BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004E10 547 bp,:Filtered

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-07   Nicotiana tomentosiformis
ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               58.9    2e-07   Nicotiana sylvestris
dbj|BAM28759.1|  ROX1 homologue                                       59.3    2e-07   Nicotiana tabacum [American tobacco]
dbj|BAM28758.1|  ROX1 homologue                                       58.9    3e-07   Nicotiana benthamiana
ref|XP_009757117.1|  PREDICTED: protein E6                            58.2    4e-07   Nicotiana sylvestris
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    57.0    1e-06   Nicotiana tomentosiformis
gb|ABH01084.1|  putative ROX1                                         56.6    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_002279294.1|  PREDICTED: protein E6                            55.8    2e-06   Vitis vinifera
ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  55.8    2e-06   Sesamum indicum [beniseed]
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               54.3    1e-05   Solanum lycopersicum
ref|XP_006364298.1|  PREDICTED: protein E6-like                       53.9    1e-05   Solanum tuberosum [potatoes]
ref|XP_011096354.1|  PREDICTED: protein E6-like                       51.6    7e-05   Sesamum indicum [beniseed]
ref|XP_008225146.1|  PREDICTED: protein E6                            50.8    1e-04   Prunus mume [ume]
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              50.4    2e-04   Erythranthe guttata [common monkey flower]



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            EQQG+S TRF ENG+Y+YDVNTEKYA  PYENSR
Sbjct  434  EQQGISGTRFFENGKYFYDVNTEKYANDPYENSR  467



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   FEQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
             +QQ MSDTRF+ENG+Y YDVNTEKY R PYENSR
Sbjct  198  VQQQRMSDTRFLENGKYSYDVNTEKYVRDPYENSR  232



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINGEKHARDPYENAR  306



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ENGRYYYD+N+EK  R+ YENSR
Sbjct  172  KQQGMSDTRFLENGRYYYDLNSEKNYRNEYENSR  205



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 1/33 (3%)
 Frame = +2

Query  92   FEQQGMSDTRFMENGRYYYDVNTEKYAR-HPYE  187
            F+ QGMSDTRF+ENG+YYYDVNT+KY+  HPYE
Sbjct  200  FQPQGMSDTRFLENGKYYYDVNTDKYSSNHPYE  232



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  271  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  304



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  196
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  278  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  311



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  92   FEQQGMSDTRFMENGRYYYDVNTEKYAR-HPYENSR  196
            FE QGMSDTR + NG+YYYD+NT +Y+R HPYE+ R
Sbjct  218  FEPQGMSDTRSVGNGKYYYDINTGRYSRNHPYESLR  253



>ref|XP_008225146.1| PREDICTED: protein E6 [Prunus mume]
Length=296

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +2

Query  95   EQQGMSDTRFMENGRYYYDVNTEK-YARHPYENSR  196
            E+QGMSDTRF+ENGRY+YD+ +EK Y ++ YENSR
Sbjct  227  EKQGMSDTRFLENGRYHYDIGSEKNYNQNQYENSR  261



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = +2

Query  101  QGMSDTRFMENGRYYYDVNTEKY-ARHPYENSR  196
            QGMSDTR +ENG+YYYD+NTEKY + HPYE  R
Sbjct  177  QGMSDTRSLENGKYYYDLNTEKYNSNHPYERLR  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335