVDPWA  343

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGF+AAWVLIG N LA   +YDDPLEAAQLHGGCG WG+IFT LFAKK YV EVY G
Sbjct  344  AIICGFIAAWVLIGCNMLAEKFQYDDPLEAAQLHGGCGTWGIIFTALFAKKQYVKEVYGG  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             PDRPYGL +GGGG+LLAA ++QI+ I  WVS TMG LF++LHKL LLR S E+E  G+D
Sbjct  404  SPDRPYGLLLGGGGRLLAAHLVQILAIVVWVSVTMGTLFFILHKLNLLRSSHEEEMSGLD  463

Query  543  LTRHGGFAYAYHDEDDQ  593
            LT HGG AY YH+E ++
Sbjct  464  LTSHGGLAYEYHEELEE  480



>gb|AAB58937.1| putative ammonium transporter OsAMT1p [Oryza sativa Japonica 
Group]
Length=533

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WS VGRTAVTTTLAG  AALTTLFGKRL  GHWNV+DVCNGLLGGFAAIT+GC VV+PWA
Sbjct  277  WSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCGVVDPWA  336

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AI+CGFV+AWVLIG N LAA  K+DDPLEAAQLHGGCGAWG++FT LFA++ YV      
Sbjct  337  AIICGFVSAWVLIGLN-LAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVER---S  392

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
                 YGLFM G  KLL   +IQI+VIFGWVS TMGPLFY L KL LLRIS  DET GMD
Sbjct  393  TAPAAYGLFM-GRRKLLVGAVIQILVIFGWVSCTMGPLFYGLKKLGLLRISGRDETSGMD  451

Query  543  LTRHGGFAYAYHDEDDQ  593
            LTRHGGFAY YHDED+ 
Sbjct  452  LTRHGGFAYVYHDEDEH  468



>ref|XP_008218365.1| PREDICTED: LOW QUALITY PROTEIN: ammonium transporter 1 member 
2 [Prunus mume]
Length=816

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 177/203 (87%), Gaps = 5/203 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVE---  173
            WSA+GRTAVTTTLAGCTAALTTLF KRLL GHWNV+DVCNGLLGGFAAITSGCSVVE   
Sbjct  591  WSAIGRTAVTTTLAGCTAALTTLFSKRLLAGHWNVLDVCNGLLGGFAAITSGCSVVEWWE  650

Query  174  --PWAAIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVN  347
               WA +VCGFVAAWVLIG NK+A   KYDDPLEAAQLHGGCGAWGL+FTGLFA ++YVN
Sbjct  651  GGRWAGVVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLMFTGLFATEAYVN  710

Query  348  EVYPGLPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDE  527
            EVY G   RP+GL MGGGGKLLAAQ++Q++V+  WVSATMGPLFY LHKLKLLRIS EDE
Sbjct  711  EVYAGKRGRPFGLLMGGGGKLLAAQIVQVLVVLVWVSATMGPLFYGLHKLKLLRISEEDE  770

Query  528  THGMDLTRHGGFAYAYHDEDDQS  596
            T GMD+TRHGGFAY YHDEDD S
Sbjct  771  TQGMDMTRHGGFAYVYHDEDDPS  793



>dbj|BAJ23884.1| putative ammonium transporter, partial [Camellia sinensis]
Length=311

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLF  R++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  97   WSAVGRTAVTTTLAGSTAALTTLFLNRVVSGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  156

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CG VAA VLIG NK+A   K+DDPLEAAQLHGGCGAWG+IFT LFA + YVNEVYPG
Sbjct  157  AVICGLVAALVLIGCNKVAERVKFDDPLEAAQLHGGCGAWGVIFTALFASEKYVNEVYPG  216

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
              DRPYGL MGGGG+LLAA +IQIVVI GWVS TMGPLF++LHKLKLLRIS+EDE  GMD
Sbjct  217  KSDRPYGLLMGGGGRLLAAHVIQIVVIVGWVSVTMGPLFFLLHKLKLLRISAEDEIAGMD  276

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            LTRHGGFAY Y   D+  S+  G++M
Sbjct  277  LTRHGGFAYVYQYHDEDESNKLGMQM  302



>ref|XP_003535981.1| PREDICTED: ammonium transporter 1 member 1 [Glycine max]
Length=500

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAG TAALTTLFGKR++ GHWNV DVCNGLLGGFAAIT+GCSVVEPWA
Sbjct  285  WSAVGRTAVTTTLAGSTAALTTLFGKRVISGHWNVTDVCNGLLGGFAAITAGCSVVEPWA  344

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            AIVCGFVA+ VLI  NKLA   K+DDPLEAAQLHGGCG WG+IFT LFAKK YV EVY G
Sbjct  345  AIVCGFVASIVLIACNKLAEKVKFDDPLEAAQLHGGCGTWGVIFTALFAKKEYVKEVY-G  403

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
            L  R +GL MGGGGKLLAA +IQI+VI GWVSATMGPLF+ L+KLKLLRISSEDE  GMD
Sbjct  404  L-GRAHGLLMGGGGKLLAAHVIQILVIAGWVSATMGPLFWGLNKLKLLRISSEDELAGMD  462

Query  543  LTRHGGFAYAYHDEDDQSSHYPGIKM  620
            +TRHGGFAYAY D++   +H  G+++
Sbjct  463  MTRHGGFAYAYEDDE---THKHGMQL  485



>ref|XP_006285981.1| hypothetical protein CARUB_v10007502mg [Capsella rubella]
 gb|EOA18879.1| hypothetical protein CARUB_v10007502mg [Capsella rubella]
Length=506

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  290  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   ++DDPLEAAQLHGGCGAWG+IFTGLFA K YV E++ G
Sbjct  350  ALICGFVAAWVLMGFNKLAEKLEFDDPLEAAQLHGGCGAWGIIFTGLFADKRYVAEIFGG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGGG+LLAA ++QI+VI GWVS TMG LFY+LHKLKLLRI SEDE  G+D
Sbjct  410  DPNRPYGLLMGGGGRLLAAHVVQILVITGWVSLTMGTLFYILHKLKLLRIPSEDEIAGVD  469

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +++ ++
Sbjct  470  PTSHGGLAYMYTEDEIKN  487



>ref|XP_002869483.1| hypothetical protein ARALYDRAFT_913645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45742.1| hypothetical protein ARALYDRAFT_913645 [Arabidopsis lyrata subsp. 
lyrata]
Length=505

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGCTAALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  290  WSAVGRTAVTTTLAGCTAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  349

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G N+LA   ++DDPLEAAQLHGGCGAWG+IFTGLFA+K Y+ E++ G
Sbjct  350  ALICGFVAAWVLMGFNRLAEKLQFDDPLEAAQLHGGCGAWGIIFTGLFAEKRYIAEIFGG  409

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGGG+LLAA ++QI+VI GWVS TMG LFY+LHKLKLLRI +EDE  G+D
Sbjct  410  DPNRPYGLLMGGGGRLLAAHVVQILVITGWVSVTMGTLFYILHKLKLLRIPAEDEIAGVD  469

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +++ ++
Sbjct  470  PTSHGGLAYMYTEDEIRN  487



>ref|XP_010438407.1| PREDICTED: ammonium transporter 1 member 4 isoform X2 [Camelina 
sativa]
Length=438

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    WSAVGRtavtttlagctaalttlFGKRLLVGHWNVIDVCNGLLGGFAAITSGCSVVEPWA  182
            WSAVGRTAVTTTLAGC+AALTTLFGKRL+ G+WNV DVCNGLLGGFAAITSGCSVVEPWA
Sbjct  226  WSAVGRTAVTTTLAGCSAALTTLFGKRLIDGYWNVTDVCNGLLGGFAAITSGCSVVEPWA  285

Query  183  AIVCGFVAAWVLIGANKLAAVCKYDDPLEAAQLHGGCGAWGLIFTGLFAKKSYVNEVYPG  362
            A++CGFVAAWVL+G NKLA   ++DDPLEAAQLHGGCGAWG+IFTGLFA+K YV E++ G
Sbjct  286  ALICGFVAAWVLMGFNKLADKLEFDDPLEAAQLHGGCGAWGIIFTGLFAEKRYVAEIFGG  345

Query  363  LPDRPYGLFMGGGGKLLAAQMIQIVVIFGWVSATMGPLFYMLHKLKLLRISSEDETHGMD  542
             P+RPYGL MGGGG+LLAA ++QI+VI GWVS TMG LF++LHKLKLLRI +EDE  G+D
Sbjct  346  DPNRPYGLLMGGGGRLLAAHVVQILVITGWVSLTMGTLFFILHKLKLLRIPAEDEIAGVD  405

Query  543  LTRHGGFAYAYHDEDDQS  596
             T HGG AY Y +++ ++
Sbjct  406  PTSHGGLAYMYTEDEIKN  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520