BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004E01 646 bp,

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795523.1|  PREDICTED: DDB1- and CUL4-associated factor ...    306   9e-99   Nicotiana sylvestris
ref|XP_009617903.1|  PREDICTED: DDB1- and CUL4-associated factor ...    304   8e-98   Nicotiana tomentosiformis
ref|XP_006366123.1|  PREDICTED: DDB1- and CUL4-associated factor ...    297   5e-95   Solanum tuberosum [potatoes]
ref|XP_009772659.1|  PREDICTED: DDB1- and CUL4-associated factor ...    296   2e-94   Nicotiana sylvestris
ref|XP_006366399.1|  PREDICTED: DDB1- and CUL4-associated factor ...    293   1e-93   
ref|XP_009628843.1|  PREDICTED: DDB1- and CUL4-associated factor ...    290   2e-92   Nicotiana tomentosiformis
ref|XP_010313526.1|  PREDICTED: DDB1- and CUL4-associated factor ...    289   5e-92   Solanum lycopersicum
ref|XP_004251276.1|  PREDICTED: DDB1- and CUL4-associated factor ...    289   5e-92   Solanum lycopersicum
gb|EYU18885.1|  hypothetical protein MIMGU_mgv1a005546mg                283   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_011089371.1|  PREDICTED: DDB1- and CUL4-associated factor 8      282   3e-89   Sesamum indicum [beniseed]
emb|CDP08939.1|  unnamed protein product                                279   6e-88   Coffea canephora [robusta coffee]
ref|XP_002284848.1|  PREDICTED: DDB1- and CUL4-associated factor 8      266   3e-83   Vitis vinifera
ref|XP_010253514.1|  PREDICTED: DDB1- and CUL4-associated factor ...    261   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010253513.1|  PREDICTED: DDB1- and CUL4-associated factor ...    261   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010112348.1|  DDB1- and CUL4-associated factor 8                 259   2e-80   Morus notabilis
ref|NP_190148.1|  DWD motif protein                                     256   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875736.1|  transducin family protein                          256   4e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010689432.1|  PREDICTED: DDB1- and CUL4-associated factor 8      253   4e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009150065.1|  PREDICTED: DDB1- and CUL4-associated factor 8      253   5e-78   Brassica rapa
emb|CDX86026.1|  BnaC03g55410D                                          253   6e-78   Brassica napus [oilseed rape]
ref|XP_002532257.1|  WD-repeat protein, putative                        253   7e-78   Ricinus communis
gb|KJB21760.1|  hypothetical protein B456_004G012500                    252   1e-77   Gossypium raimondii
gb|KFK33937.1|  hypothetical protein AALP_AA5G080800                    251   5e-77   Arabis alpina [alpine rockcress]
ref|XP_006419020.1|  hypothetical protein EUTSA_v10002508mg             248   7e-76   Eutrema salsugineum
gb|KHG14973.1|  DDB1- and CUL4-associated factor 8                      250   1e-75   Gossypium arboreum [tree cotton]
ref|XP_006424666.1|  hypothetical protein CICLE_v10028345mg             247   1e-75   Citrus clementina
ref|XP_010244992.1|  PREDICTED: DDB1- and CUL4-associated factor ...    246   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_008463887.1|  PREDICTED: DDB1- and CUL4-associated factor ...    244   4e-75   Cucumis melo [Oriental melon]
ref|XP_008463885.1|  PREDICTED: DDB1- and CUL4-associated factor ...    245   9e-75   
ref|XP_006843250.1|  hypothetical protein AMTR_s00080p00104750          244   1e-74   
gb|KDP44126.1|  hypothetical protein JCGZ_05593                         242   7e-74   Jatropha curcas
ref|XP_004149538.1|  PREDICTED: DDB1- and CUL4-associated factor ...    241   2e-73   Cucumis sativus [cucumbers]
gb|ABI34308.1|  WD domain containing protein, putative                  240   3e-73   Solanum demissum
ref|XP_010503180.1|  PREDICTED: DDB1- and CUL4-associated factor ...    239   9e-73   Camelina sativa [gold-of-pleasure]
ref|NP_001190014.1|  DWD motif protein                                  239   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425987.1|  PREDICTED: DDB1- and CUL4-associated factor ...    233   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009421372.1|  PREDICTED: DDB1- and CUL4-associated factor ...    231   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002521240.1|  WD-repeat protein, putative                        232   9e-70   Ricinus communis
ref|XP_009421371.1|  PREDICTED: DDB1- and CUL4-associated factor ...    231   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008654447.1|  PREDICTED: DDB1- and CUL4-associated factor 8      231   2e-69   Zea mays [maize]
ref|XP_002468049.1|  hypothetical protein SORBIDRAFT_01g038680          231   2e-69   Sorghum bicolor [broomcorn]
emb|CDY12084.1|  BnaC03g60000D                                          229   8e-69   Brassica napus [oilseed rape]
ref|XP_003542007.1|  PREDICTED: DDB1- and CUL4-associated factor ...    229   8e-69   
ref|XP_003547044.1|  PREDICTED: DDB1- and CUL4-associated factor ...    229   1e-68   Glycine max [soybeans]
gb|KHN33442.1|  DDB1- and CUL4-associated factor 8                      229   1e-68   Glycine soja [wild soybean]
gb|KDO68193.1|  hypothetical protein CISIN_1g009266mg                   229   1e-68   Citrus sinensis [apfelsine]
ref|XP_006422523.1|  hypothetical protein CICLE_v10028158mg             228   1e-68   Citrus clementina
gb|KDP33280.1|  hypothetical protein JCGZ_13067                         229   2e-68   Jatropha curcas
ref|XP_009588100.1|  PREDICTED: DDB1- and CUL4-associated factor ...    222   2e-68   Nicotiana tomentosiformis
ref|XP_006422524.1|  hypothetical protein CICLE_v10028158mg             229   2e-68   Citrus clementina
gb|KDO68191.1|  hypothetical protein CISIN_1g009266mg                   229   2e-68   Citrus sinensis [apfelsine]
ref|XP_007150237.1|  hypothetical protein PHAVU_005G137900g             228   2e-68   Phaseolus vulgaris [French bean]
gb|KDO68194.1|  hypothetical protein CISIN_1g009266mg                   228   2e-68   Citrus sinensis [apfelsine]
ref|XP_006486680.1|  PREDICTED: DDB1- and CUL4-associated factor ...    229   2e-68   Citrus sinensis [apfelsine]
emb|CDX90275.1|  BnaA08g17090D                                          228   2e-68   Brassica napus [oilseed rape]
ref|XP_010920925.1|  PREDICTED: DDB1- and CUL4-associated factor ...    228   4e-68   Elaeis guineensis
emb|CBI37821.3|  unnamed protein product                                228   4e-68   Vitis vinifera
ref|XP_010646524.1|  PREDICTED: DDB1- and CUL4-associated factor ...    228   5e-68   Vitis vinifera
ref|XP_009109553.1|  PREDICTED: DDB1- and CUL4-associated factor 8      227   5e-68   Brassica rapa
gb|KHN30235.1|  DDB1- and CUL4-associated factor 8                      227   7e-68   Glycine soja [wild soybean]
ref|XP_006422525.1|  hypothetical protein CICLE_v10028158mg             228   8e-68   Citrus clementina
ref|XP_004487145.1|  PREDICTED: DDB1- and CUL4-associated factor ...    226   1e-67   Cicer arietinum [garbanzo]
ref|XP_006486678.1|  PREDICTED: DDB1- and CUL4-associated factor ...    228   1e-67   Citrus sinensis [apfelsine]
ref|XP_009355589.1|  PREDICTED: DDB1- and CUL4-associated factor ...    225   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_010646516.1|  PREDICTED: DDB1- and CUL4-associated factor ...    226   4e-67   Vitis vinifera
ref|XP_009355591.1|  PREDICTED: DDB1- and CUL4-associated factor ...    225   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_009355590.1|  PREDICTED: DDB1- and CUL4-associated factor ...    225   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_003597148.1|  DDB1- and CUL4-associated factor                   224   6e-67   Medicago truncatula
gb|KHG18469.1|  DDB1- and CUL4-associated factor 8                      222   2e-66   Gossypium arboreum [tree cotton]
ref|NP_568042.1|  transducin/WD40 domain-containing protein             223   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61549.1|  unknown                                                 223   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049775.1|  Os03g0286800                                       223   2e-66   
ref|XP_008365923.1|  PREDICTED: DDB1- and CUL4-associated factor ...    223   2e-66   Malus domestica [apple tree]
ref|XP_009588099.1|  PREDICTED: DDB1- and CUL4-associated factor ...    221   2e-66   Nicotiana tomentosiformis
ref|XP_008365924.1|  PREDICTED: DDB1- and CUL4-associated factor ...    223   2e-66   Malus domestica [apple tree]
ref|XP_008365922.1|  PREDICTED: DDB1- and CUL4-associated factor ...    223   3e-66   Malus domestica [apple tree]
ref|XP_009802647.1|  PREDICTED: DDB1- and CUL4-associated factor ...    223   3e-66   Nicotiana sylvestris
ref|XP_010431782.1|  PREDICTED: DDB1- and CUL4-associated factor ...    222   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002866801.1|  hypothetical protein ARALYDRAFT_490608             222   4e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_004984829.1|  PREDICTED: DDB1- and CUL4-associated factor ...    223   5e-66   Setaria italica
gb|EEE58841.1|  hypothetical protein OsJ_10420                          223   6e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007015514.1|  Transducin/WD40 repeat-like superfamily prot...    212   8e-66   Theobroma cacao [chocolate]
ref|XP_009588095.1|  PREDICTED: DDB1- and CUL4-associated factor ...    222   9e-66   Nicotiana tomentosiformis
gb|KJB47716.1|  hypothetical protein B456_008G037700                    221   2e-65   Gossypium raimondii
gb|KJB47712.1|  hypothetical protein B456_008G037700                    221   2e-65   Gossypium raimondii
gb|KDO73115.1|  hypothetical protein CISIN_1g013644mg                   219   2e-65   Citrus sinensis [apfelsine]
gb|KJB47714.1|  hypothetical protein B456_008G037700                    218   2e-65   Gossypium raimondii
ref|XP_010446355.1|  PREDICTED: DDB1- and CUL4-associated factor ...    220   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007041733.1|  Transducin/WD40 repeat-like superfamily prot...    220   3e-65   Theobroma cacao [chocolate]
gb|KJB77781.1|  hypothetical protein B456_012G156900                    220   3e-65   Gossypium raimondii
emb|CDP14535.1|  unnamed protein product                                225   5e-65   Coffea canephora [robusta coffee]
ref|XP_009802646.1|  PREDICTED: DDB1- and CUL4-associated factor ...    221   5e-65   Nicotiana sylvestris
ref|XP_002306202.1|  hypothetical protein POPTR_0004s18520g             218   6e-65   Populus trichocarpa [western balsam poplar]
ref|XP_009588094.1|  PREDICTED: DDB1- and CUL4-associated factor ...    220   1e-64   Nicotiana tomentosiformis
ref|XP_010315399.1|  PREDICTED: DDB1- and CUL4-associated factor ...    219   1e-64   Solanum lycopersicum
ref|XP_010315400.1|  PREDICTED: DDB1- and CUL4-associated factor ...    219   1e-64   Solanum lycopersicum
ref|XP_006283705.1|  hypothetical protein CARUB_v10004776mg             218   1e-64   Capsella rubella
gb|KHG25597.1|  DDB1- and CUL4-associated factor 8                      219   1e-64   Gossypium arboreum [tree cotton]
ref|XP_007041732.1|  Transducin/WD40 repeat-like superfamily prot...    221   1e-64   Theobroma cacao [chocolate]
ref|XP_006364511.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   2e-64   Solanum tuberosum [potatoes]
ref|XP_006364512.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   2e-64   Solanum tuberosum [potatoes]
ref|XP_010541751.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    219   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_010530935.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_006411638.1|  hypothetical protein EUTSA_v10025111mg             218   2e-64   Eutrema salsugineum
ref|XP_008236073.1|  PREDICTED: DDB1- and CUL4-associated factor ...    217   3e-64   Prunus mume [ume]
ref|XP_008236072.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   3e-64   Prunus mume [ume]
emb|CDX99156.1|  BnaA06g18470D                                          217   3e-64   Brassica napus [oilseed rape]
ref|XP_008236071.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   3e-64   Prunus mume [ume]
ref|XP_007199802.1|  hypothetical protein PRUPE_ppa004717mg             218   4e-64   Prunus persica
ref|XP_006283477.1|  hypothetical protein CARUB_v10004525mg             216   9e-64   Capsella rubella
ref|XP_006651270.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   9e-64   
ref|XP_010690313.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004497203.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   1e-63   Cicer arietinum [garbanzo]
ref|XP_011045634.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   1e-63   Populus euphratica
ref|XP_008447917.1|  PREDICTED: DDB1- and CUL4-associated factor 8      216   1e-63   Cucumis melo [Oriental melon]
ref|XP_002312940.1|  transducin family protein                          216   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004231066.1|  PREDICTED: DDB1- and CUL4-associated factor ...    217   1e-63   Solanum lycopersicum
ref|XP_011088653.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   1e-63   Sesamum indicum [beniseed]
ref|XP_011045642.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   2e-63   Populus euphratica
ref|XP_010530934.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_011045649.1|  PREDICTED: DDB1- and CUL4-associated factor ...    215   2e-63   Populus euphratica
ref|XP_010530933.1|  PREDICTED: DDB1- and CUL4-associated factor ...    218   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_006364510.1|  PREDICTED: DDB1- and CUL4-associated factor ...    217   2e-63   Solanum tuberosum [potatoes]
ref|XP_004497202.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   2e-63   Cicer arietinum [garbanzo]
ref|XP_010690312.1|  PREDICTED: DDB1- and CUL4-associated factor ...    216   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006283478.1|  hypothetical protein CARUB_v10004525mg             216   4e-63   Capsella rubella
gb|KFK30152.1|  hypothetical protein AALP_AA7G223600                    215   5e-63   Arabis alpina [alpine rockcress]
ref|XP_006412141.1|  hypothetical protein EUTSA_v10025258mg             213   6e-63   Eutrema salsugineum
ref|XP_004168977.1|  PREDICTED: DDB1- and CUL4-associated factor ...    214   7e-63   
ref|XP_004144864.1|  PREDICTED: DDB1- and CUL4-associated factor ...    214   8e-63   Cucumis sativus [cucumbers]
ref|XP_006828825.1|  hypothetical protein AMTR_s00001p00141440          214   8e-63   Amborella trichopoda
ref|XP_002867089.1|  transducin family protein                          214   1e-62   Arabidopsis lyrata subsp. lyrata
ref|NP_195240.2|  WD repeat-containing protein 42A                      214   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432320.1|  PREDICTED: DDB1- and CUL4-associated factor ...    214   2e-62   Camelina sativa [gold-of-pleasure]
emb|CDY52644.1|  BnaAnng11590D                                          213   2e-62   Brassica napus [oilseed rape]
ref|XP_010028776.1|  PREDICTED: DDB1- and CUL4-associated factor ...    211   2e-62   Eucalyptus grandis [rose gum]
ref|XP_011088650.1|  PREDICTED: DDB1- and CUL4-associated factor ...    215   3e-62   Sesamum indicum [beniseed]
emb|CDX69116.1|  BnaC01g03370D                                          212   3e-62   Brassica napus [oilseed rape]
ref|XP_009105332.1|  PREDICTED: DDB1- and CUL4-associated factor ...    212   4e-62   Brassica rapa
ref|XP_009105253.1|  PREDICTED: DDB1- and CUL4-associated factor ...    212   5e-62   Brassica rapa
ref|XP_010446973.1|  PREDICTED: DDB1- and CUL4-associated factor ...    213   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_011458700.1|  PREDICTED: DDB1- and CUL4-associated factor ...    212   5e-62   Fragaria vesca subsp. vesca
gb|KFK30151.1|  hypothetical protein AALP_AA7G223600                    214   6e-62   Arabis alpina [alpine rockcress]
ref|XP_010437517.1|  PREDICTED: DDB1- and CUL4-associated factor ...    212   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010028775.1|  PREDICTED: DDB1- and CUL4-associated factor ...    211   9e-62   Eucalyptus grandis [rose gum]
ref|XP_010432321.1|  PREDICTED: DDB1- and CUL4-associated factor ...    213   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010446972.1|  PREDICTED: DDB1- and CUL4-associated factor ...    213   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010446971.1|  PREDICTED: DDB1- and CUL4-associated factor ...    213   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010437516.1|  PREDICTED: DDB1- and CUL4-associated factor ...    212   1e-61   Camelina sativa [gold-of-pleasure]
gb|EYU37990.1|  hypothetical protein MIMGU_mgv1a006081mg                210   1e-61   Erythranthe guttata [common monkey flower]
ref|XP_007142793.1|  hypothetical protein PHAVU_007G017300g             211   2e-61   Phaseolus vulgaris [French bean]
gb|KEH44402.1|  transducin/WD-like repeat-protein                       211   2e-61   Medicago truncatula
ref|XP_011458701.1|  PREDICTED: DDB1- and CUL4-associated factor ...    211   2e-61   Fragaria vesca subsp. vesca
ref|XP_010066303.1|  PREDICTED: DDB1- and CUL4-associated factor 8      210   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010028774.1|  PREDICTED: DDB1- and CUL4-associated factor ...    210   2e-61   Eucalyptus grandis [rose gum]
gb|KHN37380.1|  DDB1- and CUL4-associated factor 8                      211   2e-61   Glycine soja [wild soybean]
gb|KEH44400.1|  transducin/WD-like repeat-protein                       210   3e-61   Medicago truncatula
ref|XP_001753126.1|  predicted protein                                  209   5e-61   Physcomitrella patens
gb|KEH44401.1|  transducin/WD-like repeat-protein                       210   7e-61   Medicago truncatula
ref|XP_006589731.1|  PREDICTED: DDB1- and CUL4-associated factor ...    209   7e-61   
ref|XP_001761389.1|  predicted protein                                  209   7e-61   Physcomitrella patens
ref|XP_006589730.1|  PREDICTED: DDB1- and CUL4-associated factor ...    209   7e-61   Glycine max [soybeans]
ref|XP_011046629.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    208   1e-60   Populus euphratica
ref|XP_006589729.1|  PREDICTED: DDB1- and CUL4-associated factor ...    209   1e-60   Glycine max [soybeans]
ref|XP_006589728.1|  PREDICTED: DDB1- and CUL4-associated factor ...    209   2e-60   Glycine max [soybeans]
dbj|BAJ87505.1|  predicted protein                                      207   2e-60   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008806157.1|  PREDICTED: DDB1- and CUL4-associated factor ...    206   7e-60   Phoenix dactylifera
ref|XP_010935187.1|  PREDICTED: DDB1- and CUL4-associated factor ...    206   8e-60   Elaeis guineensis
ref|XP_010935186.1|  PREDICTED: DDB1- and CUL4-associated factor ...    206   2e-59   Elaeis guineensis
ref|XP_008806156.1|  PREDICTED: DDB1- and CUL4-associated factor ...    206   2e-59   Phoenix dactylifera
ref|XP_009392875.1|  PREDICTED: DDB1- and CUL4-associated factor 8      205   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791951.1|  PREDICTED: DDB1- and CUL4-associated factor ...    205   3e-59   Phoenix dactylifera
ref|XP_002964638.1|  hypothetical protein SELMODRAFT_81531              201   5e-59   Selaginella moellendorffii
ref|XP_010555202.1|  PREDICTED: DDB1- and CUL4-associated factor ...    203   7e-59   Tarenaya hassleriana [spider flower]
ref|NP_001150616.1|  plasmacytoma 326 homolog                           203   1e-58   Zea mays [maize]
ref|XP_008658679.1|  PREDICTED: plasmacytoma 326 homolog isoform X1     203   1e-58   Zea mays [maize]
dbj|BAK06946.1|  predicted protein                                      203   1e-58   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010918155.1|  PREDICTED: DDB1- and CUL4-associated factor 8      203   1e-58   Elaeis guineensis
ref|XP_009413038.1|  PREDICTED: DDB1- and CUL4-associated factor ...    203   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983782.1|  PREDICTED: DDB1- and CUL4-associated factor ...    204   3e-58   
ref|XP_010086844.1|  DDB1- and CUL4-associated factor 8                 203   3e-58   Morus notabilis
ref|XP_011462160.1|  PREDICTED: DDB1- and CUL4-associated factor ...    199   2e-57   Fragaria vesca subsp. vesca
ref|XP_006283704.1|  hypothetical protein CARUB_v10004776mg             198   3e-57   Capsella rubella
ref|XP_009413037.1|  PREDICTED: DDB1- and CUL4-associated factor ...    199   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG19898.1|  DDB1- and CUL4-associated factor 8                      198   6e-57   Gossypium arboreum [tree cotton]
gb|AAO16992.1|  Hypothetical protein                                    200   9e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970512.1|  hypothetical protein SELMODRAFT_147078             197   1e-56   Selaginella moellendorffii
ref|XP_002978595.1|  hypothetical protein SELMODRAFT_152654             197   1e-56   Selaginella moellendorffii
ref|XP_011470718.1|  PREDICTED: DDB1- and CUL4-associated factor 8      196   1e-56   Fragaria vesca subsp. vesca
ref|XP_010444874.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    196   2e-56   Camelina sativa [gold-of-pleasure]
emb|CAN70290.1|  hypothetical protein VITISV_019345                     204   3e-56   Vitis vinifera
emb|CAB37504.1|  putative protein                                       193   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KJB47715.1|  hypothetical protein B456_008G037700                    194   2e-55   Gossypium raimondii
ref|NP_001065201.1|  Os10g0544500                                       194   4e-55   
gb|KHN11511.1|  DDB1- and CUL4-associated factor 8                      192   6e-55   Glycine soja [wild soybean]
gb|AAM34535.1|AC113947_1  putative WD-40 repeat protein                 194   1e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79398.1|  hypothetical protein OsI_34526                          194   1e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_003555853.1|  PREDICTED: DDB1- and CUL4-associated factor ...    192   2e-54   Glycine max [soybeans]
gb|ACU19502.1|  unknown                                                 192   2e-54   Glycine max [soybeans]
ref|XP_003574277.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    192   2e-54   
ref|XP_002989505.1|  hypothetical protein SELMODRAFT_43681              188   4e-54   Selaginella moellendorffii
ref|XP_009782403.1|  PREDICTED: DDB1- and CUL4-associated factor ...    189   6e-54   Nicotiana sylvestris
gb|EMS48851.1|  DDB1- and CUL4-associated factor 8                      188   8e-54   Triticum urartu
gb|EEC75010.1|  hypothetical protein OsI_11081                          186   1e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_009782401.1|  PREDICTED: DDB1- and CUL4-associated factor ...    189   1e-53   Nicotiana sylvestris
gb|EMT05361.1|  hypothetical protein F775_27454                         182   2e-50   Aegilops tauschii
gb|EMS58245.1|  DDB1- and CUL4-associated factor 8                      182   2e-50   Triticum urartu
ref|XP_001764012.1|  predicted protein                                  177   1e-49   Physcomitrella patens
ref|XP_008791952.1|  PREDICTED: DDB1- and CUL4-associated factor ...    178   2e-49   Phoenix dactylifera
ref|XP_009782402.1|  PREDICTED: DDB1- and CUL4-associated factor ...    177   3e-49   Nicotiana sylvestris
gb|EMT10698.1|  hypothetical protein F775_06509                         178   4e-49   Aegilops tauschii
ref|XP_010555203.1|  PREDICTED: DDB1- and CUL4-associated factor ...    174   4e-48   Tarenaya hassleriana [spider flower]
tpg|DAA44809.1|  TPA: hypothetical protein ZEAMMB73_645766              154   3e-43   Zea mays [maize]
gb|EEC81328.1|  hypothetical protein OsI_24502                          161   4e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001058613.1|  Os06g0724500                                       161   4e-43   
ref|XP_004966484.1|  PREDICTED: DDB1- and CUL4-associated factor ...    161   5e-43   Setaria italica
ref|XP_002439042.1|  hypothetical protein SORBIDRAFT_10g030450          159   4e-42   Sorghum bicolor [broomcorn]
ref|XP_001632024.1|  predicted protein                                  158   5e-42   Nematostella vectensis
emb|CAB36721.1|  putative protein                                       159   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ELU09524.1|  hypothetical protein CAPTEDRAFT_156303                  151   2e-39   Capitella teleta
dbj|BAJ98693.1|  predicted protein                                      150   7e-39   Hordeum vulgare subsp. vulgare [barley]
ref|XP_011398325.1|  DDB1- and CUL4-associated factor 8                 148   5e-38   Auxenochlorella protothecoides
ref|XP_007229236.1|  PREDICTED: DDB1- and CUL4-associated factor ...    146   3e-37   Astyanax mexicanus [blind cave fish]
ref|XP_785904.3|  PREDICTED: DDB1- and CUL4-associated factor 8-like    146   5e-37   
gb|EKC36901.1|  WD repeat-containing protein 42A                        146   8e-37   Crassostrea gigas
ref|XP_011451300.1|  PREDICTED: DDB1- and CUL4-associated factor ...    146   9e-37   Crassostrea gigas
ref|XP_003563262.1|  PREDICTED: DDB1- and CUL4-associated factor 8      144   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_010787725.1|  PREDICTED: DDB1- and CUL4-associated factor 8      144   1e-36   Notothenia coriiceps [yellowbelly rockcod]
gb|EMS65437.1|  DDB1- and CUL4-associated factor 8                      143   2e-36   Triticum urartu
ref|XP_007564289.1|  PREDICTED: DDB1- and CUL4-associated factor 8      144   2e-36   Poecilia formosa
gb|EMT02177.1|  hypothetical protein F775_23299                         144   2e-36   Aegilops tauschii
emb|CDQ67358.1|  unnamed protein product                                143   2e-36   Oncorhynchus mykiss
ref|XP_008432603.1|  PREDICTED: DDB1- and CUL4-associated factor 8      144   2e-36   Poecilia reticulata
ref|XP_009588097.1|  PREDICTED: DDB1- and CUL4-associated factor ...    142   2e-36   Nicotiana tomentosiformis
ref|XP_005729142.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   Pundamilia nyererei
ref|XP_010744519.1|  PREDICTED: DDB1- and CUL4-associated factor 8      143   3e-36   Larimichthys crocea [croceine croaker]
ref|XP_003975477.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   
ref|XP_003448570.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   Oreochromis niloticus
ref|XP_008275391.1|  PREDICTED: DDB1- and CUL4-associated factor 8      143   3e-36   Stegastes partitus
ref|XP_004555354.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   
ref|XP_006792326.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005924708.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   3e-36   Haplochromis burtoni
ref|XP_008332824.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   4e-36   Cynoglossus semilaevis
ref|XP_005846365.1|  hypothetical protein CHLNCDRAFT_135819             144   4e-36   Chlorella variabilis
emb|CAE17623.2|  novel protein similar to human H326 protein            142   4e-36   Danio rerio [leopard danio]
ref|XP_008332822.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   5e-36   Cynoglossus semilaevis
ref|XP_005802010.1|  PREDICTED: DDB1- and CUL4-associated factor ...    143   5e-36   Xiphophorus maculatus
ref|XP_001346262.2|  PREDICTED: DDB1- and CUL4-associated factor 8      142   6e-36   
ref|XP_010887844.1|  PREDICTED: DDB1- and CUL4-associated factor 8      141   2e-35   Esox lucius
gb|KDR14597.1|  WD repeat-containing protein 42A                        142   2e-35   Zootermopsis nevadensis
ref|XP_010520710.1|  PREDICTED: uncharacterized protein LOC104799765    144   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_002427825.1|  Nuclear distribution protein nudF, putative        140   3e-35   Pediculus humanus corporis [human body lice]
gb|KFM65830.1|  DDB1- and CUL4-associated factor 8                      141   3e-35   Stegodyphus mimosarum
ref|XP_011403468.1|  PREDICTED: DDB1- and CUL4-associated factor ...    139   3e-35   Amphimedon queenslandica
emb|CBJ49245.1|  conserved unknown protein                              141   6e-35   Ectocarpus siliculosus
ref|XP_006594995.1|  PREDICTED: DDB1- and CUL4-associated factor ...    138   7e-35   Glycine max [soybeans]
ref|XP_005093046.1|  PREDICTED: DDB1- and CUL4-associated factor ...    140   9e-35   Aplysia californica
gb|KFD65835.1|  hypothetical protein M514_07074                         141   2e-34   Trichuris suis
emb|CDQ95303.1|  unnamed protein product                                138   2e-34   Oncorhynchus mykiss
emb|CDW53253.1|  eRF1 2 and Bestrophin and eRF1 3 and WD40 and eR...    140   3e-34   Trichuris trichiura
gb|KIZ06302.1|  hypothetical protein MNEG_1652                          137   3e-34   Monoraphidium neglectum
ref|XP_009049377.1|  hypothetical protein LOTGIDRAFT_186470             136   3e-34   Lottia gigantea
ref|XP_002610503.1|  hypothetical protein BRAFLDRAFT_65670              138   4e-34   Branchiostoma floridae
ref|XP_009013523.1|  hypothetical protein HELRODRAFT_110145             136   5e-34   Helobdella robusta
ref|NP_001167678.1|  nucleotide binding protein                         136   6e-34   Zea mays [maize]
ref|XP_008791953.1|  PREDICTED: DDB1- and CUL4-associated factor ...    134   1e-33   Phoenix dactylifera
gb|ACL53759.1|  unknown                                                 135   2e-33   Zea mays [maize]
ref|NP_001140866.1|  uncharacterized protein LOC100272942               135   2e-33   Zea mays [maize]
ref|XP_003743255.1|  PREDICTED: DDB1- and CUL4-associated factor ...    135   2e-33   Metaseiulus occidentalis
ref|XP_002953374.1|  hypothetical protein VOLCADRAFT_42270              134   2e-33   Volvox carteri f. nagariensis
gb|EFX67950.1|  hypothetical protein DAPPUDRAFT_203513                  135   2e-33   Daphnia pulex
gb|KCW64151.1|  hypothetical protein EUGRSUZ_G01796                     133   3e-33   Eucalyptus grandis [rose gum]
ref|XP_011351779.1|  PREDICTED: DDB1- and CUL4-associated factor ...    135   9e-33   Cerapachys biroi
ref|XP_011351804.1|  PREDICTED: DDB1- and CUL4-associated factor ...    135   9e-33   Cerapachys biroi
gb|EFA02022.1|  hypothetical protein TcasGA2_TC007647                   131   7e-32   
ref|XP_008191744.1|  PREDICTED: DDB1- and CUL4-associated factor 8      131   7e-32   
gb|AAH23704.1|  Wdr42a protein                                          128   1e-31   Mus musculus [mouse]
ref|XP_002127343.1|  PREDICTED: DDB1- and CUL4-associated factor ...    131   2e-31   Ciona intestinalis [sea vase]
ref|XP_004448476.1|  PREDICTED: DDB1- and CUL4-associated factor ...    130   2e-31   Dasypus novemcinctus
ref|XP_004448471.1|  PREDICTED: DDB1- and CUL4-associated factor ...    130   2e-31   
ref|XP_006814387.1|  PREDICTED: WD and tetratricopeptide repeats ...    127   2e-31   
gb|KFV72533.1|  DDB1- and CUL4-associated factor 8                      127   2e-31   
gb|KFP02608.1|  DDB1- and CUL4-associated factor 8                      127   2e-31   
ref|XP_006743500.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   3e-31   
gb|EDL94689.1|  similar to expressed sequence AA408877, isoform C...    128   4e-31   
ref|XP_008584735.1|  PREDICTED: DDB1- and CUL4-associated factor 8      129   4e-31   
ref|XP_010359063.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   4e-31   
ref|XP_008820967.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   5e-31   
gb|EDL39035.1|  WD repeat domain 42A, isoform CRA_b                     127   5e-31   
ref|XP_003488616.1|  PREDICTED: DDB1- and CUL4-associated factor ...    130   5e-31   
ref|XP_010359053.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   5e-31   
gb|AAG13587.1|AC051633_3  putative WD-repeat containing protein         121   5e-31   
ref|XP_004716564.1|  PREDICTED: DDB1- and CUL4-associated factor 8      129   6e-31   
ref|XP_003415231.1|  PREDICTED: DDB1- and CUL4-associated factor 8      129   6e-31   
ref|XP_009319202.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   6e-31   
ref|XP_009695827.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   7e-31   
ref|XP_009279527.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    127   7e-31   
ref|XP_006218364.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   7e-31   
emb|CAH91208.1|  hypothetical protein                                   127   7e-31   
ref|XP_004717855.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   7e-31   
ref|XP_010215546.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   7e-31   
emb|CAH18661.1|  hypothetical protein                                   128   7e-31   
gb|EPY76059.1|  H326-like protein                                       128   7e-31   
ref|XP_006727794.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   8e-31   
ref|XP_006250362.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   8e-31   
ref|XP_009886058.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   8e-31   
ref|XP_009463256.1|  PREDICTED: DDB1- and CUL4-associated factor 8      128   8e-31   
ref|XP_009647308.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   8e-31   
ref|XP_004688435.1|  PREDICTED: DDB1- and CUL4-associated factor 8      128   9e-31   
ref|XP_006173999.1|  PREDICTED: DDB1- and CUL4-associated factor 8      128   9e-31   
gb|ELK03358.1|  WD repeat-containing protein 42A                        127   9e-31   
ref|XP_004390252.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   9e-31   
ref|XP_010614974.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_003767904.1|  PREDICTED: DDB1- and CUL4-associated factor 8      128   1e-30   
gb|EFB22055.1|  hypothetical protein PANDA_018452                       127   1e-30   
ref|XP_003394936.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   1e-30   
ref|XP_004775903.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_001369679.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   1e-30   
ref|XP_005188440.1|  PREDICTED: DDB1- and CUL4-associated factor 8      129   1e-30   
dbj|BAH13915.1|  unnamed protein product                                127   1e-30   
ref|XP_004775900.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   1e-30   
ref|XP_008056909.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_008962532.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_005078268.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   1e-30   
ref|XP_004671168.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   1e-30   
ref|XP_007481711.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   1e-30   
ref|XP_002111723.1|  hypothetical protein TRIADDRAFT_23787              126   1e-30   
ref|XP_010565181.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_008982972.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_006250361.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_007481713.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_008767968.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_009240141.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_010346851.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_007974704.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   1e-30   
ref|XP_010614972.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_006168892.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_007974690.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_392352.4|  PREDICTED: DDB1- and CUL4-associated factor 8-l...    128   2e-30   
ref|XP_004775902.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_007481712.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   2e-30   
ref|XP_004663723.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   2e-30   
ref|XP_004525636.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   2e-30   
ref|XP_008262449.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|NP_056541.2|  DDB1- and CUL4-associated factor 8                    127   2e-30   
ref|XP_005541318.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
gb|AAH98271.1|  WD repeat domain 42A                                    127   2e-30   
ref|XP_004589134.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_010346850.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_004407922.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_003937979.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_010614968.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_008839031.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_009240115.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_003500329.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_003258744.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_010346843.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_005610023.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_006895525.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_011234604.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|NP_705783.1|  DDB1- and CUL4-associated factor 8                    127   2e-30   
ref|XP_007945896.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_006922959.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_011049406.1|  PREDICTED: DDB1- and CUL4-associated factor ...    129   2e-30   
ref|XP_536129.2|  PREDICTED: DDB1- and CUL4-associated factor 8         127   2e-30   
ref|XP_004442837.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_007171828.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|NP_001193348.1|  DDB1- and CUL4-associated factor 8                 127   2e-30   
ref|XP_007092427.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_007129689.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_006990647.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_007974689.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_011371373.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_007459995.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_004284482.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_005677283.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_003999639.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_005981762.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|NP_001231363.1|  DDB1- and CUL4-associated factor 8                 127   2e-30   
ref|NP_001014253.1|  DDB1- and CUL4-associated factor 8                 127   2e-30   
ref|XP_008056904.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_007481710.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_010346842.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_008262448.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
ref|XP_006861707.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_005244360.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   2e-30   
ref|XP_005080123.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   2e-30   
gb|EDL20551.1|  plasmacytoma expressed transcript 2, isoform CRA_b      126   2e-30   
ref|XP_003435509.2|  PREDICTED: DDB1- and CUL4-associated factor 8      127   3e-30   
dbj|BAD97195.1|  H326 variant                                           127   3e-30   
ref|XP_004027774.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   3e-30   
ref|XP_005368635.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   3e-30   
ref|NP_001127032.1|  DDB1- and CUL4-associated factor 8                 127   3e-30   
ref|XP_008262446.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   3e-30   
ref|XP_008494319.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   3e-30   
ref|XP_006215711.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   3e-30   
dbj|BAH11932.1|  unnamed protein product                                127   4e-30   
ref|XP_010565179.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   4e-30   
ref|XP_009666282.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   4e-30   
ref|NP_001084901.1|  DDB1- and CUL4-associated factor 8                 126   4e-30   
ref|XP_007066096.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   4e-30   
ref|XP_010565178.1|  PREDICTED: DDB1- and CUL4-associated factor ...    128   4e-30   
ref|XP_006612235.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   4e-30   
ref|XP_004858780.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   4e-30   
ref|XP_003691760.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   4e-30   
ref|XP_010565180.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   4e-30   
ref|XP_003466614.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   4e-30   
ref|XP_006612234.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   5e-30   
ref|XP_004901589.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   5e-30   
ref|XP_002808293.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    127   5e-30   
ref|XP_004639993.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   5e-30   
ref|XP_005400256.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   5e-30   
gb|EMP30007.1|  DDB1- and CUL4-associated factor 8                      127   5e-30   
gb|ELK38495.1|  DDB1- and CUL4-associated factor 8                      126   5e-30   
ref|XP_003924225.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   5e-30   
ref|XP_008152472.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   5e-30   
ref|XP_005400257.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   5e-30   
ref|XP_005857827.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   6e-30   
ref|XP_008262445.1|  PREDICTED: DDB1- and CUL4-associated factor ...    127   6e-30   
ref|XP_006096967.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   6e-30   
ref|XP_006752896.1|  PREDICTED: DDB1- and CUL4-associated factor 8      126   6e-30   
ref|XP_011163370.1|  PREDICTED: WD and tetratricopeptide repeats ...    125   6e-30   
ref|XP_008168578.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   6e-30   
dbj|BAE01204.1|  unnamed protein product                                125   6e-30   
ref|XP_007444617.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   7e-30   
ref|XP_003795411.1|  PREDICTED: DDB1- and CUL4-associated factor 8      127   7e-30   
ref|XP_005293827.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   7e-30   
gb|EHB13666.1|  WD repeat-containing protein 42A                        126   7e-30   
ref|XP_003228435.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   7e-30   
ref|XP_003135039.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   7e-30   
ref|XP_007530628.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   8e-30   
ref|XP_010726544.1|  PREDICTED: DDB1- and CUL4-associated factor 8      124   9e-30   
ref|XP_006115289.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   9e-30   
ref|XP_008168576.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   9e-30   
gb|AAA16607.1|  homologous to mouse gene PC326:GenBank Accession ...    125   1e-29   
ref|XP_006261524.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   1e-29   
ref|NP_032847.2|  DDB1- and CUL4-associated factor 8-like protein 2     126   1e-29   
gb|EFN62773.1|  WD repeat-containing protein 42A                        125   1e-29   
gb|AAA39895.1|  protein PC326                                           126   1e-29   
gb|EFZ16659.1|  hypothetical protein SINV_07074                         126   1e-29   
ref|XP_011162164.1|  PREDICTED: DDB1- and CUL4-associated factor ...    126   2e-29   
ref|XP_011162161.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   2e-29   
ref|XP_006038186.1|  PREDICTED: DDB1- and CUL4-associated factor 8      124   2e-29   
ref|XP_009918339.1|  PREDICTED: DDB1- and CUL4-associated factor 8      123   2e-29   
ref|XP_004663728.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   3e-29   
ref|XP_011150867.1|  PREDICTED: DDB1- and CUL4-associated factor ...    125   3e-29   
ref|XP_011264407.1|  PREDICTED: DDB1- and CUL4-associated factor 8      125   3e-29   
ref|XP_011150868.1|  PREDICTED: DDB1- and CUL4-associated factor ...    124   4e-29   
ref|XP_002093188.1|  GE21184                                            124   4e-29   
ref|XP_003510807.1|  PREDICTED: DDB1- and CUL4-associated factor 8      124   5e-29   
emb|CAG07154.1|  unnamed protein product                                122   5e-29   
ref|XP_001955965.1|  GF24833                                            124   5e-29   
ref|XP_011150866.1|  PREDICTED: DDB1- and CUL4-associated factor ...    124   6e-29   
ref|XP_004092432.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    123   6e-29   
ref|XP_002926755.1|  PREDICTED: DDB1- and CUL4-associated factor 8      123   6e-29   
ref|XP_001947204.3|  PREDICTED: DDB1- and CUL4-associated factor ...    122   6e-29   
ref|XP_004063987.1|  PREDICTED: DDB1- and CUL4-associated factor ...    123   8e-29   
ref|XP_002026197.1|  GL16051                                            123   9e-29   
ref|XP_005533373.1|  PREDICTED: DDB1- and CUL4-associated factor 8      122   1e-28   
ref|XP_002831529.1|  PREDICTED: DDB1- and CUL4-associated factor ...    122   1e-28   
ref|XP_004613975.1|  PREDICTED: DDB1- and CUL4-associated factor 8      123   1e-28   
ref|XP_011304598.1|  PREDICTED: WD and tetratricopeptide repeats ...    122   1e-28   
gb|EGI68658.1|  WD and tetratricopeptide repeats protein 1              120   2e-28   
ref|XP_001352409.1|  GA20756                                            123   2e-28   
tpg|DAA32169.1|  TPA: WD and tetratricopeptide repeats 1                120   2e-28   
ref|XP_011201293.1|  PREDICTED: DDB1- and CUL4-associated factor 8      123   2e-28   
gb|EDL96036.1|  rCG36436                                                120   2e-28   
gb|ELK02082.1|  WD and tetratricopeptide repeat protein 1               120   3e-28   
gb|ELW48301.1|  DDB1- and CUL4-associated factor 8                      121   3e-28   
ref|XP_002007149.1|  GI12542                                            122   5e-28   
ref|NP_001016610.1|  DDB1- and CUL4-associated factor 8                 120   6e-28   
gb|ELK18121.1|  WD repeat-containing protein 42A                        120   6e-28   
ref|XP_008959894.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   6e-28   
ref|XP_008270847.1|  PREDICTED: DDB1- and CUL4-associated factor ...    121   6e-28   
ref|XP_005676851.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   6e-28   
ref|XP_008987347.1|  PREDICTED: DDB1- and CUL4-associated factor ...    120   6e-28   
ref|XP_005676852.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   6e-28   
gb|AAI57860.1|  WDR42C protein                                          120   7e-28   
ref|XP_520989.3|  PREDICTED: DDB1- and CUL4-associated factor 8-l...    120   7e-28   
ref|NP_001130005.1|  DDB1- and CUL4-associated factor 8-like prot...    120   7e-28   
gb|EAX07772.1|  WD and tetratricopeptide repeats 1, isoform CRA_c       120   7e-28   
ref|XP_004671285.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   7e-28   
ref|XP_010344231.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   7e-28   
ref|XP_007893133.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   7e-28   
ref|XP_011254994.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   7e-28   
ref|XP_004671284.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   8e-28   
ref|XP_009449932.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   8e-28   
ref|XP_003730475.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   8e-28   
ref|XP_005544355.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   8e-28   
ref|NP_647657.1|  CG8001, isoform A                                     121   8e-28   
ref|XP_011254995.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   8e-28   
ref|XP_007078197.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   9e-28   
ref|XP_003799861.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   9e-28   
ref|XP_005617779.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   9e-28   
ref|XP_011254992.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   9e-28   
dbj|BAA91868.1|  unnamed protein product                                120   9e-28   
ref|XP_005841630.1|  hypothetical protein GUITHDRAFT_100125             120   9e-28   
ref|NP_001163324.1|  CG8001, isoform B                                  120   9e-28   
gb|EGI68659.1|  WD and tetratricopeptide repeats protein 1              120   9e-28   
ref|XP_005656127.1|  PREDICTED: WD and tetratricopeptide repeats ...    120   1e-27   



>ref|XP_009795523.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Nicotiana 
sylvestris]
Length=473

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+KLY  S  D  +EF+KREIGFS  R FSRRISASEA+VK+LDLYGKL GH+GCVNTI+
Sbjct  1    MEKLYKVSGGDDLMEFYKREIGFSHPRNFSRRISASEAMVKRLDLYGKLTGHEGCVNTID  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT+TSKLSYPSGH+DNIFQAKFMPF DDRKIVTASADG
Sbjct  61   FNATGDVLVSGSDDRRVILWDWATRTSKLSYPSGHMDNIFQAKFMPFADDRKIVTASADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG +LENG V+TKR+GKHQGRVH LAVEPGSPYI YSCGEDGFV+HYDL
Sbjct  121  QVRLGLLLENGRVETKRVGKHQGRVHKLAVEPGSPYILYSCGEDGFVQHYDL  172



>ref|XP_009617903.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   304 bits (779),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K+Y  S  D  +EF+KREIGFS  R FSRRISASEA+VK+LDLYGKL GH+GCVNTI+
Sbjct  1    MEKVYKVSGGDDLMEFYKREIGFSQPRKFSRRISASEAMVKRLDLYGKLTGHEGCVNTID  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VI WDWAT+TSKLSYPSGH+DNIFQAKFMPFTDDRKIVTASADG
Sbjct  61   FNATGDVLVSGSDDRRVIQWDWATRTSKLSYPSGHMDNIFQAKFMPFTDDRKIVTASADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG +LENG V+TKR+GKHQGRVH LAVEPGSPYI YSCGEDGFV+HYDL
Sbjct  121  QVRLGLLLENGRVETKRVGKHQGRVHKLAVEPGSPYILYSCGEDGFVQHYDL  172



>ref|XP_006366123.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Solanum tuberosum]
Length=473

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MK+LY  S DD+F+EF KREIG S  R F+RRISASE  VK+LDLYGKLNGH+GCVNTI+
Sbjct  1    MKRLYK-STDDEFMEFHKREIGVSQPRNFTRRISASEVTVKRLDLYGKLNGHEGCVNTID  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT+ SKLSY SGH+DNIFQA+FMPFTDDRK+VTA+ADG
Sbjct  60   FNATGDVLVSGSDDRRVILWDWATRKSKLSYSSGHMDNIFQARFMPFTDDRKVVTAAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG +LENG V+TKRLGKHQGRVH+LAVEPGSPYI YSC EDGFV+HYDL
Sbjct  120  QVRLGLLLENGHVETKRLGKHQGRVHNLAVEPGSPYILYSCSEDGFVQHYDL  171



>ref|XP_009772659.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Nicotiana 
sylvestris]
Length=477

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M++LY A  DD FLE +KREIG S  R F+RRISASE  VK+LDLYGKLNGH+GCVNTI+
Sbjct  1    MERLYKAFGDD-FLELYKREIGISQPRNFARRISASEVTVKRLDLYGKLNGHEGCVNTID  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+L SGSDD++VILWDWAT+ SKLSY SGH+DNIFQA+FMPFTDDR+IVTA+ADG
Sbjct  60   FNATGDVLASGSDDRRVILWDWATRKSKLSYQSGHMDNIFQAQFMPFTDDRRIVTAAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG +LENG+V+TKRLG+HQGRVH LAVEPGSPYIFYSCGEDGFV+HYDL
Sbjct  120  QVRLGLLLENGQVETKRLGRHQGRVHKLAVEPGSPYIFYSCGEDGFVQHYDL  171



>ref|XP_006366399.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Solanum tuberosum]
 ref|XP_006366400.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Solanum tuberosum]
Length=472

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+KLY        +EF+KREIGFS  R FSRRISASEA+VK+LDLYGKL GH+GCVNTI+
Sbjct  1    MEKLYKGD----LMEFYKREIGFSKPRNFSRRISASEAMVKRLDLYGKLTGHEGCVNTID  56

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT TSK SYPSGH+DNIFQ KFMPFTDDRKI+TASADG
Sbjct  57   FNATGDVLVSGSDDRRVILWDWATSTSKFSYPSGHMDNIFQTKFMPFTDDRKIITASADG  116

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYD  626
            QVRLG VLENG V+TK++GKHQGRVH LAVEPGSPYI YSCGEDGFV+HYD
Sbjct  117  QVRLGLVLENGRVETKKVGKHQGRVHKLAVEPGSPYILYSCGEDGFVQHYD  167



>ref|XP_009628843.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Nicotiana 
tomentosiformis]
Length=477

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M++L  A  DD FLEF+KRE G S  R F+RRISASE  VK+LDLYGKLNGH GCVNTI+
Sbjct  1    MERLNRAFGDD-FLEFYKRETGISQPRNFARRISASEVTVKRLDLYGKLNGHGGCVNTID  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT+ SKLSY SGH+DNIFQAKFMPFTDDR+IVTA+ADG
Sbjct  60   FNATGDVLVSGSDDRRVILWDWATRKSKLSYQSGHMDNIFQAKFMPFTDDRRIVTAAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRL  +LENG+V+TKRLG+HQGRVH LAVEPGSPYIFYSCGEDGFV+HYDL
Sbjct  120  QVRLDLLLENGQVETKRLGRHQGRVHKLAVEPGSPYIFYSCGEDGFVQHYDL  171



>ref|XP_010313526.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Solanum 
lycopersicum]
Length=473

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+KL    K    +EF+KREIG S  R FSRRISASEA+VK+LDLYGKL GH+GCVNTI+
Sbjct  1    MEKL----KKGDLMEFYKREIGVSKPRNFSRRISASEAMVKRLDLYGKLTGHEGCVNTID  56

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT TSK SYPSGH+DNIFQ KFMPFTDDRKI+TASADG
Sbjct  57   FNATGDVLVSGSDDRRVILWDWATATSKFSYPSGHMDNIFQTKFMPFTDDRKIITASADG  116

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG VLENG V+TK++GKHQGRVH LAVEPGSPYI YSCGEDGF++HYDL
Sbjct  117  QVRLGLVLENGRVETKKVGKHQGRVHKLAVEPGSPYILYSCGEDGFLQHYDL  168



>ref|XP_004251276.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+KL    K    +EF+KREIG S  R FSRRISASEA+VK+LDLYGKL GH+GCVNTI+
Sbjct  1    MEKL----KKGDLMEFYKREIGVSKPRNFSRRISASEAMVKRLDLYGKLTGHEGCVNTID  56

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+TGD+LVSGSDD++VILWDWAT TSK SYPSGH+DNIFQ KFMPFTDDRKI+TASADG
Sbjct  57   FNATGDVLVSGSDDRRVILWDWATATSKFSYPSGHMDNIFQTKFMPFTDDRKIITASADG  116

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLG VLENG V+TK++GKHQGRVH LAVEPGSPYI YSCGEDGF++HYDL
Sbjct  117  QVRLGLVLENGRVETKKVGKHQGRVHKLAVEPGSPYILYSCGEDGFLQHYDL  168



>gb|EYU18885.1| hypothetical protein MIMGU_mgv1a005546mg [Erythranthe guttata]
Length=479

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            + D+  +EF+KRE+GFSA R FSRRISAS+ ++K++DLYGKL+GHQGCVNTI FNSTG+I
Sbjct  7    NSDNGAVEFFKREMGFSAPRVFSRRISASQTMIKRIDLYGKLSGHQGCVNTIEFNSTGEI  66

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDDKQ++LWDWAT+  K SYPSGHLDNIFQA+ MPFTDDRKIVT+SAD QVRL QV
Sbjct  67   LVSGSDDKQIMLWDWATQKLKFSYPSGHLDNIFQARIMPFTDDRKIVTSSADCQVRLSQV  126

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            L+NG V+TKRL KHQGRVH LAVEPGSPY+FYSCGEDGFV+HYDL
Sbjct  127  LDNGSVETKRLSKHQGRVHRLAVEPGSPYVFYSCGEDGFVQHYDL  171



>ref|XP_011089371.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Sesamum indicum]
Length=477

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            + D+  LEF+KRE+GF + R FSRR+SASE ++KQ+DLYGKL GHQGCVNT+ FNSTG++
Sbjct  7    NSDNGLLEFFKREMGFCSPRIFSRRMSASETLIKQIDLYGKLTGHQGCVNTVEFNSTGEL  66

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD+Q++LWDWA +  K SYPSGHLDNIFQA+FMPFTDDRKIVT+SAD QVRL Q+
Sbjct  67   LVSGSDDRQIMLWDWAARKLKFSYPSGHLDNIFQARFMPFTDDRKIVTSSADCQVRLSQL  126

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LENG V+TKRL KHQGRVH LAVEPGSPY+FYSCGEDGFV+HYDL
Sbjct  127  LENGSVETKRLSKHQGRVHRLAVEPGSPYVFYSCGEDGFVQHYDL  171



>emb|CDP08939.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MK+ + +S +D FLEF+KREIGFS+  TFSR ISAS+ +V+Q+ LYGKL GH+GCVNTI 
Sbjct  1    MKRRFKSS-EDGFLEFYKREIGFSSPSTFSRHISASQNLVEQIGLYGKLTGHEGCVNTIE  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GD LVSGSDDKQ+ LW+WATK  K SYPSGHLDN+FQA+ MPFTDDRKIVT+SADG
Sbjct  60   FNSAGDHLVSGSDDKQIKLWEWATKALKFSYPSGHLDNVFQARIMPFTDDRKIVTSSADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +VRLG+VLEN +V+TKRLGKH GRVH LAVEPGSPYIFYSCGEDG V+HYDL
Sbjct  120  KVRLGEVLENSQVETKRLGKHHGRVHKLAVEPGSPYIFYSCGEDGLVQHYDL  171



>ref|XP_002284848.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Vitis vinifera]
 emb|CBI16251.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D+F E +KRE+GFS  R F RRISASE +VK++ L+GKLNGH+ CVNT+ FNSTGD+LVS
Sbjct  10   DEFTEVFKREMGFSRPRCFPRRISASEGLVKRITLHGKLNGHKECVNTVEFNSTGDVLVS  69

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD+QVI WDWA K+   SYPSGHLDNIFQA+ MPFTDDRKIVT+S DGQVRLG VLEN
Sbjct  70   GSDDRQVIFWDWAAKSKTFSYPSGHLDNIFQARIMPFTDDRKIVTSSCDGQVRLGLVLEN  129

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+VDT+RLGKHQGRV+ L +EPGSP+IFYSCGEDG V+H+DL
Sbjct  130  GQVDTRRLGKHQGRVYKLDIEPGSPHIFYSCGEDGVVQHFDL  171



>ref|XP_010253514.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Nelumbo nucifera]
Length=432

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E W+R++G S  R+  R I  SE +VK++DLYGKL+GH+GCVN + FNSTGD LVSGS
Sbjct  12   FAELWRRQVGLSQPRSVERLIGGSEVLVKRIDLYGKLDGHEGCVNAVEFNSTGDFLVSGS  71

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD +VILW+WAT+T KLSYPSGH+DNIFQ + MPFTDDRKIVT++ DGQ+RLGQ+LE+G 
Sbjct  72   DDTEVILWNWATRTKKLSYPSGHIDNIFQTRIMPFTDDRKIVTSAGDGQIRLGQILEDGW  131

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VDTKRLGKHQGRV+ LA+EPGSP+IFYSCGEDGF++H+DL
Sbjct  132  VDTKRLGKHQGRVYKLAIEPGSPHIFYSCGEDGFIQHFDL  171



>ref|XP_010253513.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Nelumbo nucifera]
Length=476

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E W+R++G S  R+  R I  SE +VK++DLYGKL+GH+GCVN + FNSTGD LVSGS
Sbjct  12   FAELWRRQVGLSQPRSVERLIGGSEVLVKRIDLYGKLDGHEGCVNAVEFNSTGDFLVSGS  71

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD +VILW+WAT+T KLSYPSGH+DNIFQ + MPFTDDRKIVT++ DGQ+RLGQ+LE+G 
Sbjct  72   DDTEVILWNWATRTKKLSYPSGHIDNIFQTRIMPFTDDRKIVTSAGDGQIRLGQILEDGW  131

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VDTKRLGKHQGRV+ LA+EPGSP+IFYSCGEDGF++H+DL
Sbjct  132  VDTKRLGKHQGRVYKLAIEPGSPHIFYSCGEDGFIQHFDL  171



>ref|XP_010112348.1| DDB1- and CUL4-associated factor 8 [Morus notabilis]
 gb|EXC33237.1| DDB1- and CUL4-associated factor 8 [Morus notabilis]
Length=475

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D F E + RE G S  R F+RR SASE +VK+++L GKLNGH+GCVNT+ FNS+GD+LVS
Sbjct  5    DAFAEIFGRETGLSRPRCFARRFSASEVIVKRINLCGKLNGHKGCVNTVEFNSSGDLLVS  64

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD+QV+ WDWATKT +LSYPSGH DNIFQAK MPF+DDRKIVT+S DGQ+RLGQ+ E+
Sbjct  65   GSDDRQVLFWDWATKTRRLSYPSGHSDNIFQAKIMPFSDDRKIVTSSGDGQIRLGQISED  124

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+VDTKRLG+HQGRV  LAVEPGS  IFYSCGEDGFV+H+DL
Sbjct  125  GQVDTKRLGRHQGRVFKLAVEPGSSNIFYSCGEDGFVQHFDL  166



>ref|NP_190148.1| DWD motif protein [Arabidopsis thaliana]
 emb|CAB75491.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42358.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64016.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78051.1| DWD motif protein [Arabidopsis thaliana]
Length=481

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D F E + REIGFS   T SRRISASE  VK+LDLYGKLNGH+GCVN + FNSTGD+LVS
Sbjct  13   DGFTEIFNREIGFSHPITISRRISASEGRVKKLDLYGKLNGHEGCVNAVEFNSTGDVLVS  72

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD+Q++LW+W + + KLSYPSGH +N+FQ KF+PFTDDR I+T+ ADGQVRLGQ+LEN
Sbjct  73   GSDDRQIMLWNWLSGSRKLSYPSGHCENVFQTKFIPFTDDRTIITSGADGQVRLGQILEN  132

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  133  GKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  174



>ref|XP_002875736.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51995.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=481

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D F E + REIGFS   T SRRISASE +VK+LDLYGKLNGH+GCVN + FNSTGD+LVS
Sbjct  13   DGFTEIFNREIGFSHPITISRRISASEGIVKKLDLYGKLNGHEGCVNAVEFNSTGDVLVS  72

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD+Q++LW+W + +  LSYPSGH +N+FQ KF+PFTDDR I+T+ ADGQVRLGQ+LEN
Sbjct  73   GSDDRQIMLWNWLSGSRTLSYPSGHCENVFQTKFIPFTDDRTIITSGADGQVRLGQILEN  132

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  133  GKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  174



>ref|XP_010689432.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D F   ++RE+G +  R FSRR+SAS+ +V+QLDLY KL GH+GCVNT+ FNSTG++LVS
Sbjct  11   DWFSSSFRRELGLTQPRCFSRRLSASQGLVQQLDLYAKLVGHEGCVNTVEFNSTGEVLVS  70

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDDKQVI+WDWA+K    +YPSGHL+NIFQ K MPF+DDR IVT++ADGQVR+GQVLE+
Sbjct  71   GSDDKQVIVWDWASKRKIFAYPSGHLENIFQTKIMPFSDDRVIVTSAADGQVRVGQVLED  130

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G VDTKRLGKH+G V  LAVEPGSPYIFYSCGEDGFV+H+DL
Sbjct  131  GSVDTKRLGKHRGAVFKLAVEPGSPYIFYSCGEDGFVQHFDL  172



>ref|XP_009150065.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Brassica rapa]
Length=477

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            D+ F E +KRE+GFS  R+ SRRISASE +VK+LD+YGKLNGH+GCVN + F+ST DILV
Sbjct  8    DEGFREIFKREMGFSHPRSISRRISASEGIVKKLDVYGKLNGHEGCVNAVEFSSTADILV  67

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD+Q++LW+    T  L+YPSGH +N+FQ KFMPFTDDR I+T+ ADGQVRLGQ+LE
Sbjct  68   SGSDDRQIMLWNLLNGTRTLTYPSGHCENVFQTKFMPFTDDRTIITSGADGQVRLGQILE  127

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            NG+V+TKRLG+H+GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  128  NGKVETKRLGRHRGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  170



>emb|CDX86026.1| BnaC03g55410D [Brassica napus]
Length=477

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            D+ F E + RE+GFS  R+ SRRISASE +VK+LDLYGKLNGH+GCVN + F+STGDILV
Sbjct  8    DEGFAEIFNREVGFSHPRSISRRISASEGIVKKLDLYGKLNGHEGCVNAVEFSSTGDILV  67

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD+Q++LW+    T  L+YPSGH +N+FQ KF+PFTDDR I+T+ ADGQVRLGQ+LE
Sbjct  68   SGSDDRQIMLWNLLNGTRTLTYPSGHCENVFQTKFIPFTDDRTIITSGADGQVRLGQILE  127

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            NG+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  128  NGKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  170



>ref|XP_002532257.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF30123.1| WD-repeat protein, putative [Ricinus communis]
Length=479

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D   + +KRE+G    R FS+R SASE +VKQ+ LY KL GH+GCVN++ FN TGD+LVS
Sbjct  10   DGLPQIYKRELGLFQPRNFSQRYSASEGIVKQISLYKKLLGHEGCVNSVEFNYTGDLLVS  69

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDDKQV+ WDW T T  +SYPSGH  NIFQ K MPFTDDRKIVT+SADGQVR+GQVLEN
Sbjct  70   GSDDKQVMFWDWVTGTRTISYPSGHFGNIFQTKIMPFTDDRKIVTSSADGQVRVGQVLEN  129

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+VDTK+LGKHQGRV+ LAVEPGSP+I YSCGEDGFV+H+DL
Sbjct  130  GQVDTKKLGKHQGRVYKLAVEPGSPHILYSCGEDGFVQHFDL  171



>gb|KJB21760.1| hypothetical protein B456_004G012500 [Gossypium raimondii]
Length=478

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E   RE+  S+ +TFSR  S+S+ +V+++DLYGKLNGH+GCVNT+ FN  GDILVSGS
Sbjct  14   FPEIINREMRISSPQTFSRHFSSSQVIVEKIDLYGKLNGHEGCVNTVEFNFNGDILVSGS  73

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DDK V+LW+WATKT  L Y SGHLDNIFQA+ MP TDD++I+T+SADGQVRLG++L NG+
Sbjct  74   DDKHVMLWNWATKTKTLCYASGHLDNIFQARIMPLTDDKRIITSSADGQVRLGEILVNGQ  133

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T+RLGKHQGRVHSLAVEPGSP+IF+SCGEDG V+HYDL
Sbjct  134  VKTRRLGKHQGRVHSLAVEPGSPHIFFSCGEDGLVQHYDL  173



>gb|KFK33937.1| hypothetical protein AALP_AA5G080800 [Arabis alpina]
Length=478

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M KL +A  DD F+E   REIG S   + +RRISASE +VK+LDLYGKL GH GCVN + 
Sbjct  1    MAKL-NAGIDDGFMELLHREIGLSHPSSITRRISASEGIVKKLDLYGKLTGHDGCVNALE  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GDILVSGSDD+ ++LW+W   +  LSYPSGH +N+FQ KF+PFTDDR I+T+ ADG
Sbjct  60   FNSIGDILVSGSDDRHIMLWNWLNGSKILSYPSGHCENVFQTKFIPFTDDRTIITSGADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLGQ+LENG+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  120  QVRLGQILENGKVETKRLGRHHGRVYKLAVSPGDPNVFYSCGEDGFVQHFDI  171



>ref|XP_006419020.1| hypothetical protein EUTSA_v10002508mg [Eutrema salsugineum]
 gb|ESQ37456.1| hypothetical protein EUTSA_v10002508mg [Eutrema salsugineum]
Length=479

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  129  SASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTG  308
            + S DD F   + REIGFS  R+ SRRI AS+  VK+LDLYGKL GH+GCVN ++FNSTG
Sbjct  5    NTSFDDGFTAIFNREIGFSPPRSISRRIYASQGQVKKLDLYGKLIGHEGCVNALDFNSTG  64

Query  309  DILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLG  488
            DILVSGSDD+Q+ILW+   ++  LSYPSGH +N+FQ KF+PFTDDR I+T+ ADGQVRLG
Sbjct  65   DILVSGSDDRQIILWNSLNRSKTLSYPSGHCENVFQTKFIPFTDDRTIITSGADGQVRLG  124

Query  489  QVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            Q+LENG+V+TKRLG+H G+V+ LAV PG P IFYSCGEDGFV+H+D+
Sbjct  125  QILENGKVETKRLGRHHGKVYKLAVLPGDPNIFYSCGEDGFVQHFDI  171



>gb|KHG14973.1| DDB1- and CUL4-associated factor 8 [Gossypium arboreum]
Length=578

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E   RE+  S+ +TFSR  S+S+ +V+++DLYGKLNGH+GCVNT+ FN  GDILVSGS
Sbjct  14   FPEIVNREMRISSPQTFSRHFSSSQVIVEKIDLYGKLNGHEGCVNTVEFNFNGDILVSGS  73

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DDK V+LW+WATKT  L Y SGHLDNIFQA+ MP TDD++I+T+SADGQVRLG++L+NG+
Sbjct  74   DDKHVMLWNWATKTKTLCYASGHLDNIFQARIMPLTDDKRIITSSADGQVRLGEILDNGQ  133

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T RLGKHQGRVHSLAVEPGSP+IF+SCGE+G V+HYDL
Sbjct  134  VKTGRLGKHQGRVHSLAVEPGSPHIFFSCGEEGLVQHYDL  173



>ref|XP_006424666.1| hypothetical protein CICLE_v10028345mg [Citrus clementina]
 ref|XP_006488192.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Citrus sinensis]
 gb|ESR37906.1| hypothetical protein CICLE_v10028345mg [Citrus clementina]
Length=477

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D F + +KRE+G    R+ +RR SASE ++K+++L GKL+GH+GCVN + FNSTGD LVS
Sbjct  10   DGFTDIYKREMGLFRPRSVARRFSASEVLMKRINLCGKLHGHKGCVNAVEFNSTGDFLVS  69

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDDK VI WDW  +  K SY SGHLDNIFQ + MPFTDDRKI+T+SADGQVRLGQ+ E+
Sbjct  70   GSDDKLVIFWDWKDRREKFSYLSGHLDNIFQTRIMPFTDDRKIITSSADGQVRLGQIFED  129

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G +DTKRLGKHQGRV+ LAVEPGSPYI YSCGEDGFV+H+DL
Sbjct  130  GRMDTKRLGKHQGRVYKLAVEPGSPYIIYSCGEDGFVQHFDL  171



>ref|XP_010244992.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Nelumbo nucifera]
Length=476

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E W+R+IG S  R+FSR    S  +VK++DLYGKL+GH+GCVN + FNSTGD+LVSGS
Sbjct  12   FAELWRRQIGLSQPRSFSRLTGGSMVLVKKIDLYGKLDGHEGCVNALEFNSTGDLLVSGS  71

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD +VI W+W  KT K SYPSGH D+IFQ + MPFTDDR IVT++ DGQ+RLG +LE+G+
Sbjct  72   DDTKVIFWNWEAKTKKFSYPSGHTDDIFQTRIMPFTDDRTIVTSAGDGQIRLGHILEDGQ  131

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VDTK LG HQGRV+ LA+EPGSP+IFYSCGEDGF++H+DL
Sbjct  132  VDTKELGSHQGRVYKLAIEPGSPHIFYSCGEDGFIQHFDL  171



>ref|XP_008463887.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Cucumis 
melo]
Length=414

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   Y     D F E   REIG   +R FSRR  ASE  VKQL+L  KLNGH GCVN + 
Sbjct  1    MNSCYQGMNSD-FAEICNREIGIVPSRNFSRRFIASETNVKQLNLEHKLNGHNGCVNAVE  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNSTGD+LVSGSDD +VILWDWA  + + SYPSGHLDNIFQ K MPFTDD+KIVT++ADG
Sbjct  60   FNSTGDLLVSGSDDCKVILWDWAINSKRFSYPSGHLDNIFQTKIMPFTDDQKIVTSAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +VRLGQVL +G V T+ LG+HQG VH LAVEPGSP+IFYSCGEDG V+H+DL
Sbjct  120  KVRLGQVLGDGRVITQMLGEHQGSVHELAVEPGSPHIFYSCGEDGLVQHFDL  171



>ref|XP_008463885.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Cucumis 
melo]
 ref|XP_008463886.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Cucumis 
melo]
Length=480

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   Y     D F E   REIG   +R FSRR  ASE  VKQL+L  KLNGH GCVN + 
Sbjct  1    MNSCYQGMNSD-FAEICNREIGIVPSRNFSRRFIASETNVKQLNLEHKLNGHNGCVNAVE  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNSTGD+LVSGSDD +VILWDWA  + + SYPSGHLDNIFQ K MPFTDD+KIVT++ADG
Sbjct  60   FNSTGDLLVSGSDDCKVILWDWAINSKRFSYPSGHLDNIFQTKIMPFTDDQKIVTSAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +VRLGQVL +G V T+ LG+HQG VH LAVEPGSP+IFYSCGEDG V+H+DL
Sbjct  120  KVRLGQVLGDGRVITQMLGEHQGSVHELAVEPGSPHIFYSCGEDGLVQHFDL  171



>ref|XP_006843250.1| hypothetical protein AMTR_s00080p00104750 [Amborella trichopoda]
 gb|ERN04925.1| hypothetical protein AMTR_s00080p00104750 [Amborella trichopoda]
Length=472

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             W+R++G    R F+RRI  SE ++K++ LY KL+GH GCVNT+ FN TGD+LV+GSDD+
Sbjct  15   IWRRQLGLLDPRKFARRIGGSEGIIKRMSLYAKLDGHDGCVNTVQFNPTGDLLVTGSDDR  74

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
            QVI W+WA K  + SYPSGH DN+FQA+ MPFTDDR ++T +ADGQVR G +LENG VDT
Sbjct  75   QVIFWEWAAKAKRFSYPSGHSDNVFQARIMPFTDDRSVITCAADGQVRHGLILENGLVDT  134

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            KRL KHQGRVH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  135  KRLAKHQGRVHKLAIEPGSPHIFYSCGEDGVVQHFDL  171



>gb|KDP44126.1| hypothetical protein JCGZ_05593 [Jatropha curcas]
Length=473

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            +  KRE+G    + F+ R+SASE +++Q++LYG L GH+GCVN + FNSTGD+LVSGSDD
Sbjct  14   DICKRELGLLQPKHFTNRLSASEVLLEQINLYGMLIGHEGCVNAVEFNSTGDLLVSGSDD  73

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
             QV+ WDW TK  K+SYPSGH DNIFQ + MPF+DDR++VT+SADGQVRLGQ+LENG+VD
Sbjct  74   TQVMFWDWETKRRKISYPSGHSDNIFQTRIMPFSDDRRVVTSSADGQVRLGQLLENGQVD  133

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK LGKH+GRV+ LAVEPGSP++ YSCGEDG V+H+DL
Sbjct  134  TKELGKHRGRVYKLAVEPGSPHVLYSCGEDGLVQHFDL  171



>ref|XP_004149538.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Cucumis sativus]
 ref|XP_004173364.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Cucumis sativus]
 gb|KGN47320.1| hypothetical protein Csa_6G295950 [Cucumis sativus]
Length=480

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   Y     D F E   R+IG   +  FSRR  ASE +VKQL+L  KLNGH GCVN + 
Sbjct  1    MNSCYRGMNSD-FAEICNRQIGIVPSTNFSRRFIASEIIVKQLNLEHKLNGHDGCVNAVE  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNSTGD+LVSGSDD +VILWDWA  + + SYPSGHLDNIFQ K MPFTDD+KIVT++ADG
Sbjct  60   FNSTGDLLVSGSDDCKVILWDWARNSKRFSYPSGHLDNIFQTKIMPFTDDQKIVTSAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +VRLGQVL +G V T+ LG+HQG VH LAVEPGSP+IFYSCGEDG V+H+DL
Sbjct  120  KVRLGQVLGDGRVITQMLGEHQGSVHELAVEPGSPHIFYSCGEDGLVQHFDL  171



>gb|ABI34308.1| WD domain containing protein, putative [Solanum demissum]
Length=454

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 126/150 (84%), Gaps = 16/150 (11%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            +VK+LDLYGKL GH+GCVNTI+FN+TGD+LVSGSDD++VILWDWAT TSK SYPSGH+DN
Sbjct  1    MVKRLDLYGKLTGHEGCVNTIDFNATGDVLVSGSDDRRVILWDWATSTSKFSYPSGHMDN  60

Query  408  IFQAKFMPFTDDRKIVTASADGQ----------------VRLGQVLENGEVDTKRLGKHQ  539
            IFQ KFMPFTDDRKI+TASADGQ                VRLG VLENG V+TK++GKHQ
Sbjct  61   IFQTKFMPFTDDRKIITASADGQLARTLYSVDTLFLPAMVRLGLVLENGRVETKKVGKHQ  120

Query  540  GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            GRVH LAVEPGSPYI YSCGEDGFV+HYDL
Sbjct  121  GRVHKLAVEPGSPYILYSCGEDGFVQHYDL  150



>ref|XP_010503180.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Camelina 
sativa]
Length=479

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M +  +    D F E + REIGF  + + SRRISASE +VK+LDLYGKLNGH+GCVN + 
Sbjct  1    MARRRNTEIGDSFTELFNREIGFFHSSSISRRISASEGIVKKLDLYGKLNGHEGCVNALE  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNSTGD+LVSGSDD+Q++LW+W + +  LSYPSGH +N+FQAKF+PFTDDR I+T+ ADG
Sbjct  61   FNSTGDVLVSGSDDRQIMLWNWLSGSKTLSYPSGHCENVFQAKFIPFTDDRTIITSGADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLGQ+LENG+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  121  QVRLGQILENGKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  172



>ref|NP_001190014.1| DWD motif protein [Arabidopsis thaliana]
 gb|AEE78052.1| DWD motif protein [Arabidopsis thaliana]
Length=515

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 138/196 (70%), Gaps = 34/196 (17%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASE---------------------------------  224
            D F E + REIGFS   T SRRISASE                                 
Sbjct  13   DGFTEIFNREIGFSHPITISRRISASEFRIMDLSVPKTKCYGLSVFCRMLRKSEPIQRLI  72

Query  225  -AVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHL  401
               VK+LDLYGKLNGH+GCVN + FNSTGD+LVSGSDD+Q++LW+W + + KLSYPSGH 
Sbjct  73   SGRVKKLDLYGKLNGHEGCVNAVEFNSTGDVLVSGSDDRQIMLWNWLSGSRKLSYPSGHC  132

Query  402  DNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPY  581
            +N+FQ KF+PFTDDR I+T+ ADGQVRLGQ+LENG+V+TKRLG+H GRV+ LAV PG P 
Sbjct  133  ENVFQTKFIPFTDDRTIITSGADGQVRLGQILENGKVETKRLGRHHGRVYKLAVLPGDPN  192

Query  582  IFYSCGEDGFVKHYDL  629
            +FYSCGEDGFV+H+D+
Sbjct  193  VFYSCGEDGFVQHFDI  208



>ref|XP_010425987.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Camelina 
sativa]
Length=479

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M +  +    D F E + REIGF  + + SRRISASE +VK+LDLYGKLNGH+GCVN ++
Sbjct  1    MARRRNTEIGDSFTELFNREIGFFHSSSISRRISASEGIVKKLDLYGKLNGHEGCVNALD  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            F+STG++LVSGSDD+Q+ILW+W + +  LSYPSGH +N+FQ KF+PFTDDR I+T+ AD 
Sbjct  61   FSSTGEVLVSGSDDRQIILWNWLSGSKTLSYPSGHCENVFQTKFIPFTDDRTIITSGADR  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVRLGQ+LENG+V+TKRLG+H GRV+ LAV PG P +FYSCGEDGFV+H+D+
Sbjct  121  QVRLGQILENGKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDI  172



>ref|XP_009421372.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E WKRE+G S  R F+RR+  SEA+VK++  YG L GH+GCVNTI+FN  GD+LVSGSDD
Sbjct  17   EIWKRELGPSLPRFFARRVGGSEALVKRMVSYGNLCGHKGCVNTIHFNPAGDLLVSGSDD  76

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            K +ILW+W +K  K +Y SGH+DN+FQA  MPFT+DR I+T++ADGQVR+GQ+ +NG V 
Sbjct  77   KGIILWNWESKYKKFTYASGHMDNVFQALIMPFTEDRTIITSAADGQVRVGQIADNGIVT  136

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK+LG H+GRVH LA+EPGSP+IFYSCGEDG ++H+DL
Sbjct  137  TKQLGTHRGRVHKLAIEPGSPHIFYSCGEDGLIQHFDL  174



>ref|XP_002521240.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF41096.1| WD-repeat protein, putative [Ricinus communis]
Length=482

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK    + D   L  W+RE+G  + R F+ R++ASE +V +LDLY KL+ H+GCVNT++
Sbjct  1    MKKRARTNPDKAVLNVWQREVGELSTRNFAHRLAASEDLVLRLDLYKKLDKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILWDW +   KLS+ SGH  N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNANGDILVSGSDDRRVILWDWESGRIKLSFHSGHTKNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G V+T  L KHQGR H LA+EPGSPYI Y+CGEDG V+H+DL
Sbjct  121  QVRFAQILECGAVETTLLAKHQGRAHKLAIEPGSPYILYTCGEDGLVQHFDL  172



>ref|XP_009421371.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=477

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E WKRE+G S  R F+RR+  SEA+VK++  YG L GH+GCVNTI+FN  GD+LVSGSDD
Sbjct  17   EIWKRELGPSLPRFFARRVGGSEALVKRMVSYGNLCGHKGCVNTIHFNPAGDLLVSGSDD  76

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            K +ILW+W +K  K +Y SGH+DN+FQA  MPFT+DR I+T++ADGQVR+GQ+ +NG V 
Sbjct  77   KGIILWNWESKYKKFTYASGHMDNVFQALIMPFTEDRTIITSAADGQVRVGQIADNGIVT  136

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK+LG H+GRVH LA+EPGSP+IFYSCGEDG ++H+DL
Sbjct  137  TKQLGTHRGRVHKLAIEPGSPHIFYSCGEDGLIQHFDL  174



>ref|XP_008654447.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Zea mays]
 tpg|DAA44808.1| TPA: hypothetical protein ZEAMMB73_645766 [Zea mays]
Length=483

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            FLE  +REIG S  R  SRRIS SE +V  +  YGKL+GH+GCVNT++FN  GD+LVSGS
Sbjct  17   FLEVGRREIGSSFPRVSSRRISGSEHIVSSMSQYGKLHGHEGCVNTVSFNPAGDLLVSGS  76

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW +KT KL YPSGH DN+F A+ MPFTDD  IVT +ADGQVR+G++ E GE
Sbjct  77   DDTNIILWDWLSKTKKLVYPSGHQDNVFHARVMPFTDDSTIVTVAADGQVRVGRLKEGGE  136

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V TK +G+H  RVH +A+EPG+PYIFYSCGEDG V+H+DL
Sbjct  137  VTTKLVGEHDSRVHKMAIEPGNPYIFYSCGEDGLVQHFDL  176



>ref|XP_002468049.1| hypothetical protein SORBIDRAFT_01g038680 [Sorghum bicolor]
 gb|EER95047.1| hypothetical protein SORBIDRAFT_01g038680 [Sorghum bicolor]
Length=478

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  138  KDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDIL  317
            K   FLE  +REIG S  R  SRRIS SE +V ++  YGKL GH+GCVNT++FN  GD+L
Sbjct  12   KGSCFLEVGRREIGSSFPRASSRRISGSEHIVLRMSQYGKLRGHEGCVNTVSFNPAGDLL  71

Query  318  VSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVL  497
            VSGSDD  +ILWDW +KT KL YPSGH  N+F A+ MPFTDD  IVT +ADGQVR+GQ+ 
Sbjct  72   VSGSDDTNIILWDWLSKTKKLVYPSGHQGNVFHARVMPFTDDSTIVTVAADGQVRVGQLK  131

Query  498  ENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            E GEV TK +G+H  RVH +A+EPGSPYIFYSCGEDG V+H+DL
Sbjct  132  EGGEVTTKLVGEHDSRVHKMAIEPGSPYIFYSCGEDGLVQHFDL  175



>emb|CDY12084.1| BnaC03g60000D [Brassica napus]
Length=488

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            S D   +  W+RE+G    R+FS R SASE ++ +L L+ KL  H GCVNT++FN+ GDI
Sbjct  11   SSDHTVVRIWERELGQLPNRSFSNRFSASEHLLNRLGLHKKLREHTGCVNTVSFNADGDI  70

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD+QVILWDW T T KLS+ SGH DNIFQAKFMPF+DDR IVT+SADGQVR  ++
Sbjct  71   LVSGSDDRQVILWDWDTATVKLSFDSGHCDNIFQAKFMPFSDDRSIVTSSADGQVRYSKI  130

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LE+G+V+T  LG HQG+VH LA+EPGSP+ FY+CGEDG VKH+DL
Sbjct  131  LESGQVETCMLGIHQGQVHKLAIEPGSPFSFYTCGEDGVVKHFDL  175



>ref|XP_003542007.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Glycine max]
Length=488

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  129  SASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTG  308
            + S    F + ++RE+G S   +F+RR SASE +VK LDLYGKL+GH+GCVN + FNSTG
Sbjct  14   TTSPPHGFTDIFRRELGLSHPNSFARRFSASEVLVKSLDLYGKLDGHEGCVNAVEFNSTG  73

Query  309  DILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLG  488
            DILVSGSDD+Q++ W+W +KT   +YPSGH DNIFQ K MPFTDD +IVT++ DGQ+RLG
Sbjct  74   DILVSGSDDRQIMFWNWESKTKLFAYPSGHTDNIFQTKIMPFTDDCRIVTSAGDGQIRLG  133

Query  489  QVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             + E+G VDT  LGKH G V+ LAVEPGS +IFYS GEDGF++H+DL
Sbjct  134  LLWEDGRVDTTMLGKHHGCVYKLAVEPGSAHIFYSSGEDGFIQHFDL  180



>ref|XP_003547044.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Glycine max]
Length=488

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F + ++RE+G S   +F+RR SASE +VK LDLYGKL+GH+GCVN + FNSTGD+LVSGS
Sbjct  21   FTDIFRRELGLSHPNSFARRFSASEVLVKSLDLYGKLDGHEGCVNAVEFNSTGDLLVSGS  80

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+QV+ W+WA+KT   +YPSGH DNIFQ K +PFTDD +IVT++ DGQVRLG + E+G 
Sbjct  81   DDRQVMFWNWASKTRLFAYPSGHTDNIFQTKIIPFTDDCRIVTSAGDGQVRLGLLWEDGR  140

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VDT  LGKH G V+ LAVEPGS +IFYS GEDGF++H+DL
Sbjct  141  VDTTMLGKHHGCVYKLAVEPGSAHIFYSSGEDGFIQHFDL  180



>gb|KHN33442.1| DDB1- and CUL4-associated factor 8 [Glycine soja]
Length=488

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F + ++RE+G S   +F+RR SASE +VK LDLYGKL+GH+GCVN + FNSTGD+LVSGS
Sbjct  21   FTDIFRRELGLSHPNSFARRFSASEVLVKSLDLYGKLDGHEGCVNAVEFNSTGDLLVSGS  80

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+QV+ W+WA+KT   +YPSGH DNIFQ K +PFTDD +IVT++ DGQVRLG + E+G 
Sbjct  81   DDRQVMFWNWASKTRLFAYPSGHTDNIFQTKIIPFTDDCRIVTSAGDGQVRLGLLWEDGR  140

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VDT  LGKH G V+ LAVEPGS +IFYS GEDGF++H+DL
Sbjct  141  VDTTMLGKHHGCVYKLAVEPGSAHIFYSSGEDGFIQHFDL  180



>gb|KDO68193.1| hypothetical protein CISIN_1g009266mg [Citrus sinensis]
Length=471

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>ref|XP_006422523.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
 gb|ESR35763.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
Length=458

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>gb|KDP33280.1| hypothetical protein JCGZ_13067 [Jatropha curcas]
Length=498

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S D   +  W+RE+G  + R F+ R++ASE +V +LD++ KL  H+GCVNT++
Sbjct  1    MTKRARTSPDKAVVNVWQREVGELSTRNFAHRLAASEDLVLRLDIFKKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILWDW T   KLS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWDWETGRIKLSFHSGHNNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LENG V+T  L KHQGR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRHAQILENGAVETALLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_009588100.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X5 [Nicotiana 
tomentosiformis]
Length=268

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F++R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGQLSTRNFAQRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+ VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDIVISGSDDQMVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+L++G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILDHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>ref|XP_006422524.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
 gb|ESR35764.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>gb|KDO68191.1| hypothetical protein CISIN_1g009266mg [Citrus sinensis]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>ref|XP_007150237.1| hypothetical protein PHAVU_005G137900g [Phaseolus vulgaris]
 gb|ESW22231.1| hypothetical protein PHAVU_005G137900g [Phaseolus vulgaris]
Length=484

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  96   TLRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQG  275
             L NR+     +      F + ++RE+GFS    F+RR SASE +VK L+LYG+L+GH+G
Sbjct  3    NLHNRRSITNANTGPPGAFTDIFRRELGFSHPNGFARRFSASEVLVKSLNLYGRLDGHEG  62

Query  276  CVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIV  455
            CVN + FNS+GD+LVSGSDD+QV+LW+WA+K   L+YPSGH DNIFQ K MPF+ D +I+
Sbjct  63   CVNAVEFNSSGDLLVSGSDDRQVMLWNWASKARLLAYPSGHTDNIFQTKIMPFSGDCRII  122

Query  456  TASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T++ DGQVRLG   E+G V+T  LGKH G V+ LAVEPGSP+IFYS GEDGF++H+DL
Sbjct  123  TSAGDGQVRLGLFREDGGVETALLGKHHGCVYKLAVEPGSPHIFYSSGEDGFIQHFDL  180



>gb|KDO68194.1| hypothetical protein CISIN_1g009266mg [Citrus sinensis]
Length=458

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>ref|XP_006486680.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Citrus sinensis]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>emb|CDX90275.1| BnaA08g17090D [Brassica napus]
Length=482

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            S D   +  W+RE+G    R+FS R SASE ++ +L L+ KL  H GCVNT++FN+ GDI
Sbjct  11   SSDHSVVRIWERELGQLPNRSFSNRFSASEHILNRLGLHKKLQEHTGCVNTVSFNADGDI  70

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD+QVILWDW T T KLS+ SGH +NIFQAKFMPF+DDR IVT+SADGQVR  ++
Sbjct  71   LVSGSDDRQVILWDWDTATVKLSFDSGHCNNIFQAKFMPFSDDRSIVTSSADGQVRYSKI  130

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LE+G+V+T  LG HQG+VH LA+EPGSP+ FY+CGEDG VKH+DL
Sbjct  131  LESGQVETCMLGIHQGQVHKLAIEPGSPFSFYTCGEDGVVKHFDL  175



>ref|XP_010920925.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Elaeis 
guineensis]
Length=473

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W RE+G S  R  +RRI + EA VK++  YG LNGHQGCVNTI+FN  GD+LVSGSDD
Sbjct  9    ELWDRELGASRPRVVARRIQSHEAFVKRMSFYGDLNGHQGCVNTIHFNRAGDLLVSGSDD  68

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            K +I+W+WATK+ ++ Y SGHLDN+F  + MP+TDDR I+T++ADGQVR+GQ++ENG+V 
Sbjct  69   KDIIVWNWATKSKEIIYHSGHLDNVFDVRVMPYTDDRTIITSAADGQVRVGQIMENGQVT  128

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T++LG H GRVH LA+E G+P++FYSCGEDG V+ +D+
Sbjct  129  TRQLGLHNGRVHGLAIEQGTPHVFYSCGEDGLVQRFDM  166



>emb|CBI37821.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            ++  + S D   ++ W+RE+G    R+F+ R++AS+ +V Q D+Y KL  H+GCVNT++F
Sbjct  17   RRRSTTSLDRAVVDVWQREVGGLPNRSFAHRLAASKDLVLQFDIYRKLEKHRGCVNTVSF  76

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ G+ILVSGSDD+++ILWDW +   KLS+ SGH++N+FQAKFMP+TDDR IVT +ADGQ
Sbjct  77   NADGEILVSGSDDRRIILWDWESGHVKLSFESGHINNVFQAKFMPYTDDRSIVTCAADGQ  136

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LE+G V+T  L KHQGR H LA+EPGSPYIFY+CGEDG V+H DL
Sbjct  137  VRRAQILESGRVETTLLAKHQGRAHKLAIEPGSPYIFYTCGEDGLVQHIDL  187



>ref|XP_010646524.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            ++  + S D   ++ W+RE+G    R+F+ R++AS+ +V Q D+Y KL  H+GCVNT++F
Sbjct  3    RRRSTTSLDRAVVDVWQREVGGLPNRSFAHRLAASKDLVLQFDIYRKLEKHRGCVNTVSF  62

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ G+ILVSGSDD+++ILWDW +   KLS+ SGH++N+FQAKFMP+TDDR IVT +ADGQ
Sbjct  63   NADGEILVSGSDDRRIILWDWESGHVKLSFESGHINNVFQAKFMPYTDDRSIVTCAADGQ  122

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LE+G V+T  L KHQGR H LA+EPGSPYIFY+CGEDG V+H DL
Sbjct  123  VRRAQILESGRVETTLLAKHQGRAHKLAIEPGSPYIFYTCGEDGLVQHIDL  173



>ref|XP_009109553.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Brassica rapa]
Length=482

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            S D   +  W+RE+G    R+FS R SASE ++ +L L+ KL  H GCVNT++FN+ GDI
Sbjct  11   SSDHTVVRIWERELGQLPNRSFSNRFSASEHLLNRLGLHKKLQEHTGCVNTVSFNADGDI  70

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD+QVILWDW T T KLS+ SGH +NIFQAKFMPF+DDR IVT+SADGQVR  ++
Sbjct  71   LVSGSDDRQVILWDWDTATVKLSFDSGHCNNIFQAKFMPFSDDRSIVTSSADGQVRYSKI  130

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LE+G+V+T  LG HQG+VH LA+EPGSP+ FY+CGEDG VKH+DL
Sbjct  131  LESGQVETCMLGIHQGQVHKLAIEPGSPFSFYTCGEDGVVKHFDL  175



>gb|KHN30235.1| DDB1- and CUL4-associated factor 8 [Glycine soja]
Length=488

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  129  SASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTG  308
            + S    F + ++RE+G S   +F+RR SASE +VK LDLYGKL+GH+GCVN + FNSTG
Sbjct  14   TTSPPHGFTDIFRRELGLSHPNSFARRFSASEVLVKSLDLYGKLDGHEGCVNAVEFNSTG  73

Query  309  DILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLG  488
            DILVSGSDD+Q++ W+W +KT   +YPSGH DNIFQ K MPFTD  +IVT++ DGQ+RLG
Sbjct  74   DILVSGSDDRQIMFWNWESKTKLFAYPSGHTDNIFQTKIMPFTDGCRIVTSAGDGQIRLG  133

Query  489  QVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             + E+G VDT  LGKH G V+ LAVEPGS +IFYS GEDGFV+H+DL
Sbjct  134  LLWEDGRVDTTMLGKHHGCVYKLAVEPGSAHIFYSSGEDGFVQHFDL  180



>ref|XP_006422525.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
 gb|ESR35765.1| hypothetical protein CICLE_v10028158mg [Citrus clementina]
 gb|KDO68192.1| hypothetical protein CISIN_1g009266mg [Citrus sinensis]
Length=538

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>ref|XP_004487145.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Cicer arietinum]
Length=474

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
               RE+GFS   + +RR  ASE +VK L+LY +L+GH+GCVN + FNSTGDILVSGSDD+
Sbjct  16   IMNRELGFSHPSSLTRRFYASEVIVKNLNLYARLDGHEGCVNAVEFNSTGDILVSGSDDR  75

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
            QV+ W W +KT  L YPSGH DNIFQ K MPF+DD +IVT++ DGQVRLG + E+G V+T
Sbjct  76   QVMFWSWESKTKLLVYPSGHSDNIFQTKIMPFSDDSRIVTSAGDGQVRLGILQEDGRVNT  135

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              LGKH G V+ LAVEPGSP+IFYSCGEDGF++H+DL
Sbjct  136  TMLGKHDGSVYKLAVEPGSPHIFYSCGEDGFIQHFDL  172



>ref|XP_006486678.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Citrus sinensis]
 ref|XP_006486679.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Citrus sinensis]
Length=549

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N    K    S D   ++ W RE+G  + R F+ R  ASE +V +L +Y KL+ H+GCVN
Sbjct  6    NNNNNKRARTSVDKALVDVWLRELGQLSTRNFALRRRASEDLVLRLGIYAKLDKHRGCVN  65

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T++FN+ GDIL+SGSDD++VILWDW T+  KLS+ SGH DN+FQAK MPFTDDR IVT +
Sbjct  66   TVSFNTDGDILISGSDDRRVILWDWKTERVKLSFHSGHNDNVFQAKIMPFTDDRSIVTCA  125

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADGQVR  Q+LE G V+TK LGKHQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  126  ADGQVRHAQILERGGVETKLLGKHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  180



>ref|XP_009355589.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Pyrus 
x bretschneideri]
Length=494

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F +R++ SE +V +L++Y KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKQRLAGSEDLVLRLEIYRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_010646516.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010646519.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Vitis 
vinifera]
Length=531

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            ++  + S D   ++ W+RE+G    R+F+ R++AS+ +V Q D+Y KL  H+GCVNT++F
Sbjct  3    RRRSTTSLDRAVVDVWQREVGGLPNRSFAHRLAASKDLVLQFDIYRKLEKHRGCVNTVSF  62

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ G+ILVSGSDD+++ILWDW +   KLS+ SGH++N+FQAKFMP+TDDR IVT +ADGQ
Sbjct  63   NADGEILVSGSDDRRIILWDWESGHVKLSFESGHINNVFQAKFMPYTDDRSIVTCAADGQ  122

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LE+G V+T  L KHQGR H LA+EPGSPYIFY+CGEDG V+H DL
Sbjct  123  VRRAQILESGRVETTLLAKHQGRAHKLAIEPGSPYIFYTCGEDGLVQHIDL  173



>ref|XP_009355591.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Pyrus 
x bretschneideri]
Length=482

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F +R++ SE +V +L++Y KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKQRLAGSEDLVLRLEIYRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_009355590.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Pyrus 
x bretschneideri]
Length=493

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F +R++ SE +V +L++Y KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKQRLAGSEDLVLRLEIYRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_003597148.1| DDB1- and CUL4-associated factor [Medicago truncatula]
 gb|AES67399.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=478

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+GFS   +F+    AS+ +VK L LY KL GH+GCVN + FNSTGDILVSGSDD+QV+
Sbjct  17   RELGFSHPTSFTHHFYASQVLVKNLSLYAKLEGHEGCVNAVEFNSTGDILVSGSDDRQVM  76

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
             W+W +KT    YPSGH DNIFQ K MPFTDD +IVT++ DGQVRLG V E+G V+T  L
Sbjct  77   FWNWESKTKLFDYPSGHEDNIFQTKIMPFTDDSRIVTSAGDGQVRLGLVQEDGRVNTTML  136

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            GKHQG V+ LAVEPGSP+IFYSCGEDGF+ H+DL
Sbjct  137  GKHQGSVYKLAVEPGSPHIFYSCGEDGFIHHFDL  170



>gb|KHG18469.1| DDB1- and CUL4-associated factor 8 [Gossypium arboreum]
Length=438

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            +RN++ +     S D   ++ W+RE+G  + R F  R++ASE +V +L++  KL+ H+GC
Sbjct  1    MRNKRAR----GSVDKAVVDVWQREVGEISTRNFVHRLAASEDLVLRLEILRKLDKHRGC  56

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDDK++ILWDW T  +KL++PSGH+ N+FQAK MP+TDDR ++T
Sbjct  57   VNTVSFNADGNILVSGSDDKRIILWDWETGVAKLTFPSGHVSNVFQAKIMPYTDDRSLIT  116

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V+T+ + KHQGR H LAVEPGSP+IFY+CGEDG V+H DL
Sbjct  117  CAADGQVRHAQILEGG-VETRLVAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHIDL  172



>ref|NP_568042.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE86932.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=471

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            D   +  W+RE+G    R+FS R SASE ++++L L  KL+ H+GCVNT++FN+ GDIL+
Sbjct  12   DHSVVNVWERELGLLPNRSFSNRFSASEDLLRRLGLDKKLDKHKGCVNTVSFNADGDILL  71

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD+QVILWDW T + KLS+ SGH +NIFQAKFMPF+DDR IVT++AD QVR  ++LE
Sbjct  72   SGSDDRQVILWDWQTASVKLSFDSGHFNNIFQAKFMPFSDDRTIVTSAADKQVRYSKILE  131

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G+V+T  LGKHQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  132  SGQVETSLLGKHQGPVHKLAVEPGSPFSFYTCGEDGAVKHFDL  174



>gb|AAM61549.1| unknown [Arabidopsis thaliana]
Length=471

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            D   +  W+RE+G    R+FS R SASE ++++L L  KL+ H+GCVNT++FN+ GDIL+
Sbjct  12   DHSVVNVWERELGLLPNRSFSNRFSASEDLLRRLGLDKKLDKHKGCVNTVSFNADGDILL  71

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD+QVILWDW T + KLS+ SGH +NIFQAKFMPF+DDR IVT++AD QVR  ++LE
Sbjct  72   SGSDDRQVILWDWQTASVKLSFDSGHFNNIFQAKFMPFSDDRTIVTSAADKQVRYSKILE  131

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G+V+T  LGKHQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  132  SGQVETSLLGKHQGPVHKLAVEPGSPFSFYTCGEDGAVKHFDL  174



>ref|NP_001049775.1| Os03g0286800 [Oryza sativa Japonica Group]
 gb|ABF95362.1| WD domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11689.1| Os03g0286800 [Oryza sativa Japonica Group]
 dbj|BAG99376.1| unnamed protein product [Oryza sativa Japonica Group]
Length=477

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  ++EIG S  R  SRRIS SE +V ++  YGKL GH GCVNT++FN  G++LVSGS
Sbjct  16   FFEVGRQEIGSSTPRASSRRISGSEGLVMRMHQYGKLRGHDGCVNTVSFNPAGNLLVSGS  75

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  KT +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+GQ+ E GE
Sbjct  76   DDMDIILWDWLAKTQRLIYPSGHQENVFHARVMPFTDDSAIVTVAADGQVRVGQLNEGGE  135

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V TK++G H  R H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  136  VTTKQIGVHDDRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  175



>ref|XP_008365923.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Malus domestica]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F  R++ SE +V +L+++ KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKHRLAGSEDLVLRLEIFRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_009588099.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X4 [Nicotiana 
tomentosiformis]
Length=420

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F++R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGQLSTRNFAQRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+ VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDIVISGSDDQMVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+L++G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILDHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>ref|XP_008365924.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Malus domestica]
Length=480

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F  R++ SE +V +L+++ KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKHRLAGSEDLVLRLEIFRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_008365922.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Malus domestica]
Length=493

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M   +  S D   +  W+RE+G  +AR F  R++ SE +V +L+++ KL  H+GCVNT++
Sbjct  1    MNTRHRTSIDKAVVNVWQREVGQLSARNFKHRLAGSEDLVLRLEIFRKLEKHKGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T  ++LS+ SGH +NIFQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDILVSGSDDRRVILWNWETGKAQLSFHSGHNNNIFQAKIMPYTDDRTIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T  LG+H GR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRRSQILERGQVNTSLLGRHMGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_009802647.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Nicotiana 
sylvestris]
Length=492

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F+ R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGALSTRNFAHRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN  GDI++SGSDD++VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNVDGDIVISGSDDQKVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>ref|XP_010431782.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Camelina 
sativa]
Length=461

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  138  KDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDIL  317
            +D   +  W+RE+G    R FS R SASE ++++L L  KL  H+GCVNT++FN+ GDIL
Sbjct  11   RDHSVVNVWERELGLLPNRNFSNRFSASEDLLRRLGLDKKLVKHKGCVNTVSFNADGDIL  70

Query  318  VSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVL  497
            +SGSDDKQVILWDW T T KLS+ SGH +N+FQA+FMPF+DDR IVT++AD QVR  ++L
Sbjct  71   LSGSDDKQVILWDWQTPTVKLSFDSGHFNNVFQAQFMPFSDDRSIVTSAADKQVRHSKIL  130

Query  498  ENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            E+G+V+T  LGKHQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  131  ESGQVETCLLGKHQGPVHKLAVEPGSPFSFYTCGEDGVVKHFDL  174



>ref|XP_002866801.1| hypothetical protein ARALYDRAFT_490608 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43060.1| hypothetical protein ARALYDRAFT_490608 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            D   +  W+RE+G    R+FS R SASE ++++L L  KL+ H+GCVN+++FN+ GD+L+
Sbjct  12   DHSVVNVWEREVGLLPNRSFSNRFSASEDLLRRLGLDKKLDKHKGCVNSVSFNADGDLLL  71

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDDKQVILWDW T + KLS+ SGH +N+FQAKFMPF+DDR IVT++AD QVR  ++LE
Sbjct  72   SGSDDKQVILWDWETASVKLSFDSGHFNNVFQAKFMPFSDDRSIVTSAADKQVRYSKILE  131

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G+V+T  LGKHQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  132  SGQVETSLLGKHQGPVHKLAVEPGSPFSFYTCGEDGAVKHFDL  174



>ref|XP_004984829.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Setaria italica]
Length=520

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  +R+IG S  R  SRRIS SE +V ++  YGKL GH GCVNT++FN  GD+LVSGS
Sbjct  58   FFEVGRRDIGSSFPRASSRRISGSEYIVMRMTQYGKLRGHDGCVNTVSFNPAGDLLVSGS  117

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  KT +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+G++ E GE
Sbjct  118  DDTNIILWDWFAKTKRLVYPSGHQENVFHARVMPFTDDSTIVTVAADGQVRVGRLKEGGE  177

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V TK +G+H  RVH +A+EPGSPYIFYSCGEDG V+H+DL
Sbjct  178  VTTKLVGEHDSRVHKVAIEPGSPYIFYSCGEDGLVQHFDL  217



>gb|EEE58841.1| hypothetical protein OsJ_10420 [Oryza sativa Japonica Group]
Length=530

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  ++EIG S  R  SRRIS SE +V ++  YGKL GH GCVNT++FN  G++LVSGS
Sbjct  16   FFEVGRQEIGSSTPRASSRRISGSEGLVMRMHQYGKLRGHDGCVNTVSFNPAGNLLVSGS  75

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  KT +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+GQ+ E GE
Sbjct  76   DDMDIILWDWLAKTQRLIYPSGHQENVFHARVMPFTDDSAIVTVAADGQVRVGQLNEGGE  135

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V TK++G H  R H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  136  VTTKQIGVHDDRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  175



>ref|XP_007015514.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY33133.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=168

 Score =   212 bits (539),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            +V +++LYG+LNGH+ CVNT+ FNSTGD+LVSGSDDK V+LW+WATK+  LSY SGHLDN
Sbjct  36   LVDKINLYGELNGHEECVNTVEFNSTGDLLVSGSDDKHVVLWNWATKSKTLSYASGHLDN  95

Query  408  IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
            IFQA+ +PF D++KIVT+ ADGQVRLG++LENG+V T++LG+HQGRVH+LAV+PGSP+IF
Sbjct  96   IFQARIIPFADEKKIVTSPADGQVRLGEILENGQVRTRKLGEHQGRVHNLAVDPGSPHIF  155

Query  588  YSCGEDGFVKH  620
            YS GEDG V+H
Sbjct  156  YSSGEDGLVQH  166



>ref|XP_009588095.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Nicotiana 
tomentosiformis]
Length=492

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F++R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGQLSTRNFAQRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+ VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDIVISGSDDQMVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+L++G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILDHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>gb|KJB47716.1| hypothetical protein B456_008G037700 [Gossypium raimondii]
Length=512

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE +V +LD+Y KL  H+GC
Sbjct  1    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEDLVLRLDIYKKLEKHRGC  56

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDD++VILWDW T   KL + SGH++N+FQAKFMP+TDDR +VT
Sbjct  57   VNTVSFNADGNILVSGSDDRRVILWDWETGNGKLVFQSGHVNNVFQAKFMPYTDDRCLVT  116

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V+T+ L KHQG+VH LA+EPGSP+IFY+CGEDG V+H DL
Sbjct  117  CAADGQVRHAQILERG-VETRLLAKHQGQVHKLAIEPGSPHIFYTCGEDGLVQHIDL  172



>gb|KJB47712.1| hypothetical protein B456_008G037700 [Gossypium raimondii]
Length=513

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE +V +LD+Y KL  H+GC
Sbjct  1    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEDLVLRLDIYKKLEKHRGC  56

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDD++VILWDW T   KL + SGH++N+FQAKFMP+TDDR +VT
Sbjct  57   VNTVSFNADGNILVSGSDDRRVILWDWETGNGKLVFQSGHVNNVFQAKFMPYTDDRCLVT  116

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V+T+ L KHQG+VH LA+EPGSP+IFY+CGEDG V+H DL
Sbjct  117  CAADGQVRHAQILERG-VETRLLAKHQGQVHKLAIEPGSPHIFYTCGEDGLVQHIDL  172



>gb|KDO73115.1| hypothetical protein CISIN_1g013644mg [Citrus sinensis]
Length=439

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  231  VKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNI  410
            +K+++L GKL+GH+GCVN + FNSTGD LVSGSDDK VI WDW  +  K SY SGHLDNI
Sbjct  1    MKRINLCGKLHGHKGCVNAVEFNSTGDFLVSGSDDKLVIFWDWKDRREKFSYLSGHLDNI  60

Query  411  FQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFY  590
            FQ + MPFTDDRKI+T+SADGQVRLGQ+ E+G +DTKRLGKHQGRV+ LAVEPGSPYI Y
Sbjct  61   FQTRIMPFTDDRKIITSSADGQVRLGQIFEDGRMDTKRLGKHQGRVYKLAVEPGSPYIIY  120

Query  591  SCGEDGFVKHYDL  629
            SCGEDGFV+H+DL
Sbjct  121  SCGEDGFVQHFDL  133



>gb|KJB47714.1| hypothetical protein B456_008G037700 [Gossypium raimondii]
Length=401

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE +V +LD+Y KL  H+GC
Sbjct  1    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEDLVLRLDIYKKLEKHRGC  56

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDD++VILWDW T   KL + SGH++N+FQAKFMP+TDDR +VT
Sbjct  57   VNTVSFNADGNILVSGSDDRRVILWDWETGNGKLVFQSGHVNNVFQAKFMPYTDDRCLVT  116

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKH  620
             +ADGQVR  Q+LE G V+T+ L KHQG+VH LA+EPGSP+IFY+CGEDG V+H
Sbjct  117  CAADGQVRHAQILERG-VETRLLAKHQGQVHKLAIEPGSPHIFYTCGEDGLVQH  169



>ref|XP_010446355.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Camelina 
sativa]
Length=462

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  138  KDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDIL  317
            +D   +  W+RE+G    R FS R SASE ++++L L  KL  H+GCVNT++FN+ GDIL
Sbjct  11   RDHSVVNVWERELGLLPNRNFSNRFSASENLLRRLGLDKKLVEHKGCVNTVSFNADGDIL  70

Query  318  VSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVL  497
            +SGSDDKQVILWDW T + KLS+ SGH +N+FQA+FMPF+DDR IVT++AD QVR  Q+ 
Sbjct  71   LSGSDDKQVILWDWQTASVKLSFDSGHYNNVFQAQFMPFSDDRSIVTSAADKQVRHSQIH  130

Query  498  ENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            E+G+V+T  LGKHQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  131  ESGQVETSLLGKHQGPVHKLAVEPGSPFSFYTCGEDGVVKHFDL  174



>ref|XP_007041733.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX97564.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=491

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ K     S D   ++ W+RE+G  + R+F+ R++ASE +V +L++Y KL  H+GC
Sbjct  2    MKNKRSK----TSVDKAVVDVWQREVGELSTRSFAHRLAASEDLVLRLEIYKKLEKHRGC  57

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDDK V+LWDW T  +KLS+ SGH++N+FQAK MP+TDDR +VT
Sbjct  58   VNTVSFNADGNILVSGSDDKLVVLWDWETGHAKLSFQSGHVNNVFQAKIMPYTDDRSLVT  117

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V T+ L KHQGR H LA+EPGSP+IFY+CGEDG V+H DL
Sbjct  118  CAADGQVRHAQILERG-VKTRLLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHIDL  173



>gb|KJB77781.1| hypothetical protein B456_012G156900 [Gossypium raimondii]
Length=488

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE +V +L++Y KL  H+GC
Sbjct  1    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEDLVLRLEIYKKLKKHRGC  56

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDDK+VILWDW T  +KL++ SGH++N+FQAK MP++DDR +VT
Sbjct  57   VNTVSFNADGNILVSGSDDKRVILWDWETGNAKLTFQSGHVNNVFQAKIMPYSDDRSLVT  116

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V+TK L KHQGR H + +EPGSPYIFY+CGEDG V+H DL
Sbjct  117  CAADGQVRHAQILERG-VETKLLAKHQGRAHKVVIEPGSPYIFYTCGEDGLVQHIDL  172



>emb|CDP14535.1| unnamed protein product [Coffea canephora]
Length=798

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K    S D   ++ WKRE+G  + R F+ R++ASE +V +LD++GKL+ H+GCVNT+N
Sbjct  1    MRKRARTSLDTAVVDIWKREVGDLSTRNFAHRLAASEDLVLRLDIFGKLDKHRGCVNTVN  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDIL+SGSDD++VILWDW     +LS+ SGH +N+FQAK MP+T+DR IVT +ADG
Sbjct  61   FNADGDILISGSDDRRVILWDWEGGNVRLSFHSGHHNNVFQAKIMPYTEDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G+V+T+ L KH GR H LA+EPGSP+I Y+CGEDG V+H DL
Sbjct  121  QVRHAQILERGKVETRLLAKHHGRAHKLAIEPGSPHIVYTCGEDGLVQHIDL  172



>ref|XP_009802646.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Nicotiana 
sylvestris]
Length=544

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F+ R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGALSTRNFAHRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN  GDI++SGSDD++VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNVDGDIVISGSDDQKVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>ref|XP_002306202.1| hypothetical protein POPTR_0004s18520g [Populus trichocarpa]
 gb|EEE86713.1| hypothetical protein POPTR_0004s18520g [Populus trichocarpa]
Length=442

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK  SA  D   +  WKRE+G  + R F+ R +ASE +V +L+++ KL  H GCVNT++
Sbjct  1    MKKRSSADIDQAVVNVWKRELGQLSTRNFAHRFAASEDLVSRLEIHKKLEKHDGCVNTLS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD +VILWDW T   KLS+ SGH +N+FQA FMPF+DDR I+T +ADG
Sbjct  61   FNAGGDILVSGSDDLRVILWDWETGRDKLSFRSGHDNNVFQANFMPFSDDRTIITCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKH-QGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++R  Q+LE GEV T  LGKH + +VH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  121  EIRQAQILEGGEVKTILLGKHEESQVHKLAIEPGSPHIFYSCGEDGVVQHFDL  173



>ref|XP_009588094.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Nicotiana 
tomentosiformis]
Length=541

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKRE+G  + R F++R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  1    MRKRTRSSVDCAVVDVWKREVGQLSTRNFAQRLAASEDLVLRLDVLRKLEKHRGCVNTVS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+ VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  61   FNADGDIVISGSDDQMVILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+L++G+V+TK L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  121  QVRQAQILDHGKVETKLLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  172



>ref|XP_010315399.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Solanum 
lycopersicum]
Length=494

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN  GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNPDGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP SP+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPASPHIVYTCGEDGLVQHIDL  173



>ref|XP_010315400.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Solanum 
lycopersicum]
Length=493

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN  GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNPDGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP SP+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPASPHIVYTCGEDGLVQHIDL  173



>ref|XP_006283705.1| hypothetical protein CARUB_v10004776mg [Capsella rubella]
 gb|EOA16603.1| hypothetical protein CARUB_v10004776mg [Capsella rubella]
Length=455

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            +  W+RE+G    R FS R +ASE ++++L L+ KL  H+GCVNT++FN+ GDIL+SGSD
Sbjct  17   VSVWERELGLLPNRNFSTRFAASEDLLRRLGLHKKLFKHKGCVNTVSFNADGDILLSGSD  76

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            DKQVILWDW + + KLS+ SGH DNIFQAKFMPF+DD  IVT++AD QVR  ++LE+G+V
Sbjct  77   DKQVILWDWQSASVKLSFNSGHSDNIFQAKFMPFSDDLSIVTSAADKQVRYSKILESGQV  136

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG+HQG VH LAVEPGSP+ FY+CGEDG VKH+DL
Sbjct  137  ETSLLGEHQGPVHKLAVEPGSPFSFYTCGEDGVVKHFDL  175



>gb|KHG25597.1| DDB1- and CUL4-associated factor 8 [Gossypium arboreum]
Length=513

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE +V +LD+Y KL  H+GC
Sbjct  2    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEDLVLRLDIYKKLEKHRGC  57

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDD++VILWDW T  +KL + SGH++N+FQAKFMP+TDDR +VT
Sbjct  58   VNTVSFNADGNILVSGSDDRRVILWDWETGNAKLVFQSGHVNNVFQAKFMPYTDDRCLVT  117

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE  +V T+ L KHQG+VH LA+EPGSP+IFY+CGEDG V+H DL
Sbjct  118  CAADGQVRHAQILER-DVATRLLAKHQGQVHKLAIEPGSPHIFYTCGEDGLVQHIDL  173



>ref|XP_007041732.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX97563.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=579

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            ++N++ K     S D   ++ W+RE+G  + R+F+ R++ASE +V +L++Y KL  H+GC
Sbjct  2    MKNKRSK----TSVDKAVVDVWQREVGELSTRSFAHRLAASEDLVLRLEIYKKLEKHRGC  57

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ G+ILVSGSDDK V+LWDW T  +KLS+ SGH++N+FQAK MP+TDDR +VT
Sbjct  58   VNTVSFNADGNILVSGSDDKLVVLWDWETGHAKLSFQSGHVNNVFQAKIMPYTDDRSLVT  117

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LE G V T+ L KHQGR H LA+EPGSP+IFY+CGEDG V+H DL
Sbjct  118  CAADGQVRHAQILERG-VKTRLLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHIDL  173



>ref|XP_006364511.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Solanum tuberosum]
Length=494

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNADGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP  P+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPACPHIVYTCGEDGLVQHIDL  173



>ref|XP_006364512.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Solanum tuberosum]
Length=493

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNADGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP  P+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPACPHIVYTCGEDGLVQHIDL  173



>ref|XP_010541751.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 
8 [Tarenaya hassleriana]
Length=527

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 130/171 (76%), Gaps = 10/171 (6%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISAS--------EAVVKQLDLYGKLNGHQGCVNTINF  296
            DD+  +F +     S A   S R S++        + +VK++DLYGKLNGH GCVN + F
Sbjct  58   DDR--DFHRASDRVSTASVPSSRFSSTISLGCLLFQGIVKKIDLYGKLNGHGGCVNVVEF  115

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            NSTGD+LVSGSDD+Q+++W+W  ++  LSYPSGH DN+FQ K MP TDD+KIVT+  DGQ
Sbjct  116  NSTGDMLVSGSDDRQIMIWNWLDRSRTLSYPSGHCDNVFQTKIMPLTDDQKIVTSVVDGQ  175

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VRLG+VLENG+V  KRLG+H GR++ LAVEPG+P IFYSCGEDGFV+H+DL
Sbjct  176  VRLGEVLENGQVKIKRLGRHHGRIYKLAVEPGNPNIFYSCGEDGFVQHFDL  226



>ref|XP_010530935.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Tarenaya 
hassleriana]
Length=502

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N K K+  ++      ++FW+RE+G  ++R+F+ R +ASE +V +L++Y KL  H+ CVN
Sbjct  2    NGKAKRARTSLDHHPVVDFWRREVGTISSRSFADRFAASENLVLRLEIYKKLQKHRECVN  61

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T+ FN+ GDIL+SGSDD++VILW+W     +LS+ SGH +N+FQAKFMPF+DDR IVT +
Sbjct  62   TVGFNADGDILISGSDDRRVILWNWEVGNVELSFHSGHSNNVFQAKFMPFSDDRSIVTCA  121

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADG+VR  ++LENG+V+T  LG HQGR H LA+EPGS ++FY+CGEDG V+H+DL
Sbjct  122  ADGEVRHAKILENGKVETSLLGIHQGRAHKLAIEPGSSHVFYTCGEDGLVQHFDL  176



>ref|XP_006411638.1| hypothetical protein EUTSA_v10025111mg [Eutrema salsugineum]
 gb|ESQ53091.1| hypothetical protein EUTSA_v10025111mg [Eutrema salsugineum]
Length=469

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            +  R  KK    + D   +   +RE+G    R FS R SAS+ ++++L L+ KL  H+GC
Sbjct  1    MSGRPAKK--PRTTDHSVVRICERELGRLPNRNFSNRFSASQHLLQRLGLHKKLRKHKGC  58

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ GDIL+S SDD+QVILWDW T + KLS+ SGH +NIFQAKFMPF+DDR IVT
Sbjct  59   VNTVSFNADGDILLSASDDRQVILWDWDTASVKLSFDSGHCNNIFQAKFMPFSDDRTIVT  118

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++ADGQVR  ++LE+G+V+T  LGKHQGRVH LAVEP SP+ FY+CGEDG VKH+DL
Sbjct  119  SAADGQVRSSKILESGQVETCLLGKHQGRVHKLAVEPASPFSFYTCGEDGVVKHFDL  175



>ref|XP_008236073.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Prunus 
mume]
Length=474

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S     +  W+RE+G  +AR F+ R+  SE +V +L+LY KL  H+GCVNTI+
Sbjct  1    MNKRPRTSIGKAVVNVWQREVGELSARNFTHRVGGSEDLVLRLELYRKLEKHRGCVNTIS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T   +LS+ SGH +NIFQAK MP+TDDR I+T +ADG
Sbjct  61   FNAAGDILVSGSDDRRVILWNWETGKVQLSFHSGHNNNIFQAKIMPYTDDRSIITCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ + G+V T  LGKH GR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRHAQISDKGQVKTSLLGKHLGRSHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_008236072.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Prunus 
mume]
Length=493

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S     +  W+RE+G  +AR F+ R+  SE +V +L+LY KL  H+GCVNTI+
Sbjct  1    MNKRPRTSIGKAVVNVWQREVGELSARNFTHRVGGSEDLVLRLELYRKLEKHRGCVNTIS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T   +LS+ SGH +NIFQAK MP+TDDR I+T +ADG
Sbjct  61   FNAAGDILVSGSDDRRVILWNWETGKVQLSFHSGHNNNIFQAKIMPYTDDRSIITCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ + G+V T  LGKH GR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRHAQISDKGQVKTSLLGKHLGRSHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>emb|CDX99156.1| BnaA06g18470D [Brassica napus]
Length=452

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  210  ISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYP  389
            I   + +VK+LD+YGKLNGH+GCVN + F+STGDILVSGSDD+Q++LW+    +  L+YP
Sbjct  6    IKLFQGIVKKLDVYGKLNGHEGCVNAVEFSSTGDILVSGSDDRQIMLWNLLNGSRTLTYP  65

Query  390  SGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEP  569
            SGH +N+FQ KF+PFTDDR I+T+ ADGQVRLGQ+LENG+V+TKRLG+H+GRV+ LAV P
Sbjct  66   SGHCENVFQTKFIPFTDDRTIITSGADGQVRLGQILENGKVETKRLGRHRGRVYKLAVLP  125

Query  570  GSPYIFYSCGEDGFVKHYDL  629
            G P +FYSCGEDGFV+H+D+
Sbjct  126  GDPNVFYSCGEDGFVQHFDI  145



>ref|XP_008236071.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Prunus 
mume]
Length=494

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S     +  W+RE+G  +AR F+ R+  SE +V +L+LY KL  H+GCVNTI+
Sbjct  1    MNKRPRTSIGKAVVNVWQREVGELSARNFTHRVGGSEDLVLRLELYRKLEKHRGCVNTIS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T   +LS+ SGH +NIFQAK MP+TDDR I+T +ADG
Sbjct  61   FNAAGDILVSGSDDRRVILWNWETGKVQLSFHSGHNNNIFQAKIMPYTDDRSIITCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ + G+V T  LGKH GR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRHAQISDKGQVKTSLLGKHLGRSHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_007199802.1| hypothetical protein PRUPE_ppa004717mg [Prunus persica]
 gb|EMJ01001.1| hypothetical protein PRUPE_ppa004717mg [Prunus persica]
Length=494

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S     +  W+RE+G  +AR F+ R+  SE +V +L+LY KL  H+GCVNTI+
Sbjct  1    MNKRPRTSIGKAVVNVWQREVGELSARNFTHRVGGSEDLVLRLELYRKLEKHRGCVNTIS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD++VILW+W T   +LS+ SGH +NIFQAK MP+TDDR I+T +ADG
Sbjct  61   FNAAGDILVSGSDDRRVILWNWETGKVQLSFHSGHNNNIFQAKIMPYTDDRSIITCAADG  120

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ + G+V T  LGKH GR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  121  QVRHAQISDKGQVKTSLLGKHLGRSHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_006283477.1| hypothetical protein CARUB_v10004525mg [Capsella rubella]
 gb|EOA16375.1| hypothetical protein CARUB_v10004525mg [Capsella rubella]
Length=494

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASEDLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VILWDW     KLS+ SGH DN+FQAKFMPF+DDR IVT +ADG VR   +LE  +V
Sbjct  80   DRRVILWDWQLGNVKLSFHSGHADNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGAKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|XP_006651270.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Oryza brachyantha]
Length=480

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  +REIG    R  SRRIS SE+++ ++  YGKL GH GCVNT++FN  G++LVSGS
Sbjct  18   FFEVGRREIGSYTPRASSRRISGSESLMMRMHQYGKLRGHDGCVNTVSFNPAGNLLVSGS  77

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  K+ +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+GQ+ E  E
Sbjct  78   DDMDIILWDWLAKSKRLVYPSGHQENVFHARVMPFTDDNTIVTVAADGQVRVGQLKEGDE  137

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V TK++G H  RVH LA+EPGSP IFY+CGEDG V+H+DL
Sbjct  138  VTTKQIGAHDDRVHRLAIEPGSPCIFYTCGEDGLVQHFDL  177



>ref|XP_010690313.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=496

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            ++  ++ W+RE+G  ++R F+ R++ASE +V + D+  KL  H+GCVNT++FN++G+ILV
Sbjct  11   ENTIVDVWRREVGQLSSRNFAHRLAASEGLVLRFDILRKLERHRGCVNTVSFNASGEILV  70

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD++VILWDW    +KLS+ SGH +NIFQA+FMP +DD  IVT +ADGQVR  Q+LE
Sbjct  71   SGSDDRRVILWDWEVGHAKLSFHSGHGNNIFQARFMPCSDDLSIVTCAADGQVRHAQILE  130

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             G V+T  LG+HQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  131  GGHVETSLLGRHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  173



>ref|XP_004497203.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Cicer arietinum]
Length=498

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G   AR F  R++A+E +V +LD++ KL  H+GCVNT+ FN+ GDILVSGSDD+++I
Sbjct  20   RELGRLPARIFPNRLAANEDLVLRLDVFTKLEKHRGCVNTVCFNADGDILVSGSDDRRII  79

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KLS+ SGH +N+FQAKFMP +DDR IVT +ADGQVR  Q+LENG ++TK L
Sbjct  80   LWDWETSRIKLSFHSGHSNNVFQAKFMPHSDDRSIVTCAADGQVRHAQILENGRIETKLL  139

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             KHQGR H LA+EPGS +IFYSCGEDG V+H+DL
Sbjct  140  AKHQGRAHKLAIEPGSSHIFYSCGEDGLVQHFDL  173



>ref|XP_011045634.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Populus 
euphratica]
Length=496

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK      D   +   KRE+G  + R F+ R++ASE +V +L+++ KL  H+GCVNT++
Sbjct  2    MKKRSRTDLDQAVVNVCKRELGQLSTRDFAHRLAASEDLVLRLEIHKKLEKHEGCVNTLS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GD+L+SGSDD +VILWDW T   KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG
Sbjct  62   FNSDGDVLISGSDDLRVILWDWETGRVKLSFNSGHRNNVFQAKFMPFSDDRTIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQ-GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++R  Q+LE GEV T  LGKH+  RVH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  122  EIRQAQILEGGEVKTILLGKHEDSRVHKLAIEPGSPHIFYSCGEDGVVQHFDL  174



>ref|XP_008447917.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Cucumis melo]
Length=480

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            +  WKRE+G  + R F+ R+ A E +V +LDLY KL  H+GCVNT++FN+ GDILVSGSD
Sbjct  15   VNVWKREVGELSTRNFAHRLGALEDLVLRLDLYKKLERHKGCVNTVSFNAAGDILVSGSD  74

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VILW+W T   KLS+ SGH +N+FQAK MP+TDDR IVT +ADGQVR  Q+L +G V
Sbjct  75   DRRVILWNWETGRVKLSFQSGHNNNVFQAKIMPYTDDRSIVTCAADGQVRHAQILNSGHV  134

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG H GR H LA+EPGSPY+FY+CGEDG V+ +DL
Sbjct  135  ETSLLGSHLGRAHKLAIEPGSPYMFYTCGEDGLVQRFDL  173



>ref|XP_002312940.1| transducin family protein [Populus trichocarpa]
 gb|EEE86895.1| transducin family protein [Populus trichocarpa]
Length=496

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK      D   +   KRE+G  + R F+ R++ASE +V +L+++ KL  H+GCVNT++
Sbjct  2    MKKRSRTDLDQAVVNVCKRELGQLSTRDFAHRLAASEDLVLRLEIHKKLEKHEGCVNTLS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GD+L+SGSDD +VILWDW T   KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG
Sbjct  62   FNSGGDVLISGSDDLRVILWDWETGRVKLSFNSGHRNNVFQAKFMPFSDDRTIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQ-GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++R  Q+LE GEV T  LGKH+  RVH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  122  EIRQAQILEGGEVKTILLGKHKDSRVHKLAIEPGSPHIFYSCGEDGVVQHFDL  174



>ref|XP_004231066.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Solanum 
lycopersicum]
Length=549

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN  GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNPDGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP SP+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPASPHIVYTCGEDGLVQHIDL  173



>ref|XP_011088653.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Sesamum 
indicum]
Length=493

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 6/178 (3%)
 Frame = +3

Query  96   TLRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQG  275
            T+R R    L SA      +  W+RE+G  ++R FS R++ASE +V +LD+  KL+ H+G
Sbjct  2    TMRKRTRTSLNSA-----LVNVWRRELGELSSRNFSDRLAASEDLVLRLDILQKLDLHRG  56

Query  276  CVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIV  455
            CVNTI+FN  GDILVSGSDD+++ILWDW T   +LS+ SGH +N+FQAK MP TDDR  V
Sbjct  57   CVNTISFNGAGDILVSGSDDRRIILWDWETGQPRLSFHSGHHNNVFQAKIMPCTDDRSFV  116

Query  456  TASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T +ADGQVR  Q+L +G V TK L KH GRVH LAVEPGSP+IFY+CGEDG V+H DL
Sbjct  117  TCAADGQVRHAQILASGVV-TKLLAKHHGRVHKLAVEPGSPHIFYTCGEDGLVQHIDL  173



>ref|XP_011045642.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Populus 
euphratica]
Length=484

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK      D   +   KRE+G  + R F+ R++ASE +V +L+++ KL  H+GCVNT++
Sbjct  2    MKKRSRTDLDQAVVNVCKRELGQLSTRDFAHRLAASEDLVLRLEIHKKLEKHEGCVNTLS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GD+L+SGSDD +VILWDW T   KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG
Sbjct  62   FNSDGDVLISGSDDLRVILWDWETGRVKLSFNSGHRNNVFQAKFMPFSDDRTIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQ-GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++R  Q+LE GEV T  LGKH+  RVH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  122  EIRQAQILEGGEVKTILLGKHEDSRVHKLAIEPGSPHIFYSCGEDGVVQHFDL  174



>ref|XP_010530934.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Tarenaya 
hassleriana]
Length=571

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N K K+  ++      ++FW+RE+G  ++R+F+ R +ASE +V +L++Y KL  H+ CVN
Sbjct  2    NGKAKRARTSLDHHPVVDFWRREVGTISSRSFADRFAASENLVLRLEIYKKLQKHRECVN  61

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T+ FN+ GDIL+SGSDD++VILW+W     +LS+ SGH +N+FQAKFMPF+DDR IVT +
Sbjct  62   TVGFNADGDILISGSDDRRVILWNWEVGNVELSFHSGHSNNVFQAKFMPFSDDRSIVTCA  121

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADG+VR  ++LENG+V+T  LG HQGR H LA+EPGS ++FY+CGEDG V+H+DL
Sbjct  122  ADGEVRHAKILENGKVETSLLGIHQGRAHKLAIEPGSSHVFYTCGEDGLVQHFDL  176



>ref|XP_011045649.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Populus 
euphratica]
Length=480

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK      D   +   KRE+G  + R F+ R++ASE +V +L+++ KL  H+GCVNT++
Sbjct  2    MKKRSRTDLDQAVVNVCKRELGQLSTRDFAHRLAASEDLVLRLEIHKKLEKHEGCVNTLS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FNS GD+L+SGSDD +VILWDW T   KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG
Sbjct  62   FNSDGDVLISGSDDLRVILWDWETGRVKLSFNSGHRNNVFQAKFMPFSDDRTIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQ-GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++R  Q+LE GEV T  LGKH+  RVH LA+EPGSP+IFYSCGEDG V+H+DL
Sbjct  122  EIRQAQILEGGEVKTILLGKHEDSRVHKLAIEPGSPHIFYSCGEDGVVQHFDL  174



>ref|XP_010530933.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Tarenaya 
hassleriana]
Length=572

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVN  284
            N K K+  ++      ++FW+RE+G  ++R+F+ R +ASE +V +L++Y KL  H+ CVN
Sbjct  2    NGKAKRARTSLDHHPVVDFWRREVGTISSRSFADRFAASENLVLRLEIYKKLQKHRECVN  61

Query  285  TINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTAS  464
            T+ FN+ GDIL+SGSDD++VILW+W     +LS+ SGH +N+FQAKFMPF+DDR IVT +
Sbjct  62   TVGFNADGDILISGSDDRRVILWNWEVGNVELSFHSGHSNNVFQAKFMPFSDDRSIVTCA  121

Query  465  ADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ADG+VR  ++LENG+V+T  LG HQGR H LA+EPGS ++FY+CGEDG V+H+DL
Sbjct  122  ADGEVRHAKILENGKVETSLLGIHQGRAHKLAIEPGSSHVFYTCGEDGLVQHFDL  176



>ref|XP_006364510.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Solanum tuberosum]
Length=551

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K   +S D   ++ WKR +G  + R F+ R+ ASE +V +LD++ KL  H+GCVNT++
Sbjct  2    MRKTTRSSIDCAVVDVWKRAVGELSTRNFAHRLGASEDLVLRLDVFRKLEKHRGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDI++SGSDD+++ILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADG
Sbjct  62   FNADGDIVISGSDDRRIILWDWETGKIALSFHSGHHNNVFQAKIMPYTDDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE+G+V+TK L KHQGR H LA+EP  P+I Y+CGEDG V+H DL
Sbjct  122  QVRQAQILEHGKVETKLLAKHQGRAHKLAIEPACPHIVYTCGEDGLVQHIDL  173



>ref|XP_004497202.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Cicer arietinum]
Length=518

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G   AR F  R++A+E +V +LD++ KL  H+GCVNT+ FN+ GDILVSGSDD+++I
Sbjct  20   RELGRLPARIFPNRLAANEDLVLRLDVFTKLEKHRGCVNTVCFNADGDILVSGSDDRRII  79

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KLS+ SGH +N+FQAKFMP +DDR IVT +ADGQVR  Q+LENG ++TK L
Sbjct  80   LWDWETSRIKLSFHSGHSNNVFQAKFMPHSDDRSIVTCAADGQVRHAQILENGRIETKLL  139

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             KHQGR H LA+EPGS +IFYSCGEDG V+H+DL
Sbjct  140  AKHQGRAHKLAIEPGSSHIFYSCGEDGLVQHFDL  173



>ref|XP_010690312.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            ++  ++ W+RE+G  ++R F+ R++ASE +V + D+  KL  H+GCVNT++FN++G+ILV
Sbjct  11   ENTIVDVWRREVGQLSSRNFAHRLAASEGLVLRFDILRKLERHRGCVNTVSFNASGEILV  70

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGSDD++VILWDW    +KLS+ SGH +NIFQA+FMP +DD  IVT +ADGQVR  Q+LE
Sbjct  71   SGSDDRRVILWDWEVGHAKLSFHSGHGNNIFQARFMPCSDDLSIVTCAADGQVRHAQILE  130

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             G V+T  LG+HQGR H LA+EPGSP++FY+CGEDG V+H+DL
Sbjct  131  GGHVETSLLGRHQGRAHKLAIEPGSPHVFYTCGEDGLVQHFDL  173



>ref|XP_006283478.1| hypothetical protein CARUB_v10004525mg [Capsella rubella]
 gb|EOA16376.1| hypothetical protein CARUB_v10004525mg [Capsella rubella]
Length=547

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASEDLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VILWDW     KLS+ SGH DN+FQAKFMPF+DDR IVT +ADG VR   +LE  +V
Sbjct  80   DRRVILWDWQLGNVKLSFHSGHADNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGAKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>gb|KFK30152.1| hypothetical protein AALP_AA7G223600 [Arabis alpina]
Length=505

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            +  ++FW+RE+G  ++R FS R S SE++V +L++Y KL  H+GCVNT++FN  GDIL+S
Sbjct  17   NPVVDFWRREVGGISSRNFSNRFSGSESMVLRLEIYKKLVKHKGCVNTVSFNGGGDILIS  76

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE+
Sbjct  77   GSDDRRVVLWDWELGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRASILES  136

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+V+T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  137  GKVETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|XP_006412141.1| hypothetical protein EUTSA_v10025258mg [Eutrema salsugineum]
 gb|ESQ53594.1| hypothetical protein EUTSA_v10025258mg [Eutrema salsugineum]
Length=431

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS+R S SE +V +L+++ KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSKRFSGSENLVLRLEVHRKLVKHKGCVNTVSFNADGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VI+WDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE+G+V
Sbjct  80   DRRVIIWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRASILESGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGSHQGRAHKLGIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|XP_004168977.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Cucumis sativus]
Length=480

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            +  WKRE+G  + R F+ R+ A E +V +LDLY KL  H+GCVNT++FN+ GDILVSGSD
Sbjct  15   VNVWKREVGELSTRNFAHRLGALEDLVLRLDLYKKLERHKGCVNTVSFNAAGDILVSGSD  74

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VILW+W T   KLS+ SGH +N+FQAK MP+TDD+ IVT +ADGQVR  Q+L +G V
Sbjct  75   DRRVILWNWETGRVKLSFQSGHNNNVFQAKIMPYTDDQSIVTCAADGQVRHAQILNSGHV  134

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG H GR H LA+EPGSPY+FY+CGEDG V+ +DL
Sbjct  135  ETSLLGNHLGRAHKLAIEPGSPYMFYTCGEDGLVQRFDL  173



>ref|XP_004144864.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Cucumis sativus]
 gb|KGN43277.1| hypothetical protein Csa_7G016620 [Cucumis sativus]
Length=480

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            +  WKRE+G  + R F+ R+ A E +V +LDLY KL  H+GCVNT++FN+ GDILVSGSD
Sbjct  15   VNVWKREVGELSTRNFAHRLGALEDLVLRLDLYKKLERHKGCVNTVSFNAAGDILVSGSD  74

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++VILW+W T   KLS+ SGH +N+FQAK MP+TDD+ IVT +ADGQVR  Q+L +G V
Sbjct  75   DRRVILWNWETGRVKLSFQSGHNNNVFQAKIMPYTDDQSIVTCAADGQVRHAQILNSGHV  134

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG H GR H LA+EPGSPY+FY+CGEDG V+ +DL
Sbjct  135  ETSLLGNHLGRAHKLAIEPGSPYMFYTCGEDGLVQRFDL  173



>ref|XP_006828825.1| hypothetical protein AMTR_s00001p00141440 [Amborella trichopoda]
 gb|ERM96241.1| hypothetical protein AMTR_s00001p00141440 [Amborella trichopoda]
Length=488

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W+R+ G    R F++RI+  E +V +LD Y KL  HQGCVNT++FNS+GD+LVSGSDD
Sbjct  17   EIWQRQFGMVRPRAFAQRIAGFEELVLRLDQYAKLEMHQGCVNTVHFNSSGDLLVSGSDD  76

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            + VILWDW ++  KLS+ SGH +N+FQA+ MPF+DDR IVT +ADGQVR  ++LE G+VD
Sbjct  77   RLVILWDWDSQCVKLSFHSGHTNNVFQARIMPFSDDRSIVTCAADGQVRYAKILEGGQVD  136

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T +L +H GR + LA+E GSP+IFYSCGEDG V+H+DL
Sbjct  137  TVKLARHGGRAYKLAIERGSPHIFYSCGEDGLVQHFDL  174



>ref|XP_002867089.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43348.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE  +V
Sbjct  80   DRRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRASILEGDKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|NP_195240.2| WD repeat-containing protein 42A  [Arabidopsis thaliana]
 gb|AAM53280.1| putative protein [Arabidopsis thaliana]
 gb|AAN15347.1| putative protein [Arabidopsis thaliana]
 gb|AEE86472.1| WD repeat-containing protein 42A [Arabidopsis thaliana]
Length=496

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE  +V
Sbjct  80   DRRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRASILEGDKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|XP_010432320.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Camelina sativa]
Length=526

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +VILWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  80   DWRVILWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  140  KTSFLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>emb|CDY52644.1| BnaAnng11590D [Brassica napus]
Length=481

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  + R+FS R SASE +V +L++Y KL  H+GCVNT++FN+ GDILVSGSD
Sbjct  20   VDFWRREVGGISPRSFSDRFSASENMVLRLEVYRKLAKHKGCVNTVSFNAQGDILVSGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   VLE+G+V
Sbjct  80   DRRVLLWDWELGNVKLSFHSGHSNNVFQAKFMPFSDDRTIVTCAADGMVRRASVLESGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQG  H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  140  ETVLLGLHQGPAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>ref|XP_010028776.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Eucalyptus grandis]
Length=416

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+   AS D   ++  +RE+G  +  +F+RR++ASE +V +LD+Y KL GH+GCVNT+ F
Sbjct  3    KRPRGASLDQAVVDIRRREVGGLSGLSFARRLAASEGLVLRLDIYNKLKGHRGCVNTVGF  62

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N  GDI++SGSDD+ V LWDW T   KLS+ SGH  N+FQAK MP+TDDR IVT +ADGQ
Sbjct  63   NLDGDIVISGSDDRHVKLWDWQTGKVKLSFDSGHQSNVFQAKIMPYTDDRSIVTCAADGQ  122

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             R  Q+LE G+V T  L KH+GR H LA++PGSP+I Y+CGEDG V+  DL
Sbjct  123  ARHAQILEGGQVQTMLLAKHRGRAHKLAIDPGSPHIVYTCGEDGLVQRLDL  173



>ref|XP_011088650.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Sesamum 
indicum]
 ref|XP_011088652.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Sesamum 
indicum]
Length=590

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 6/178 (3%)
 Frame = +3

Query  96   TLRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQG  275
            T+R R    L SA      +  W+RE+G  ++R FS R++ASE +V +LD+  KL+ H+G
Sbjct  2    TMRKRTRTSLNSA-----LVNVWRRELGELSSRNFSDRLAASEDLVLRLDILQKLDLHRG  56

Query  276  CVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIV  455
            CVNTI+FN  GDILVSGSDD+++ILWDW T   +LS+ SGH +N+FQAK MP TDDR  V
Sbjct  57   CVNTISFNGAGDILVSGSDDRRIILWDWETGQPRLSFHSGHHNNVFQAKIMPCTDDRSFV  116

Query  456  TASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T +ADGQVR  Q+L +G V TK L KH GRVH LAVEPGSP+IFY+CGEDG V+H DL
Sbjct  117  TCAADGQVRHAQILASGVV-TKLLAKHHGRVHKLAVEPGSPHIFYTCGEDGLVQHIDL  173



>emb|CDX69116.1| BnaC01g03370D [Brassica napus]
Length=480

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  + R+FS R SASE +V +L++Y KL  H+GCVNT++FN+ GDILVSGSD
Sbjct  20   VDFWRREVGGISPRSFSDRFSASENMVLRLEIYRKLAKHKGCVNTVSFNAQGDILVSGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   VLE+G+V
Sbjct  80   DRRVLLWDWELGNVKLSFHSGHSNNVFQAKFMPFSDDRTIVTCAADGMVRRASVLESGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQG  H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETVLLGLHQGPAHKLCIEPGNPHIFYTCGEDGSVQRFDL  178



>ref|XP_009105332.1| PREDICTED: DDB1- and CUL4-associated factor 8-like protein 2 
isoform X2 [Brassica rapa]
Length=480

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             ++FW+RE+G  + R+FS R SASE ++ +L++Y KL  H+GCVNT++FN+ GDILVSGS
Sbjct  19   IVDFWRREVGGISPRSFSDRFSASENMILRLEVYRKLAKHKGCVNTVSFNAHGDILVSGS  78

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   VLE+G+
Sbjct  79   DDRRVLLWDWELGNVKLSFHSGHSNNVFQAKFMPFSDDRTIVTCAADGMVRRASVLESGK  138

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V+T  LG HQG  H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  139  VETVLLGLHQGPAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>ref|XP_009105253.1| PREDICTED: DDB1- and CUL4-associated factor 8-like protein 2 
isoform X1 [Brassica rapa]
Length=481

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             ++FW+RE+G  + R+FS R SASE ++ +L++Y KL  H+GCVNT++FN+ GDILVSGS
Sbjct  19   IVDFWRREVGGISPRSFSDRFSASENMILRLEVYRKLAKHKGCVNTVSFNAHGDILVSGS  78

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   VLE+G+
Sbjct  79   DDRRVLLWDWELGNVKLSFHSGHSNNVFQAKFMPFSDDRTIVTCAADGMVRRASVLESGK  138

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V+T  LG HQG  H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  139  VETVLLGLHQGPAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>ref|XP_010446973.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Camelina sativa]
Length=546

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  71   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAQGDVLISGSD  130

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  131  DWRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  190

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  191  KTSLLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  229



>ref|XP_011458700.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 127/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S D   +  W+R++G  +AR F+ R+  SE +V +LD++GKLN HQGCVNT++
Sbjct  2    MNKRLRTSTDKPVVNVWQRQLGELSARNFAHRLGGSEDLVLRLDIHGKLNKHQGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GD LVSGSDD ++ILW+W T    LS+ SGH +N+FQAKFMP+++DR IVT +ADG
Sbjct  62   FNADGDTLVSGSDDTRLILWNWETGKVNLSFDSGHNNNVFQAKFMPYSNDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ E+G+V++  L  H  R H LA+EPGSP+IFY+CGEDG V H+DL
Sbjct  122  QVRHIQISEHGQVESSLLASHTRRAHKLAIEPGSPHIFYTCGEDGLVLHFDL  173



>gb|KFK30151.1| hypothetical protein AALP_AA7G223600 [Arabis alpina]
Length=601

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R S SE++V +L++Y KL  H+GCVNT++FN  GDIL+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSGSESMVLRLEIYKKLVKHKGCVNTVSFNGGGDILISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE+G+V
Sbjct  80   DRRVVLWDWELGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRASILESGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +T  LG HQGR H L +EPG+P+IFY+CGEDG V+ +DL
Sbjct  140  ETSFLGLHQGRAHKLCIEPGNPHIFYTCGEDGLVQRFDL  178



>ref|XP_010437517.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Camelina sativa]
Length=493

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN  GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNGEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  80   DWRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  140  KTSFLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>ref|XP_010028775.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Eucalyptus grandis]
Length=484

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+   AS D   ++  +RE+G  +  +F+RR++ASE +V +LD+Y KL GH+GCVNT+ F
Sbjct  3    KRPRGASLDQAVVDIRRREVGGLSGLSFARRLAASEGLVLRLDIYNKLKGHRGCVNTVGF  62

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N  GDI++SGSDD+ V LWDW T   KLS+ SGH  N+FQAK MP+TDDR IVT +ADGQ
Sbjct  63   NLDGDIVISGSDDRHVKLWDWQTGKVKLSFDSGHQSNVFQAKIMPYTDDRSIVTCAADGQ  122

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             R  Q+LE G+V T  L KH+GR H LA++PGSP+I Y+CGEDG V+  DL
Sbjct  123  ARHAQILEGGQVQTMLLAKHRGRAHKLAIDPGSPHIVYTCGEDGLVQRLDL  173



>ref|XP_010432321.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Camelina sativa]
Length=586

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +VILWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  80   DWRVILWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  140  KTSFLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>ref|XP_010446972.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Camelina sativa]
Length=567

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  71   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAQGDVLISGSD  130

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  131  DWRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  190

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  191  KTSLLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  229



>ref|XP_010446971.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Camelina sativa]
Length=585

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  71   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAQGDVLISGSD  130

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  131  DWRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  190

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  191  KTSLLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  229



>ref|XP_010437516.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Camelina sativa]
Length=528

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN  GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNGEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D +V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG VR   +LE G+V
Sbjct  80   DWRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMVRRANILEGGKV  139

Query  513  DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             T  LG HQGR H L +EPG+P++FY+CGEDG V+ +DL
Sbjct  140  KTSFLGLHQGRAHKLCIEPGNPHVFYTCGEDGLVQRFDL  178



>gb|EYU37990.1| hypothetical protein MIMGU_mgv1a006081mg [Erythranthe guttata]
Length=458

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M++      D   ++ WKRE+G  + R+F+ R++ASE +V +LD+  KL  H+GCVNT++
Sbjct  3    MRRRGRTGLDSSIVDVWKREVGSLSTRSFAHRLAASEDLVLRLDILQKLEKHRGCVNTVS  62

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GD+LVSGSDD++VI WDW +  +K S+ SGH +N+FQAK MP+TD+R IVT +ADG
Sbjct  63   FNAAGDVLVSGSDDRKVIFWDWESGQAKFSFHSGHHNNVFQAKIMPYTDERSIVTCAADG  122

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ E  EV++K + +HQGRVH LA+EPGSP+I Y+CGEDG V+H DL
Sbjct  123  QVRHTQIAE-CEVESKLVARHQGRVHKLAIEPGSPHIVYTCGEDGLVQHIDL  173



>ref|XP_007142793.1| hypothetical protein PHAVU_007G017300g [Phaseolus vulgaris]
 gb|ESW14787.1| hypothetical protein PHAVU_007G017300g [Phaseolus vulgaris]
Length=499

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGC  278
            +  R +  +Y A  D        RE+G    R F+ R  ASE +V +LD+  KL  H+GC
Sbjct  1    MNKRPITAVYKALPD-----LCHRELGHLPPRNFALRFGASEDLVLRLDVLRKLQKHRGC  55

Query  279  VNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVT  458
            VNT++FN+ GD+LVSGSDD +VILWDW T + K S+ SGH +N+FQAK MP ++DR IVT
Sbjct  56   VNTVSFNTDGDVLVSGSDDWRVILWDWQTGSIKHSFHSGHSNNVFQAKIMPHSEDRSIVT  115

Query  459  ASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +ADGQVR  Q+LENG VDTK L KHQGR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  116  CAADGQVRHAQILENGGVDTKFLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>gb|KEH44402.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=497

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G   AR F  R++ASE +V +LD++ KL+ H+GCVNT+ FN+ GDIL+SGSDD+++I
Sbjct  19   RELGHLPARIFPNRLAASEDLVLRLDVFKKLDKHRGCVNTVCFNADGDILLSGSDDRRII  78

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KLS+ SGH +N+FQAKFM  + DR IVT +ADGQ R  Q+LE+G V+TK L
Sbjct  79   LWDWETGRVKLSFHSGHSNNVFQAKFMSHSYDRSIVTCAADGQARHAQLLEDGHVETKLL  138

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            GKHQGR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  139  GKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_011458701.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=513

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 127/172 (74%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M K    S D   +  W+R++G  +AR F+ R+  SE +V +LD++GKLN HQGCVNT++
Sbjct  2    MNKRLRTSTDKPVVNVWQRQLGELSARNFAHRLGGSEDLVLRLDIHGKLNKHQGCVNTVS  61

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GD LVSGSDD ++ILW+W T    LS+ SGH +N+FQAKFMP+++DR IVT +ADG
Sbjct  62   FNADGDTLVSGSDDTRLILWNWETGKVNLSFDSGHNNNVFQAKFMPYSNDRSIVTCAADG  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+ E+G+V++  L  H  R H LA+EPGSP+IFY+CGEDG V H+DL
Sbjct  122  QVRHIQISEHGQVESSLLASHTRRAHKLAIEPGSPHIFYTCGEDGLVLHFDL  173



>ref|XP_010066303.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Eucalyptus grandis]
 gb|KCW64150.1| hypothetical protein EUGRSUZ_G01796 [Eucalyptus grandis]
Length=490

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +3

Query  162  WKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQ  341
            W REIG  ++R FS R  ASE +V + ++Y KL  H+GCVNTI+FNS+GDILVSGSDD+Q
Sbjct  29   WLREIGGLSSRGFSYRHRASEDLVLRFEIYRKLKSHRGCVNTISFNSSGDILVSGSDDRQ  88

Query  342  VILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTK  521
            VI+WDW     KLS+ SGH +N+F AK MP+TDDR+IVT +ADGQVR  Q+ E+G V T 
Sbjct  89   VIMWDWEIGNVKLSFHSGHHNNVFNAKIMPYTDDRRIVTCAADGQVRYAQLAESGSVKTS  148

Query  522  RLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             L KH GR H LA+EPGSP++FYSCGEDG V+ +DL
Sbjct  149  LLAKHHGRAHRLAIEPGSPHVFYSCGEDGLVQRFDL  184



>ref|XP_010028774.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Eucalyptus grandis]
 gb|KCW55589.1| hypothetical protein EUGRSUZ_I01460 [Eucalyptus grandis]
Length=499

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+   AS D   ++  +RE+G  +  +F+RR++ASE +V +LD+Y KL GH+GCVNT+ F
Sbjct  3    KRPRGASLDQAVVDIRRREVGGLSGLSFARRLAASEGLVLRLDIYNKLKGHRGCVNTVGF  62

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N  GDI++SGSDD+ V LWDW T   KLS+ SGH  N+FQAK MP+TDDR IVT +ADGQ
Sbjct  63   NLDGDIVISGSDDRHVKLWDWQTGKVKLSFDSGHQSNVFQAKIMPYTDDRSIVTCAADGQ  122

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             R  Q+LE G+V T  L KH+GR H LA++PGSP+I Y+CGEDG V+  DL
Sbjct  123  ARHAQILEGGQVQTMLLAKHRGRAHKLAIDPGSPHIVYTCGEDGLVQRLDL  173



>gb|KHN37380.1| DDB1- and CUL4-associated factor 8 [Glycine soja]
Length=511

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+  +A  +    +   RE+G    R F+ R+ ASE +V +L+L   L  H+GCVNT++F
Sbjct  18   KRPLTAVYNKALPDLCNRELGHLPPRNFALRLGASEDLVLRLELLRNLQKHRGCVNTVSF  77

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ GD LVSGSDD  VILWDW T   KLS+ SGH +N+FQAKFMP + DR IVT +ADGQ
Sbjct  78   NADGDTLVSGSDDWGVILWDWETGRIKLSFHSGHSNNVFQAKFMPHSHDRTIVTCAADGQ  137

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LENG V+TK L KHQGR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  138  VRHAQILENGRVETKCLAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  188



>gb|KEH44400.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=501

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G   AR F  R++ASE +V +LD++ KL+ H+GCVNT+ FN+ GDIL+SGSDD+++I
Sbjct  19   RELGHLPARIFPNRLAASEDLVLRLDVFKKLDKHRGCVNTVCFNADGDILLSGSDDRRII  78

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KLS+ SGH +N+FQAKFM  + DR IVT +ADGQ R  Q+LE+G V+TK L
Sbjct  79   LWDWETGRVKLSFHSGHSNNVFQAKFMSHSYDRSIVTCAADGQARHAQLLEDGHVETKLL  138

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            GKHQGR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  139  GKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_001753126.1| predicted protein [Physcomitrella patens]
 gb|EDQ82167.1| predicted protein [Physcomitrella patens]
Length=497

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W+R+IG      FSR+I   E ++ +L  Y +L GH GCVNT++FN +G++LVSGSDD
Sbjct  14   EHWRRQIGDVTPTAFSRKIGGCEDLIHRLINYAELEGHNGCVNTVSFNPSGELLVSGSDD  73

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            +++ +W+W +KT  LSY SGH DN+FQA+ MP++DDR IV+ +ADGQVR G +LENG V 
Sbjct  74   QEIKVWNWGSKTEVLSYESGHEDNVFQARVMPYSDDRIIVSCAADGQVRYGTILENGRVS  133

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK L KH+ R H +A+EPGSP IFYSCGEDG V+H+DL
Sbjct  134  TKNLAKHRNRAHKMAIEPGSPRIFYSCGEDGVVRHFDL  171



>gb|KEH44401.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=529

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G   AR F  R++ASE +V +LD++ KL+ H+GCVNT+ FN+ GDIL+SGSDD+++I
Sbjct  19   RELGHLPARIFPNRLAASEDLVLRLDVFKKLDKHRGCVNTVCFNADGDILLSGSDDRRII  78

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KLS+ SGH +N+FQAKFM  + DR IVT +ADGQ R  Q+LE+G V+TK L
Sbjct  79   LWDWETGRVKLSFHSGHSNNVFQAKFMSHSYDRSIVTCAADGQARHAQLLEDGHVETKLL  138

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            GKHQGR H LA+EPGSP+IFY+CGEDG V+H+DL
Sbjct  139  GKHQGRAHKLAIEPGSPHIFYTCGEDGLVQHFDL  172



>ref|XP_006589731.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X4 
[Glycine max]
Length=496

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+  +A  +    +   RE+G    R F+ R+ ASE +V +L+L   L  H+GCVNT++F
Sbjct  22   KRPLTAVYNKAIPDLCNRELGHLPPRNFALRLGASEDLVLRLELLRNLQKHRGCVNTVSF  81

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ GD LVSGSDD  VILWDW T   KLS+ SGH +N+FQAKFMP + DR IVT +ADGQ
Sbjct  82   NADGDTLVSGSDDWGVILWDWETGRIKLSFHSGHSNNVFQAKFMPHSHDRTIVTCAADGQ  141

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LENG V+TK L KHQGR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  142  VRHAQILENGRVETKCLAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  192



>ref|XP_001761389.1| predicted protein [Physcomitrella patens]
 gb|EDQ73778.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W+R+IG  +   F+RRI   E +V++L  Y +L+GH GCVNT++FN TG++LVSGSDD
Sbjct  14   EHWRRQIGDVSPTAFTRRIGGCEDLVRRLVKYAELDGHSGCVNTVSFNPTGELLVSGSDD  73

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            + +I+W+WA KT  LSY SGH +N+FQA+ MP+ DDR IV+ +ADGQVR   +LENG V 
Sbjct  74   QDIIVWNWANKTQVLSYISGHENNVFQARVMPYCDDRIIVSCAADGQVRSATILENGMVV  133

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK+L KH+GR H +A+EPGS  IFYSCGEDG V+H+DL
Sbjct  134  TKKLAKHRGRAHKMAIEPGSSRIFYSCGEDGVVQHFDL  171



>ref|XP_006589730.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Glycine max]
Length=515

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+  +A  +    +   RE+G    R F+ R+ ASE +V +L+L   L  H+GCVNT++F
Sbjct  22   KRPLTAVYNKAIPDLCNRELGHLPPRNFALRLGASEDLVLRLELLRNLQKHRGCVNTVSF  81

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ GD LVSGSDD  VILWDW T   KLS+ SGH +N+FQAKFMP + DR IVT +ADGQ
Sbjct  82   NADGDTLVSGSDDWGVILWDWETGRIKLSFHSGHSNNVFQAKFMPHSHDRTIVTCAADGQ  141

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LENG V+TK L KHQGR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  142  VRHAQILENGRVETKCLAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  192



>ref|XP_011046629.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 
8 [Populus euphratica]
Length=471

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            MKK  S   D   +  WKRE+G  + R F+ R +ASE +V +L+++ KL  H GCVNT++
Sbjct  1    MKKRSSEDIDQAVVNVWKRELGQLSTRNFAHRFAASEDLVSRLEIHKKLEKHDGCVNTLS  60

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ GDILVSGSDD +V LWDW T   KLS+ SGH +N+FQA FMPF+DDR I+T +A G
Sbjct  61   FNAGGDILVSGSDDLRVFLWDWETGRDKLSFRSGHDNNVFQANFMPFSDDRTIITCAAVG  120

Query  474  QVRLGQVLENGEVDTKRLGKH-QGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +VR  Q+LE GEV T  LGKH + +VH LA+EPGS +IFYSCGEDG V+H+DL
Sbjct  121  EVRQAQILEGGEVKTILLGKHEESQVHKLAIEPGSAHIFYSCGEDGVVQHFDL  173



>ref|XP_006589729.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Glycine max]
Length=530

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+  +A  +    +   RE+G    R F+ R+ ASE +V +L+L   L  H+GCVNT++F
Sbjct  18   KRPLTAVYNKAIPDLCNRELGHLPPRNFALRLGASEDLVLRLELLRNLQKHRGCVNTVSF  77

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ GD LVSGSDD  VILWDW T   KLS+ SGH +N+FQAKFMP + DR IVT +ADGQ
Sbjct  78   NADGDTLVSGSDDWGVILWDWETGRIKLSFHSGHSNNVFQAKFMPHSHDRTIVTCAADGQ  137

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LENG V+TK L KHQGR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  138  VRHAQILENGRVETKCLAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  188



>ref|XP_006589728.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Glycine max]
Length=534

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +3

Query  117  KKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINF  296
            K+  +A  +    +   RE+G    R F+ R+ ASE +V +L+L   L  H+GCVNT++F
Sbjct  22   KRPLTAVYNKAIPDLCNRELGHLPPRNFALRLGASEDLVLRLELLRNLQKHRGCVNTVSF  81

Query  297  NSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            N+ GD LVSGSDD  VILWDW T   KLS+ SGH +N+FQAKFMP + DR IVT +ADGQ
Sbjct  82   NADGDTLVSGSDDWGVILWDWETGRIKLSFHSGHSNNVFQAKFMPHSHDRTIVTCAADGQ  141

Query  477  VRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            VR  Q+LENG V+TK L KHQGR H LAVEPGSP+IFY+CGEDG V+H+DL
Sbjct  142  VRHAQILENGRVETKCLAKHQGRAHKLAVEPGSPHIFYTCGEDGLVQHFDL  192



>dbj|BAJ87505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  KREIG S++R  S +IS SE ++ ++  YGKL GH GCVNT++FN  GD+LVSGS
Sbjct  16   FFEVRKREIGSSSSRASSSQISGSEGLILRMSQYGKLRGHSGCVNTVSFNPAGDLLVSGS  75

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  KT KL+YPSGH  N+F A+ MPFTDD  IVT +ADGQVR+GQ+ + GE
Sbjct  76   DDTDIILWDWLAKTKKLTYPSGHQQNVFHARVMPFTDDSTIVTVAADGQVRVGQMKQGGE  135

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              TK++G+H  R H +A+EPGSP+I YSCGEDG V+H+DL
Sbjct  136  FTTKQIGEHHDRAHKMALEPGSPHILYSCGEDGLVQHFDL  175



>ref|XP_008806157.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Phoenix 
dactylifera]
Length=485

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             ++  +RE+G  A RTF+ R+ ASE ++ +L +  +L+ H+GCVNT++FN+ G+ILVSGS
Sbjct  15   IVDLRQREVGDLAPRTFAHRLGASEGLILRLQILRRLDKHKGCVNTVSFNADGNILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ ++LWDW     +LS+ SGH DN+FQA+FMP+TDD+ IVT +ADG+VR  Q+ E G+
Sbjct  75   DDRMIMLWDWEAGLVRLSFHSGHTDNVFQARFMPYTDDQTIVTCAADGEVRHAQLREGGQ  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T  L +H+GRVH +A+EPGSP+IFYSCGEDG V+H+DL
Sbjct  135  VATMMLAQHEGRVHKMAIEPGSPHIFYSCGEDGLVQHFDL  174



>ref|XP_010935187.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Elaeis 
guineensis]
Length=484

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             L+  +RE+G  A RTF+ R+ ASE ++ +L +  +L+ H+GCVNT++FN+ G+ILVSGS
Sbjct  15   ILDLRQREVGDLAPRTFAHRLGASEDLILRLQILRRLDKHRGCVNTVSFNADGNILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ +ILWDW    ++ S+ SGH DN+FQA+FMP+TDDR IVT +ADG+VR  Q+ E G 
Sbjct  75   DDRMIILWDWEAGLARSSFHSGHTDNVFQARFMPYTDDRTIVTCAADGEVRHSQLGEGGR  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T  L +H+GRVH +A+EPGSP+IFYSCGEDG V+H+DL
Sbjct  135  VATMMLAQHEGRVHKMAIEPGSPHIFYSCGEDGLVQHFDL  174



>ref|XP_010935186.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             L+  +RE+G  A RTF+ R+ ASE ++ +L +  +L+ H+GCVNT++FN+ G+ILVSGS
Sbjct  15   ILDLRQREVGDLAPRTFAHRLGASEDLILRLQILRRLDKHRGCVNTVSFNADGNILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ +ILWDW    ++ S+ SGH DN+FQA+FMP+TDDR IVT +ADG+VR  Q+ E G 
Sbjct  75   DDRMIILWDWEAGLARSSFHSGHTDNVFQARFMPYTDDRTIVTCAADGEVRHSQLGEGGR  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T  L +H+GRVH +A+EPGSP+IFYSCGEDG V+H+DL
Sbjct  135  VATMMLAQHEGRVHKMAIEPGSPHIFYSCGEDGLVQHFDL  174



>ref|XP_008806156.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Phoenix 
dactylifera]
Length=524

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             ++  +RE+G  A RTF+ R+ ASE ++ +L +  +L+ H+GCVNT++FN+ G+ILVSGS
Sbjct  15   IVDLRQREVGDLAPRTFAHRLGASEGLILRLQILRRLDKHKGCVNTVSFNADGNILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ ++LWDW     +LS+ SGH DN+FQA+FMP+TDD+ IVT +ADG+VR  Q+ E G+
Sbjct  75   DDRMIMLWDWEAGLVRLSFHSGHTDNVFQARFMPYTDDQTIVTCAADGEVRHAQLREGGQ  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T  L +H+GRVH +A+EPGSP+IFYSCGEDG V+H+DL
Sbjct  135  VATMMLAQHEGRVHKMAIEPGSPHIFYSCGEDGLVQHFDL  174



>ref|XP_009392875.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             L   +RE+GF + RTF+ R  ASE +V +L +  KLN H+GCVNT++ N+ G+ILVSGS
Sbjct  15   ILNLCQREVGFLSPRTFAHRAGASEDLVLRLGIDRKLNKHEGCVNTVSLNADGNILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ VILWDWA  T ++S+ SGH +N+FQA+FMP++ DR IVT++ADG+VRL Q+ E G+
Sbjct  75   DDRTVILWDWAVGTVRISFNSGHKNNVFQARFMPYSSDRTIVTSAADGEVRLAQLREGGQ  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V  K L +H G VH +A+EPGSP++F+SCGEDG V+H+DL
Sbjct  135  VAVKLLAEHDGAVHKVAIEPGSPHVFFSCGEDGLVRHFDL  174



>ref|XP_008791951.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Phoenix dactylifera]
Length=495

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
             ++ W RE+G  + R+F+RRI+A+E +V +  ++ KL  H GCVNT++FN+ GDILVSGS
Sbjct  15   IVQLWDREVGDVSPRSFARRIAAAEDLVLRFGIHKKLEKHGGCVNTVSFNADGDILVSGS  74

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD+ VILW+W     KLS+ SGH +N+FQAKFMP+ +DR IVT +ADG+VR  ++ E G+
Sbjct  75   DDRMVILWNWDAGLVKLSFHSGHSNNVFQAKFMPYMEDRIIVTCAADGEVRHAEIREGGK  134

Query  510  VDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            V T  L +H+GR H LA+EPGSPYIFY+CGEDG V+H+DL
Sbjct  135  VLTSLLAQHEGRAHKLAIEPGSPYIFYTCGEDGLVQHFDL  174



>ref|XP_002964638.1| hypothetical protein SELMODRAFT_81531 [Selaginella moellendorffii]
 gb|EFJ34971.1| hypothetical protein SELMODRAFT_81531 [Selaginella moellendorffii]
Length=391

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            + W+R+IG    R FS  I   + ++++L+ Y +L+GH GCVNT++FN +GDILVSGSDD
Sbjct  9    KLWERQIGNIHPRAFSLNIGGCKDLIQRLERYAELSGHDGCVNTVHFNPSGDILVSGSDD  68

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            K+++ WDWA ++ KLS+ SGH +N+FQA+ MPF++DR +VT +ADGQVR   + ENG V 
Sbjct  69   KEIVFWDWAARSKKLSFNSGHDNNVFQARIMPFSNDRSVVTCAADGQVRHAVIPENGCVS  128

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK+L +H+GR H LA+EPGSP  F+SCGEDG V+ +DL
Sbjct  129  TKKLAQHRGRAHKLAIEPGSPRTFFSCGEDGDVRQFDL  166



>ref|XP_010555202.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Tarenaya 
hassleriana]
Length=468

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = +3

Query  132  ASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGD  311
            A  +   ++  KRE+G    R+FS+R SASE +++   L+ KL  H+G V T++FN+ GD
Sbjct  9    ARTEHSVVDVSKRELGLLPNRSFSQRFSASEDLLRHFGLHRKLQMHRGSVRTVSFNADGD  68

Query  312  ILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQ  491
            ILVSGSDD+QVILW+W T + KLS+ SGH +N+FQAKFMPF+DD  IVT +ADGQVR  +
Sbjct  69   ILVSGSDDRQVILWNWETGSVKLSFSSGHTNNVFQAKFMPFSDDHSIVTCAADGQVRHAK  128

Query  492  VLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +LE+G V+T  LG HQG+ H LA+EPGSP+ FYSCG DG VKH+DL
Sbjct  129  ILESG-VETSLLGGHQGQAHKLAIEPGSPFSFYSCGSDGVVKHFDL  173



>ref|NP_001150616.1| plasmacytoma 326 homolog [Zea mays]
 gb|ACG39765.1| nucleotide binding protein [Zea mays]
 gb|AFW88235.1| nucleotide binding protein [Zea mays]
Length=504

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R F+RR + SE +V +L ++ KL+ H GCVNT+ FN  GD L+SGSDD++V+
Sbjct  26   REVGDLLPRRFARRAAGSEDLVMRLQIHRKLDRHTGCVNTVGFNEVGDTLISGSDDQKVM  85

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T T KL + SGH  N+FQA+FMP +DDR IVT +ADG+VRL ++ + G+V T  L
Sbjct  86   LWDWDTGTVKLEFHSGHGGNVFQARFMPCSDDRTIVTCAADGEVRLAKIQDAGDVSTTLL  145

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+H+GR H+LA+EPGSPYIFYSCGE+GFV+H+DL
Sbjct  146  GEHEGRAHNLAIEPGSPYIFYSCGEEGFVQHFDL  179



>ref|XP_008658679.1| PREDICTED: plasmacytoma 326 homolog isoform X1 [Zea mays]
 gb|AFW88236.1| hypothetical protein ZEAMMB73_832102 [Zea mays]
Length=502

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R F+RR + SE +V +L ++ KL+ H GCVNT+ FN  GD L+SGSDD++V+
Sbjct  26   REVGDLLPRRFARRAAGSEDLVMRLQIHRKLDRHTGCVNTVGFNEVGDTLISGSDDQKVM  85

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T T KL + SGH  N+FQA+FMP +DDR IVT +ADG+VRL ++ + G+V T  L
Sbjct  86   LWDWDTGTVKLEFHSGHGGNVFQARFMPCSDDRTIVTCAADGEVRLAKIQDAGDVSTTLL  145

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+H+GR H+LA+EPGSPYIFYSCGE+GFV+H+DL
Sbjct  146  GEHEGRAHNLAIEPGSPYIFYSCGEEGFVQHFDL  179



>dbj|BAK06946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E   RE+G      F+RR +ASE +V +L ++ KLN H GCVNT+ FN+ GD LVSGSDD
Sbjct  16   ELCFREVGDLLPHRFARRAAASEELVMRLQIHRKLNKHTGCVNTVGFNAAGDTLVSGSDD  75

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            ++VILWDW T   K+ + SGH DN+FQA+FMP+T+DR IVT +ADG+VR+ ++ +  +V 
Sbjct  76   QKVILWDWDTGAVKMQFHSGHADNVFQARFMPYTNDRTIVTCAADGEVRVAKIQDGRDVL  135

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T  LG+H GR H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  136  TSLLGEHDGRAHKLAIEPGSPYIFYSCGEDGHVQHFDL  173



>ref|XP_010918155.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Elaeis guineensis]
Length=495

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +3

Query  147  KFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            + +E   RE+G  + R+F+ RI+ASE +V +L ++ KL  H+GCVNT++FN+ GDILVSG
Sbjct  14   RIVELCNREVGDVSPRSFAHRIAASEDLVLRLGIHKKLEKHRGCVNTVSFNADGDILVSG  73

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDD+ VILW+W     KL + SGH +N+FQAKFMP+ +DR IVT +ADG+VR  ++ E G
Sbjct  74   SDDRMVILWNWDAGLVKLCFHSGHSNNVFQAKFMPYMEDRIIVTCAADGEVRHAEIREGG  133

Query  507  EVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +V T  L +H+GR H LA+EPGSPYIFY+CGEDG V+H+DL
Sbjct  134  KVLTSLLAQHEGRAHKLAIEPGSPYIFYTCGEDGLVQHFDL  174



>ref|XP_009413038.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=491

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W RE+G    R F+ R  ASE +V +  ++ KL+ H+GCVNT++FN+ GD LVSGSDD
Sbjct  19   ELWHRELGDFPPRAFAHRFVASEDLVLRFGVHRKLDNHRGCVNTVSFNADGDTLVSGSDD  78

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            ++VILWDW     KLS+ SGH +N+FQA+FMP+TDDR I+T +ADG+VR  Q+LE G+VD
Sbjct  79   RKVILWDWDAGRVKLSFDSGHSNNVFQARFMPYTDDRIIITCAADGEVRHAQILEGGKVD  138

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            T  L +H GR H L +EPGS YI YSCGEDG V+H DL
Sbjct  139  TTLLAQHDGRAHKLGIEPGSSYIIYSCGEDGLVQHIDL  176



>ref|XP_004983782.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Setaria italica]
Length=614

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R+F+RR + SE +V +L L+ KL  H GCVNT+ FN  GD L+SGSDD+ V+
Sbjct  27   REVGDLLPRSFARRAAGSEDLVMRLQLHRKLERHTGCVNTVGFNDAGDTLISGSDDQMVM  86

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDWAT  +KL + SGH  N+FQA+FMP TDDR IVT  ADG+VRL ++ + G+V T  L
Sbjct  87   LWDWATGANKLEFHSGHGGNVFQARFMPGTDDRTIVTCGADGEVRLAKIQDGGDVSTTLL  146

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G+H+GR H++AVEPGSPYIFYSCGEDG V+H+DL
Sbjct  147  GEHEGRAHNVAVEPGSPYIFYSCGEDGLVQHFDL  180



>ref|XP_010086844.1| DDB1- and CUL4-associated factor 8 [Morus notabilis]
 gb|EXB24042.1| DDB1- and CUL4-associated factor 8 [Morus notabilis]
Length=541

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M++  S + D+  ++   RE+G   AR F+ R+ ASE +V +L+LY +L  H+GCVNT++
Sbjct  1    MRRARSGA-DNTVVDVSLRELGSLPARNFALRLGASEDLVLRLELYRRLEHHRGCVNTVS  59

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            FN+ G ILVSGSDD +VILWDW     KL++ SGHL N+FQAKF+P++DDR+IVT +ADG
Sbjct  60   FNADGRILVSGSDDMRVILWDWDIGQVKLAFDSGHLQNVFQAKFIPYSDDRRIVTCAADG  119

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G V+T  LG+H G+ H LA+ PGSP+IFYSCGEDG V+ +DL
Sbjct  120  QVRFVQILEGGRVETSLLGEHLGQAHKLAIVPGSPHIFYSCGEDGLVQLFDL  171



>ref|XP_011462160.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Fragaria 
vesca subsp. vesca]
Length=440

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            ++ F +   RE G    R ++R+ SA++ +V QLDLY +L GH   V+++ FNS+GD+LV
Sbjct  58   NNGFFDICNRETGLRRPRRYARQFSANQGIVMQLDLYAELKGHNDHVSSMEFNSSGDLLV  117

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SG+ D QVI W+W TKT +LSY  G+L N+ QAK MP T+DR+IVTA  DGQVRLG+VLE
Sbjct  118  SGAYDNQVIFWNWETKTRRLSYDPGNLKNVQQAKIMPLTNDRRIVTACGDGQVRLGEVLE  177

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G+V TKRL  H+G VH LAVEPG+P I YSCG+  FV+H+DL
Sbjct  178  DGQVHTKRLVSHRGAVHKLAVEPGNPNIIYSCGDYSFVQHFDL  220



>ref|XP_006283704.1| hypothetical protein CARUB_v10004776mg [Capsella rubella]
 gb|EOA16602.1| hypothetical protein CARUB_v10004776mg [Capsella rubella]
Length=431

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  204  RRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLS  383
            RR   S  ++++L L+ KL  H+GCVNT++FN+ GDIL+SGSDDKQVILWDW + + KLS
Sbjct  10   RRTEHSVDLLRRLGLHKKLFKHKGCVNTVSFNADGDILLSGSDDKQVILWDWQSASVKLS  69

Query  384  YPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAV  563
            + SGH DNIFQAKFMPF+DD  IVT++AD QVR  ++LE+G+V+T  LG+HQG VH LAV
Sbjct  70   FNSGHSDNIFQAKFMPFSDDLSIVTSAADKQVRYSKILESGQVETSLLGEHQGPVHKLAV  129

Query  564  EPGSPYIFYSCGEDGFVKHYDL  629
            EPGSP+ FY+CGEDG VKH+DL
Sbjct  130  EPGSPFSFYTCGEDGVVKHFDL  151



>ref|XP_009413037.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=520

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W RE+G    R F+ R  ASE +V +  ++ KL+ H+GCVNT++FN+ GD LVSGSDD
Sbjct  19   ELWHRELGDFPPRAFAHRFVASEDLVLRFGVHRKLDNHRGCVNTVSFNADGDTLVSGSDD  78

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            ++VILWDW     KLS+ SGH +N+FQA+FMP+TDDR I+T +ADG+VR  Q+LE G+VD
Sbjct  79   RKVILWDWDAGRVKLSFDSGHSNNVFQARFMPYTDDRIIITCAADGEVRHAQILEGGKVD  138

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKH  620
            T  L +H GR H L +EPGS YI YSCGEDG V+H
Sbjct  139  TTLLAQHDGRAHKLGIEPGSSYIIYSCGEDGLVQH  173



>gb|KHG19898.1| DDB1- and CUL4-associated factor 8 [Gossypium arboreum]
 gb|KHG21648.1| DDB1- and CUL4-associated factor 8 [Gossypium arboreum]
Length=472

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 137/225 (61%), Gaps = 53/225 (24%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASE------------------  224
            ++N++ +     S D   ++ W+RE+G  + R F+ R++ASE                  
Sbjct  1    MKNKRAR----TSVDKAVVDVWQREVGELSTRNFAHRLAASEFCGDKVGFARGEVCEVLL  56

Query  225  ------------------------------AVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
                                           +V +L++Y KL  H+GCVNT++FN+ G+I
Sbjct  57   AGAVECLVVFSGRHFIDFSLSEFERPQWANDLVLRLEIYKKLEKHRGCVNTVSFNADGNI  116

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDDK+VILWDW T  +KL++ SGH++N+FQAK MP++DDR +VT +ADGQVR  Q+
Sbjct  117  LVSGSDDKRVILWDWETGNAKLTFQSGHVNNVFQAKIMPYSDDRSLVTCAADGQVRHAQI  176

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LE G  +TK L KHQGR H LA+EPGSPYIFY+CGEDG V+H DL
Sbjct  177  LERG-AETKLLAKHQGRAHKLAIEPGSPYIFYTCGEDGLVQHIDL  220



>gb|AAO16992.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=600

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  186  AARTFSRRISAS--EAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDW  359
            A+    RR ++   E +V ++  YGKL GH GCVNT++FN  G++LVSGSDD  +ILWDW
Sbjct  4    ASEAACRRAASCFFEGLVMRMHQYGKLRGHDGCVNTVSFNPAGNLLVSGSDDMDIILWDW  63

Query  360  ATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQ  539
              KT +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+GQ+ E GEV TK++G H 
Sbjct  64   LAKTQRLIYPSGHQENVFHARVMPFTDDSAIVTVAADGQVRVGQLNEGGEVTTKQIGVHD  123

Query  540  GRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             R H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  124  DRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  153



>ref|XP_002970512.1| hypothetical protein SELMODRAFT_147078 [Selaginella moellendorffii]
 gb|EFJ28642.1| hypothetical protein SELMODRAFT_147078 [Selaginella moellendorffii]
Length=481

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  147  KFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            +  E +KREIG      ++ RI   E +V++L  + +L+GH+GCVNT++FN +GD LVSG
Sbjct  22   RHFELYKREIGSLRPSLYAHRIGGCEDMVQRLKEFRRLSGHRGCVNTVHFNPSGDRLVSG  81

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDDKQ+I WDW     KL Y SGH  N+FQA+ MPF+DDR +V+ +ADGQVR   + E+G
Sbjct  82   SDDKQIIFWDWMAGRKKLIYHSGHEQNVFQARIMPFSDDRSVVSCAADGQVRHALISEDG  141

Query  507  EVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             V+TK+L KH+G  H LAVEPGSP  F+SCGEDG V H+DL
Sbjct  142  RVETKKLAKHRGPAHKLAVEPGSPRTFFSCGEDGIVLHFDL  182



>ref|XP_002978595.1| hypothetical protein SELMODRAFT_152654 [Selaginella moellendorffii]
 gb|EFJ20581.1| hypothetical protein SELMODRAFT_152654 [Selaginella moellendorffii]
Length=481

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  147  KFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            +  E +KREIG      ++ RI   E +V++L  + +L+GH+GCVNT++FN +GD LVSG
Sbjct  22   RHFELYKREIGSLRPSLYAHRIGGCEDMVQRLKEFRRLSGHRGCVNTVHFNPSGDRLVSG  81

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDDKQ+I WDW     KL Y SGH  N+FQA+ MPF+DDR +V+ +ADGQVR   + E+G
Sbjct  82   SDDKQIIFWDWMAGRKKLIYHSGHEQNVFQARIMPFSDDRSVVSCAADGQVRHALISEDG  141

Query  507  EVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             V+TK+L KH+G  H LAVEPGSP  F+SCGEDG V H+DL
Sbjct  142  RVETKKLAKHRGPAHKLAVEPGSPRTFFSCGEDGIVLHFDL  182



>ref|XP_011470718.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Fragaria vesca 
subsp. vesca]
Length=408

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  DDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILV  320
            ++ F +   RE G    R F+R+ S ++ +VKQL++Y +L GH   V+++ FNS+GD+LV
Sbjct  4    NNGFYDICNRETGLRRPRRFARQFSTNQGIVKQLNMYAELKGHNDRVSSMEFNSSGDLLV  63

Query  321  SGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE  500
            SGS DKQVI W+W  K+ +LSY  GH + ++Q K MPFT+DR+I+TA   GQVRLG+V +
Sbjct  64   SGSYDKQVIFWNWEAKSRRLSYDPGHPEEVYQTKIMPFTNDRRILTACRGGQVRLGEVSK  123

Query  501  NGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G+V TKRLG H+G VH LA+EPG+P I YSCG+D F++H+DL
Sbjct  124  DGQVHTKRLGSHRGAVHKLAIEPGNPNILYSCGDDSFIQHFDL  166



>ref|XP_010444874.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 
8-like, partial [Camelina sativa]
Length=436

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            ++++L L  KL  H+GCVNT++FN+ GDIL+SGSDDKQVILWDW T + KLS+ SGH +N
Sbjct  11   LLRRLGLDKKLVEHEGCVNTVSFNADGDILLSGSDDKQVILWDWQTASVKLSFDSGHYNN  70

Query  408  IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
            +FQA+FMPF+DDR IVT++AD QVR  Q+LE+G+V+T  LGKHQG VH LAVEPGSP+ F
Sbjct  71   VFQAQFMPFSDDRSIVTSAADKQVRHSQILESGQVETCLLGKHQGPVHKLAVEPGSPFSF  130

Query  588  YSCGEDGFVKHYDL  629
            Y+CGEDG VKH+DL
Sbjct  131  YTCGEDGVVKHFDL  144



>emb|CAN70290.1| hypothetical protein VITISV_019345 [Vitis vinifera]
Length=1464

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +3

Query  228   VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
             +V Q D+Y KL  H+GCVNT++FN+ GDILVSGSDD+++ILWDW +   KLS+ SGH++N
Sbjct  899   LVLQFDIYRKLEKHRGCVNTVSFNADGDILVSGSDDRRIILWDWESGHVKLSFESGHINN  958

Query  408   IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
             +FQAKFMP+TDDR IVT +ADGQVR  Q+LE G V+T  L KHQGR H LA+EPGSPYIF
Sbjct  959   VFQAKFMPYTDDRSIVTCAADGQVRRAQILEXGRVETTLLAKHQGRAHKLAIEPGSPYIF  1018

Query  588   YSCGEDGFVKHYDL  629
             Y+CGEDG V+H DL
Sbjct  1019  YTCGEDGLVQHIDL  1032



>emb|CAB37504.1| putative protein [Arabidopsis thaliana]
 emb|CAB80512.1| putative protein [Arabidopsis thaliana]
Length=426

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  210  ISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYP  389
            I   + ++++L L  KL+ H+GCVNT++FN+ GDIL+SGSDD+QVILWDW T + KLS+ 
Sbjct  2    ILQKQDLLRRLGLDKKLDKHKGCVNTVSFNADGDILLSGSDDRQVILWDWQTASVKLSFD  61

Query  390  SGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEP  569
            SGH +NIFQAKFMPF+DDR IVT++AD QVR  ++LE+G+V+T  LGKHQG VH LAVEP
Sbjct  62   SGHFNNIFQAKFMPFSDDRTIVTSAADKQVRYSKILESGQVETSLLGKHQGPVHKLAVEP  121

Query  570  GSPYIFYSCGEDGFVKH  620
            GSP+ FY+CGEDG VKH
Sbjct  122  GSPFSFYTCGEDGAVKH  138



>gb|KJB47715.1| hypothetical protein B456_008G037700 [Gossypium raimondii]
Length=478

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            +V +LD+Y KL  H+GCVNT++FN+ G+ILVSGSDD++VILWDW T   KL + SGH++N
Sbjct  5    LVLRLDIYKKLEKHRGCVNTVSFNADGNILVSGSDDRRVILWDWETGNGKLVFQSGHVNN  64

Query  408  IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
            +FQAKFMP+TDDR +VT +ADGQVR  Q+LE G V+T+ L KHQG+VH LA+EPGSP+IF
Sbjct  65   VFQAKFMPYTDDRCLVTCAADGQVRHAQILERG-VETRLLAKHQGQVHKLAIEPGSPHIF  123

Query  588  YSCGEDGFVKHYDL  629
            Y+CGEDG V+H DL
Sbjct  124  YTCGEDGLVQHIDL  137



>ref|NP_001065201.1| Os10g0544500 [Oryza sativa Japonica Group]
 gb|AAP54874.2| transducin family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27115.1| Os10g0544500 [Oryza sativa Japonica Group]
 dbj|BAG93723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=499

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R F+RR +ASE +V +L ++ KLN H GCVNT+ FN+ GD L+SGSDD+ V+
Sbjct  21   REVGLLLPRRFARRAAASEDLVMRLQVHRKLNRHTGCVNTVGFNADGDTLISGSDDQMVM  80

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KL +PSGH +N+FQA+FMP+T+D+ IVT +ADG+VRL ++ + G+V T  L
Sbjct  81   LWDWDTGAIKLQFPSGHSNNVFQARFMPYTNDQTIVTCAADGEVRLAKIGDGGDVPTTLL  140

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G H GR H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  141  GDHDGRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  174



>gb|KHN11511.1| DDB1- and CUL4-associated factor 8 [Glycine soja]
Length=430

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            +K     +   RE+G  + R F+ R+ +SE +V +L L   L  H+GCVN ++FN+ GDI
Sbjct  2    NKRKALPDLCNREVGHLSPRNFALRLGSSEDLVLRLQLLRNLQKHRGCVNAVSFNADGDI  61

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD  +ILWDW T   +LS+ SGH +N+FQAK MP +DDR IVT +ADGQVR  Q+
Sbjct  62   LVSGSDDCGIILWDWETGRIRLSFHSGHSNNVFQAKIMPHSDDRTIVTCAADGQVRHAQL  121

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LENG V+TK L KHQGR H LA+EPGSP+IFY+CGEDG V+ +DL
Sbjct  122  LENGRVETKCLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQRFDL  166



>gb|AAM34535.1|AC113947_1 putative WD-40 repeat protein [Oryza sativa Japonica Group]
Length=612

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R F+RR +ASE +V +L ++ KLN H GCVNT+ FN+ GD L+SGSDD+ V+
Sbjct  21   REVGLLLPRRFARRAAASEDLVMRLQVHRKLNRHTGCVNTVGFNADGDTLISGSDDQMVM  80

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KL +PSGH +N+FQA+FMP+T+D+ IVT +ADG+VRL ++ + G+V T  L
Sbjct  81   LWDWDTGAIKLQFPSGHSNNVFQARFMPYTNDQTIVTCAADGEVRLAKIGDGGDVPTTLL  140

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G H GR H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  141  GDHDGRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  174



>gb|EAY79398.1| hypothetical protein OsI_34526 [Oryza sativa Indica Group]
Length=613

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            RE+G    R F+RR +ASE +V +L ++ KLN H GCVNT+ FN+ GD L+SGSDD+ V+
Sbjct  21   REVGLLLPRRFARRAAASEDLVMRLQVHRKLNRHTGCVNTVGFNADGDTLISGSDDQMVM  80

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRL  527
            LWDW T   KL +PSGH +N+FQA+FMP+T+D+ IVT +ADG+VRL ++ + G+V T  L
Sbjct  81   LWDWDTGAIKLQFPSGHSNNVFQARFMPYTNDQTIVTCAADGEVRLAKIGDGGDVPTTLL  140

Query  528  GKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            G H GR H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  141  GDHDGRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  174



>ref|XP_003555853.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform 1 
[Glycine max]
Length=489

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            +K     +   RE+G  + R F+ R+ +SE +V +L L   L  H+GCVN ++FN+ GDI
Sbjct  2    NKRKALPDLCNREVGHLSPRNFALRLGSSEDLVLRLQLLRNLQKHRGCVNAVSFNADGDI  61

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD  +ILWDW T   +LS+ SGH +N+FQAK MP +DDR IVT +ADGQVR  Q+
Sbjct  62   LVSGSDDCGIILWDWETGRIRLSFHSGHSNNVFQAKIMPHSDDRTIVTCAADGQVRHAQL  121

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LENG V+TK L KHQGR H LA+EPGSP+IFY+CGEDG V+ +DL
Sbjct  122  LENGRVETKCLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQRFDL  166



>gb|ACU19502.1| unknown [Glycine max]
Length=489

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            +K     +   RE+G  + R F+ R+ +SE +V +L L   L  H+GCVN ++FN+ GDI
Sbjct  2    NKRKALPDLCNREVGHLSPRNFALRLDSSEDLVLRLQLLRNLQKHRGCVNAVSFNADGDI  61

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            LVSGSDD  +ILWDW T   +LS+ SGH +N+FQAK MP +DDR IVT +ADGQVR  Q+
Sbjct  62   LVSGSDDCGIILWDWETGRIRLSFHSGHSNNVFQAKIMPHSDDRTIVTCAADGQVRHAQL  121

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            LENG V+TK L KHQGR H LA+EPGSP+IFY+CGEDG V+ +DL
Sbjct  122  LENGRVETKCLAKHQGRAHKLAIEPGSPHIFYTCGEDGLVQRFDL  166



>ref|XP_003574277.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 
8-like [Brachypodium distachyon]
Length=502

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = +3

Query  168  REIG--FSAARTFSRRISAS-EAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
            RE+G    A R   R  SA  + ++ +L ++ KLN H GCVNT+ FN+ GD L+SGSDD+
Sbjct  29   REVGGLLPALRPPRRASSAVVQDLIMRLQIHKKLNRHTGCVNTVGFNADGDTLISGSDDQ  88

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
             V+LWDW T   KL + SGH DN+FQA+FMP+TDDR IVT +ADG+VR+ ++ + G+V T
Sbjct  89   LVMLWDWDTGAVKLQFHSGHADNVFQARFMPYTDDRTIVTCAADGEVRIAKIQDGGDVPT  148

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              LG+H GR H LA+EPGSPYIFYSCGEDG V+H+DL
Sbjct  149  SLLGEHDGRAHKLAIEPGSPYIFYSCGEDGLVQHFDL  185



>ref|XP_002989505.1| hypothetical protein SELMODRAFT_43681, partial [Selaginella moellendorffii]
 gb|EFJ09381.1| hypothetical protein SELMODRAFT_43681, partial [Selaginella moellendorffii]
Length=373

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +3

Query  189  ARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATK  368
            AR  S  +   + ++++L+ Y +L+GH GCVNT++FN +GDILVSGSDDK+++ WDWA +
Sbjct  1    ARNQSSLLPPLQDLIQRLERYAELSGHDGCVNTVHFNPSGDILVSGSDDKEIVFWDWAAR  60

Query  369  TSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRV  548
            + KLS+ SGH +N+FQA+ MPF++DR +VT +ADGQVR   + ENG V TK+L +H+GR 
Sbjct  61   SKKLSFNSGHDNNVFQARIMPFSNDRSVVTCAADGQVRHAVISENGCVSTKKLAQHRGRA  120

Query  549  HSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            H LA+EPGSP  F+SCGEDG V  +DL
Sbjct  121  HKLAIEPGSPRTFFSCGEDGDVHQFDL  147



>ref|XP_009782403.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X3 
[Nicotiana sylvestris]
Length=408

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K    S D   +  WKRE+G  + + F+  ++ASE +V +LD++ +L  H+G VNT++
Sbjct  3    MRKRARTSLDSAIVNVWKREVGEISTKNFADSLTASEDLVLRLDVFRRLKEHRGWVNTVS  62

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            F++ GDILVS S+D++V LWDW T  + LS+ SGH D +FQAK MP TD+R IVT +ADG
Sbjct  63   FSADGDILVSSSNDRKVTLWDWETGKTVLSFHSGHDDYVFQAKTMPHTDNRSIVTCAADG  122

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G V T  L KHQG    LA+EPGSP IFY+CG DG V+H DL
Sbjct  123  QVRRAQILERGYVTTNLLAKHQGLAPKLAIEPGSPNIFYTCGYDGLVQHIDL  174



>gb|EMS48851.1| DDB1- and CUL4-associated factor 8 [Triticum urartu]
Length=403

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  249  YGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFM  428
            YGKL GH GCVNTI+FN  GD+LVSGSDD  +ILWDW  KT KL+YPSGH  N+F A+ M
Sbjct  4    YGKLRGHSGCVNTISFNPAGDLLVSGSDDTDIILWDWLAKTEKLTYPSGHQQNLFHARVM  63

Query  429  PFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDG  608
            PFTDD  IVT  ADGQVR+GQ+ + GE  TK++G+H  R + +A+EPGSP+I YSCGEDG
Sbjct  64   PFTDDSTIVTVGADGQVRVGQLKQGGEFITKQIGEHHDRAYKMALEPGSPHILYSCGEDG  123

Query  609  FVKHYDL  629
             V+H+DL
Sbjct  124  LVQHFDL  130



>gb|EEC75010.1| hypothetical protein OsI_11081 [Oryza sativa Indica Group]
Length=317

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +3

Query  150  FLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGS  329
            F E  ++EIG S  R  SRRIS SE +V ++  YGKL GH GCVNT++FN  G++LVSGS
Sbjct  16   FFEVGRQEIGSSTPRASSRRISGSEGLVMRMHQYGKLRGHDGCVNTVSFNPAGNLLVSGS  75

Query  330  DDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGE  509
            DD  +ILWDW  KT +L YPSGH +N+F A+ MPFTDD  IVT +ADGQVR+GQ+ E GE
Sbjct  76   DDMDIILWDWLAKTQRLIYPSGHQENVFHARVMPFTDDSAIVTVAADGQVRVGQLNEGGE  135

Query  510  VDTKRLGKHQGRVHSLAVEPGS  575
            V TK++G H  R H LA+EPG+
Sbjct  136  VTTKQIGVHDDRAHKLAIEPGT  157



>ref|XP_009782401.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X1 
[Nicotiana sylvestris]
Length=447

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K    S D   +  WKRE+G  + + F+  ++ASE +V +LD++ +L  H+G VNT++
Sbjct  3    MRKRARTSLDSAIVNVWKREVGEISTKNFADSLTASEDLVLRLDVFRRLKEHRGWVNTVS  62

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            F++ GDILVS S+D++V LWDW T  + LS+ SGH D +FQAK MP TD+R IVT +ADG
Sbjct  63   FSADGDILVSSSNDRKVTLWDWETGKTVLSFHSGHDDYVFQAKTMPHTDNRSIVTCAADG  122

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            QVR  Q+LE G V T  L KHQG    LA+EPGSP IFY+CG DG V+H DL
Sbjct  123  QVRRAQILERGYVTTNLLAKHQGLAPKLAIEPGSPNIFYTCGYDGLVQHIDL  174



>gb|EMT05361.1| hypothetical protein F775_27454 [Aegilops tauschii]
Length=520

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +3

Query  144  DKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVS  323
            D  L +   E G S AR     +   + +V +L ++ KLN H GCVNT+ FN+ GD L+S
Sbjct  39   DCGLHWQHLEYGGSCARFV---VPGRQELVMRLQIHRKLNKHTGCVNTVGFNAAGDTLIS  95

Query  324  GSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLEN  503
            GSDD++V+LWDW T   K+ + SGH DN+FQA+FMP+T+DR IVT SADG+VR+ ++ + 
Sbjct  96   GSDDQRVMLWDWDTGAVKMQFHSGHGDNVFQARFMPYTNDRTIVTCSADGEVRVAKIQDG  155

Query  504  GEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +V T  LG+H GR H LA+EPGSPYIFYSCGEDG V+H  +
Sbjct  156  RDVLTSLLGEHDGRAHKLAIEPGSPYIFYSCGEDGHVQHLTI  197



>gb|EMS58245.1| DDB1- and CUL4-associated factor 8 [Triticum urartu]
Length=506

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            +V +L ++ KLN H GCVNT+ FN+ GD L+SGSDD++V+LWDW T   K+ + SGH DN
Sbjct  58   LVMRLQIHRKLNKHTGCVNTVGFNAAGDTLISGSDDQRVMLWDWDTGAVKMQFHSGHGDN  117

Query  408  IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
            +FQA+FMP+T+DR IVT +ADG+VR+ ++ +  +V T  LG H GR H LA+EPGSPYIF
Sbjct  118  VFQARFMPYTNDRTIVTCAADGEVRVAKIQDGRDVLTSLLGDHDGRAHKLALEPGSPYIF  177

Query  588  YSCGEDGFVKHYDL  629
            YSCGEDG V+H+DL
Sbjct  178  YSCGEDGHVQHFDL  191



>ref|XP_001764012.1| predicted protein [Physcomitrella patens]
 gb|EDQ71151.1| predicted protein, partial [Physcomitrella patens]
Length=401

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 113/158 (72%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  EFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDD  335
            E W+ +IG  +   F+R+I   E +V++  +YG+L+GH GCV++++F+ TG++LVSGS D
Sbjct  1    EHWRLQIGDVSPAAFARQIGGCEELVRRFTMYGELSGHGGCVSSVSFDPTGELLVSGSFD  60

Query  336  KQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD  515
            + +I+W+WA +    +Y SGH  N+FQA  MP  D+R IVT +ADGQVR G +L++G   
Sbjct  61   QVIIVWNWAERRPVFTYNSGHEKNVFQALVMPHCDNRIIVTCAADGQVRYGAILQDGSAK  120

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK LG+H+G  H +A+EPGS  I YSCGEDG V+H DL
Sbjct  121  TKCLGQHRGHSHKMAIEPGSSRIIYSCGEDGVVQHIDL  158



>ref|XP_008791952.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Phoenix dactylifera]
Length=460

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  228  VVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDN  407
            +V +  ++ KL  H GCVNT++FN+ GDILVSGSDD+ VILW+W     KLS+ SGH +N
Sbjct  6    LVLRFGIHKKLEKHGGCVNTVSFNADGDILVSGSDDRMVILWNWDAGLVKLSFHSGHSNN  65

Query  408  IFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIF  587
            +FQAKFMP+ +DR IVT +ADG+VR  ++ E G+V T  L +H+GR H LA+EPGSPYIF
Sbjct  66   VFQAKFMPYMEDRIIVTCAADGEVRHAEIREGGKVLTSLLAQHEGRAHKLAIEPGSPYIF  125

Query  588  YSCGEDGFVKHYDL  629
            Y+CGEDG V+H+DL
Sbjct  126  YTCGEDGLVQHFDL  139



>ref|XP_009782402.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform X2 
[Nicotiana sylvestris]
Length=442

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +3

Query  114  MKKLYSASKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTIN  293
            M+K    S D   +  WKRE+G  + + F+  ++ASE +V +LD++ +L  H+G VNT++
Sbjct  3    MRKRARTSLDSAIVNVWKREVGEISTKNFADSLTASEDLVLRLDVFRRLKEHRGWVNTVS  62

Query  294  FNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADG  473
            F++ GDILVS S+D++V LWDW T  + LS+ SGH D +FQAK MP TD+R IVT +AD 
Sbjct  63   FSADGDILVSSSNDRKVTLWDWETGKTVLSFHSGHDDYVFQAKTMPHTDNRSIVTCAAD-  121

Query  474  QVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
                GQ+LE G V T  L KHQG    LA+EPGSP IFY+CG DG V+H DL
Sbjct  122  ----GQILERGYVTTNLLAKHQGLAPKLAIEPGSPNIFYTCGYDGLVQHIDL  169



>gb|EMT10698.1| hypothetical protein F775_06509 [Aegilops tauschii]
Length=516

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 105/161 (65%), Gaps = 23/161 (14%)
 Frame = +3

Query  216  ASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSG  395
            +   ++ +++ YGKL GH GCVNTI+FN  GD+LVSGSDD  +ILWDW  KT KL+YPSG
Sbjct  53   SDSGLILRMNQYGKLRGHSGCVNTISFNPAGDLLVSGSDDTDIILWDWLAKTEKLTYPSG  112

Query  396  HLDNIFQAKFMPFTDDRKIVTASADG-----------------------QVRLGQVLENG  506
            H  N+F A+ MPFTDD  IVT  ADG                       QVR+GQ+ + G
Sbjct  113  HQQNVFHARVMPFTDDSTIVTVGADGQVSADSLNLPFCSDSHFNPTTCPQVRVGQLKQGG  172

Query  507  EVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
               TK++G+H  R H +A+EPGSP+I YSCGEDG V+H+DL
Sbjct  173  GFTTKQIGEHHDRAHKMALEPGSPHILYSCGEDGLVQHFDL  213



>ref|XP_010555203.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555204.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555205.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Tarenaya 
hassleriana]
Length=416

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +3

Query  267  HQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDR  446
            H+G V T++FN+ GDILVSGSDD+QVILW+W T + KLS+ SGH +N+FQAKFMPF+DD 
Sbjct  2    HRGSVRTVSFNADGDILVSGSDDRQVILWNWETGSVKLSFSSGHTNNVFQAKFMPFSDDH  61

Query  447  KIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYD  626
             IVT +ADGQVR  ++LE+G V+T  LG HQG+ H LA+EPGSP+ FYSCG DG VKH+D
Sbjct  62   SIVTCAADGQVRHAKILESG-VETSLLGGHQGQAHKLAIEPGSPFSFYSCGSDGVVKHFD  120

Query  627  L  629
            L
Sbjct  121  L  121



>tpg|DAA44809.1| TPA: hypothetical protein ZEAMMB73_645766, partial [Zea mays]
Length=155

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +3

Query  138  KDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDIL  317
            K   FLE  +REIG S  R  SRRIS SE +V  +  YGKL+GH+GCVNT++FN  GD+L
Sbjct  13   KGSCFLEVGRREIGSSFPRVSSRRISGSEHIVSSMSQYGKLHGHEGCVNTVSFNPAGDLL  72

Query  318  VSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQ  476
            VSGSDD  +ILWDW +KT KL YPSGH DN+F A+ MPFTDD  IVT +ADGQ
Sbjct  73   VSGSDDTNIILWDWLSKTKKLVYPSGHQDNVFHARVMPFTDDSTIVTVAADGQ  125



>gb|EEC81328.1| hypothetical protein OsI_24502 [Oryza sativa Indica Group]
Length=480

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 104/157 (66%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             W+RE+G    + F+  + AS+  V+ L +  +L  H+GCVNTI+FN  G +L+SGSDD+
Sbjct  11   LWEREVGCLPPKLFANSVMASQDFVRSLGVQKRLRKHRGCVNTISFNEDGSLLLSGSDDR  70

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
              +LW+W   T   ++ +GH DN+F A FMPF+ DR I+T +ADGQVR  Q+ E G V T
Sbjct  71   AAVLWNWQEGTPTFAFHTGHSDNVFHALFMPFSGDRSIITCAADGQVRHSQIQEGGRVIT  130

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              L   +  VH LA+EPG+P+ F+SCG++G V  +DL
Sbjct  131  NELVDTEVAVHKLAIEPGNPHTFFSCGDNGSVFLFDL  167



>ref|NP_001058613.1| Os06g0724500 [Oryza sativa Japonica Group]
 dbj|BAD61689.1| transducin family protein-like [Oryza sativa Japonica Group]
 dbj|BAD62533.1| transducin family protein-like [Oryza sativa Japonica Group]
 dbj|BAF20527.1| Os06g0724500 [Oryza sativa Japonica Group]
 gb|EEE66377.1| hypothetical protein OsJ_22697 [Oryza sativa Japonica Group]
Length=480

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 104/157 (66%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             W+RE+G    + F+  + AS+  V+ L +  +L  H+GCVNTI+FN  G +L+SGSDD+
Sbjct  11   LWEREVGCLPPKLFANSVMASQDFVRSLGVQKRLRKHRGCVNTISFNEDGSLLLSGSDDR  70

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
              +LW+W   T   ++ +GH DN+F A FMPF+ DR I+T +ADGQVR  Q+ E G V T
Sbjct  71   AAVLWNWQEGTPTFAFHTGHSDNVFHALFMPFSGDRSIITCAADGQVRHSQIQEGGRVIT  130

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              L   +  VH LA+EPG+P+ F+SCG++G V  +DL
Sbjct  131  NELVDTEVAVHKLAIEPGNPHTFFSCGDNGSVFLFDL  167



>ref|XP_004966484.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Setaria italica]
Length=487

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             W+RE+G    R F+  + AS+  V+ L +  +L  H+GCVNTI+FNS G  L+SG+DD+
Sbjct  11   LWEREVGGLPPRHFANAVMASKDFVQSLSIQKRLRKHRGCVNTISFNSDGRFLLSGADDR  70

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
             V+LW+W       S+ SGH +N+  A+FMPF+DDR +VT +ADG+VR  Q+ E G   T
Sbjct  71   NVVLWNWVEAAPTFSFHSGHSNNVLHAQFMPFSDDRSVVTCAADGEVRHSQIREGGCATT  130

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +L +    VH LAVEPGSPY FY C ED  V  +DL
Sbjct  131  DKLVELDFAVHRLAVEPGSPYTFYCCCEDSSVWLFDL  167



>ref|XP_002439042.1| hypothetical protein SORBIDRAFT_10g030450 [Sorghum bicolor]
 gb|EER90409.1| hypothetical protein SORBIDRAFT_10g030450 [Sorghum bicolor]
Length=487

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  147  KFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            +  E W+RE+G    + F+  + AS+  V+ L++  +L  H+GCVNTI+F++ G +L+SG
Sbjct  7    RMEELWEREVGSLPPKRFANSVMASKEYVQSLNIQKRLRKHRGCVNTISFSADGSLLLSG  66

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDD+ ++LWDW      LS+ +GH +N++ A FMP +DDR IV+ +ADG+V   Q+ E G
Sbjct  67   SDDRTLVLWDWQEAAPTLSFHTGHRNNVYHALFMPVSDDRSIVSCAADGEVIHSQIEEGG  126

Query  507  EVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             V T +L + +  VH LAVEP SP+ FY C +D  V H+DL
Sbjct  127  RVITDKLVELEFAVHRLAVEPASPHTFYCCCQDSSVWHFDL  167



>ref|XP_001632024.1| predicted protein [Nematostella vectensis]
 gb|EDO39961.1| predicted protein [Nematostella vectensis]
Length=462

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             + R+ G  +   F+++ S S  +V++L L+  L  H GCVNT++++ TG++L SGSDD 
Sbjct  53   LFARQQGLLSPGYFTKKASGSTGLVQRLKLHSNLKYHDGCVNTLHYSPTGELLASGSDDL  112

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVD-  515
             +++WDWA K   L Y SGH  N+FQAKFMPF+ +  +V+ + DGQVR+G +   G    
Sbjct  113  DIVIWDWAKKKKVLHYESGHASNVFQAKFMPFSSESTLVSCARDGQVRVGFLSSTGTSKG  172

Query  516  TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            TK+L +H+G  H L++EPGSP+ F++CGEDG V   DL
Sbjct  173  TKKLSQHRGAAHKLSIEPGSPWTFFTCGEDGVVFQVDL  210



>emb|CAB36721.1| putative protein [Arabidopsis thaliana]
 emb|CAB80231.1| putative protein [Arabidopsis thaliana]
Length=493

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +3

Query  153  LEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            ++FW+RE+G  ++R FS R SASE +V +L++Y KL  H+GCVNT++FN+ GD+L+SGSD
Sbjct  20   VDFWRREVGGISSRNFSNRFSASENLVLRLEIYKKLEKHKGCVNTVSFNAEGDVLISGSD  79

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRL-----GQVL  497
            D++V+LWDW     KLS+ SGH +N+FQAKFMPF+DDR IVT +ADG   L      ++ 
Sbjct  80   DRRVVLWDWQLGNVKLSFHSGHANNVFQAKFMPFSDDRTIVTCAADGMFDLRTEAPTELF  139

Query  498  ENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
                VD +R      +++++A++P +  +F   G + + + YD+
Sbjct  140  TCRSVDPRRRNMDAIQLNAIAIDPRNSNLFAVGGMEEYARLYDI  183



>gb|ELU09524.1| hypothetical protein CAPTEDRAFT_156303 [Capitella teleta]
Length=460

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +3

Query  165  KREIGF----SAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSD  332
            +RE+GF    SA   F  +  AS  +VK+L+L+  L+GH+GCVN ++FN  G++L SGSD
Sbjct  21   QRELGFHNRMSATDLFKIKAGASLNLVKRLELFTTLDGHEGCVNALHFNQAGNLLASGSD  80

Query  333  DKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV  512
            D  +I+WDWA K    S+ SGH  N+FQ KFMPFT D  +V+ + DG +RL ++   G  
Sbjct  81   DLSIIVWDWACKRKAFSFDSGHRSNVFQCKFMPFTGDCHLVSCARDGMIRLAELSSMGSC  140

Query  513  -DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
              T+RL  H+G  H LA+   S ++ YSCGEDG +   DL
Sbjct  141  KSTRRLAAHRGAAHKLALLEDSSHVLYSCGEDGAMFEIDL  180



>dbj|BAJ98693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +3

Query  135  SKDDKFLEFWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDI  314
            +K  +  E W RE+G    + F+  + AS+  V  L +  +L  H+G VNTI+FNS G +
Sbjct  3    AKGTRMAELWGREVGRLRPKRFADSVKASQDFVNSLGIQKRLREHRGGVNTISFNSNGSL  62

Query  315  LVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQV  494
            L+SGSDD+ V+LWDW      + + +GH +N+  A+FMP +DDR IVT   DG+VR  Q+
Sbjct  63   LLSGSDDRTVVLWDWVRAKPAVQFHTGHENNVLHAQFMPLSDDRSIVTCGGDGEVRYAQI  122

Query  495  LENGEVDTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             E G V   ++ +    VH LAVE G+P  FYS G+DG+V  +DL
Sbjct  123  DEAGRVYVDQVVEMAYEVHRLAVEQGNPNTFYSSGQDGYVWRFDL  167



>ref|XP_011398325.1| DDB1- and CUL4-associated factor 8 [Auxenochlorella protothecoides]
 gb|KFM25430.1| DDB1- and CUL4-associated factor 8 [Auxenochlorella protothecoides]
Length=606

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 100/155 (65%), Gaps = 1/155 (1%)
 Frame = +3

Query  165  KREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQV  344
            +RE   S +R F  R+ AS  ++++L L  +L GH GCVNT+ F   G+ L+SGSDD+ +
Sbjct  10   QREGLLSPSR-FRSRVGASLHLLQRLGLTRRLEGHTGCVNTVTFTPDGEGLLSGSDDQLI  68

Query  345  ILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKR  524
             LWDW      LSY SGH DN+FQA+ +P TD+R +V++ ADGQVRLG   E G V T+ 
Sbjct  69   KLWDWRRGAEVLSYDSGHTDNVFQARAIPGTDNRTVVSSGADGQVRLGLAGEGGSVRTRC  128

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H GR H LA+ PG+     SCGEDG V   D+
Sbjct  129  VARHNGRAHKLALVPGAAGWVLSCGEDGRVLSTDV  163



>ref|XP_007229236.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Astyanax 
mexicanus]
Length=619

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  +A+ F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  184  REIGRDSAQ-FVRRVCGARGLVQRLELQGRLERHSGCVNTLHFNPSGTRLASGSDDLRVV  242

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  243  IWDWARRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRIAELSATQRCKNTKR  302

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  303  VAQHKGAAHKLALEPESPCSFLSAGEDAVVFGIDL  337



>ref|XP_785904.3| PREDICTED: DDB1- and CUL4-associated factor 8-like [Strongylocentrotus 
purpuratus]
Length=683

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 105/180 (58%), Gaps = 3/180 (2%)
 Frame = +3

Query  99   LRNRKMKKLYSASKDDKFLEFWKREIGF--SAARTFSRRISASEAVVKQLDLYGKLNGHQ  272
            + N  + +     K     E   RE G     +  +      S  + K+LD Y +L  H+
Sbjct  171  MENEILGRNLPPPKSHALHEIRAREFGHYQRCSLPYCLNFMGSVPLAKRLDKYCELKHHE  230

Query  273  GCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKI  452
            GCVNT++FN  GD+L SGSDD +++LWDWA +  KL + SGH  N+FQAKFMP + D  +
Sbjct  231  GCVNTLHFNPAGDLLASGSDDLEIVLWDWARQKPKLIFESGHRSNVFQAKFMPCSGDATL  290

Query  453  VTASADGQVRLGQVLENGEV-DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            ++ + DGQVR+ ++   G   +TK++ +H+G  H L + P SP +F SCGED  V + DL
Sbjct  291  ISCARDGQVRVAELSTTGVCKETKKIVQHKGAAHKLGLLPDSPVVFMSCGEDAAVYNIDL  350



>gb|EKC36901.1| WD repeat-containing protein 42A [Crassostrea gigas]
Length=759

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 100/162 (62%), Gaps = 4/162 (2%)
 Frame = +3

Query  156  EFWKREIGFS---AARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            +   R++GFS       F  ++  S  +V++L L  K+  H+GCVN ++FN  G +L SG
Sbjct  315  DLSSRQMGFSNRTPPSIFREKVQGSLQMVQRLKLQYKMEYHEGCVNALSFNRIGTLLASG  374

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDD  VILW+W  K   L Y SGH  N+FQAKFMPF+ D  +V+ + DGQVRL ++   G
Sbjct  375  SDDLNVILWNWIKKRPSLVYDSGHRGNVFQAKFMPFSGDCHVVSCARDGQVRLAELSLTG  434

Query  507  EVD-TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
                TK+L +H+G  H LA+E  SP++F SCGED  V   DL
Sbjct  435  VCKGTKKLAQHKGAAHKLALELDSPHVFLSCGEDAMVFSIDL  476



>ref|XP_011451300.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Crassostrea 
gigas]
 ref|XP_011451301.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Crassostrea 
gigas]
 ref|XP_011451302.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Crassostrea 
gigas]
Length=756

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 100/162 (62%), Gaps = 4/162 (2%)
 Frame = +3

Query  156  EFWKREIGFS---AARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSG  326
            +   R++GFS       F  ++  S  +V++L L  K+  H+GCVN ++FN  G +L SG
Sbjct  315  DLSSRQMGFSNRTPPSIFREKVQGSLQMVQRLKLQYKMEYHEGCVNALSFNRIGTLLASG  374

Query  327  SDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENG  506
            SDD  VILW+W  K   L Y SGH  N+FQAKFMPF+ D  +V+ + DGQVRL ++   G
Sbjct  375  SDDLNVILWNWIKKRPSLVYDSGHRGNVFQAKFMPFSGDCHVVSCARDGQVRLAELSLTG  434

Query  507  EVD-TKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
                TK+L +H+G  H LA+E  SP++F SCGED  V   DL
Sbjct  435  VCKGTKKLAQHKGAAHKLALELDSPHVFLSCGEDAMVFSIDL  476



>ref|XP_003563262.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Brachypodium distachyon]
Length=488

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  FWKREIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDK  338
             W+RE+G    + F+  + AS+  V+ L ++ +L  H+GCVNTI+FNS+G +L+SGSDD+
Sbjct  11   LWEREVGRLPPKRFANAVMASKDFVQSLSIHKRLRKHRGCVNTISFNSSGSLLLSGSDDQ  70

Query  339  QVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDT  518
             ++LW+W      L + +GH +N+  A+FMPF+DDR I+++ ADGQVR  Q+ E G V T
Sbjct  71   YIMLWNWEKGEPTLKFYTGHDNNVLYAQFMPFSDDRSIISSGADGQVRHSQIQEGGCVLT  130

Query  519  KRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             +  +    VH LAV+PG+P+ F+SCG+DG V  +D+
Sbjct  131  HKFAEMDYAVHRLAVQPGNPHTFFSCGQDGAVWSFDV  167



>ref|XP_010787725.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Notothenia coriiceps]
Length=619

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 107/183 (58%), Gaps = 9/183 (5%)
 Frame = +3

Query  105  NRKMKKLYSASKDDKFLEFWK-------REIGFSAARTFSRRISASEAVVKQLDLYGKLN  263
            N  M+    A   D     W+       REIG    + F RR+  +  +V++L+L G+L 
Sbjct  157  NEAMEAWLGAEVRDMRAPIWRSIPSLRSREIGRHTHQ-FVRRVCGARGLVQRLELQGRLE  215

Query  264  GHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDD  443
             H GCVNT++FN +G  L SGSDD +V++WDWA + ++L + SGH  N+FQAKF+P + D
Sbjct  216  RHTGCVNTLHFNPSGTRLASGSDDLRVVIWDWAIRRAELEFDSGHKSNVFQAKFLPHSGD  275

Query  444  RKIVTASADGQVRLGQVLENGEV-DTKRLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKH  620
              +   + DGQ+R+ ++       +TKR+ +H+G  H LA+EP SP  F S GED  V  
Sbjct  276  STLAMCARDGQIRVAELSATQRCKNTKRVAQHKGAAHKLALEPDSPCSFLSAGEDAVVFG  335

Query  621  YDL  629
             DL
Sbjct  336  IDL  338



>gb|EMS65437.1| DDB1- and CUL4-associated factor 8 [Triticum urartu]
Length=464

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = +3

Query  216  ASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSG  395
            +S  +V  L +  +L  H+GCVNTI+FNSTG +L+SGSDD+ V+LWDW      L   +G
Sbjct  4    SSPDLVNSLGIQKRLQEHRGCVNTISFNSTGSLLLSGSDDRTVVLWDWERAKPALQIHTG  63

Query  396  HLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAVEPGS  575
            H +N+  A+FMP +DDR IVT  ADG+VR  Q+ E G     ++ + +  VH LAVEPGS
Sbjct  64   HENNVLHAQFMPLSDDRSIVTCGADGEVRYVQIEEGGRAVVDQVVETEYAVHRLAVEPGS  123

Query  576  PYIFYSCGEDGFVKHYDL  629
            P+ FYS G+DG V  +DL
Sbjct  124  PHTFYSAGQDGSVWRFDL  141



>ref|XP_007564289.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Poecilia formosa]
 ref|XP_007564290.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Poecilia formosa]
Length=617

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG ++ + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  183  REIGRNSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  241

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  242  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  301

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  302  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  336



>gb|EMT02177.1| hypothetical protein F775_23299 [Aegilops tauschii]
Length=604

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 0/142 (0%)
 Frame = +3

Query  204  RRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLS  383
            R  + S   V  L +  +L  H+GCVNTI+FNSTG +L+SGSDD+ V+LWDW      L 
Sbjct  141  RTKTRSTDFVNSLGIQKRLREHRGCVNTISFNSTGSLLLSGSDDRTVVLWDWEAARPALQ  200

Query  384  YPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTKRLGKHQGRVHSLAV  563
              +GH +N+  A+FMP +DDR IVT  ADG+VR  Q+ E G     ++ + +  VH LAV
Sbjct  201  IHTGHENNVLHAQFMPLSDDRSIVTCGADGEVRYVQIEEGGRAVVDQVVETEYAVHRLAV  260

Query  564  EPGSPYIFYSCGEDGFVKHYDL  629
            EPGSP+ FYS G+DG V  +DL
Sbjct  261  EPGSPHTFYSAGQDGSVWRFDL  282



>emb|CDQ67358.1| unnamed protein product [Oncorhynchus mykiss]
Length=568

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG   +  F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  143  REIG-RGSHQFVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  201

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  202  VWDWARRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSAMQRCKNTKR  261

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  262  VAQHKGAAHKLALEPDSPCCFLSAGEDAVVFGIDL  296



>ref|XP_008432603.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Poecilia reticulata]
Length=617

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG ++ + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  183  REIGRNSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  241

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  242  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  301

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  302  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  336



>ref|XP_009588097.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009588098.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X3 [Nicotiana 
tomentosiformis]
Length=466

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  VILWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEVDTK  521
            VILWDW T    LS+ SGH +N+FQAK MP+TDDR IVT +ADGQVR  Q+L++G+V+TK
Sbjct  2    VILWDWETGKVVLSFHSGHHNNVFQAKIMPYTDDRSIVTCAADGQVRQAQILDHGKVETK  61

Query  522  RLGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
             L KHQGR H LA+EP SP+IFY+CGEDG V+H DL
Sbjct  62   LLAKHQGRAHKLAIEPASPHIFYTCGEDGLVQHIDL  97



>ref|XP_005729142.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Pundamilia 
nyererei]
Length=608

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  174  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  232

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  233  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  292

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  293  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  327



>ref|XP_010744519.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Larimichthys crocea]
Length=618

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  184  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLEKHTGCVNTLHFNPSGTRLASGSDDLRVV  242

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  243  IWDWAVRHAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  302

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  303  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  337



>ref|XP_003975477.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Takifugu 
rubripes]
Length=533

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F+RR+  +  +V++L+L G+L  H GCVNT++FN TG  L SGSDD +V+
Sbjct  99   REIGRDSHQ-FARRVCGARGLVQRLELQGRLERHTGCVNTLHFNPTGTRLASGSDDLRVV  157

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + + L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  158  IWDWAIRHAVLEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQCCKNTKR  217

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  218  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  252



>ref|XP_003448570.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Oreochromis 
niloticus]
Length=618

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  184  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  242

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  243  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  302

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  303  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  337



>ref|XP_008275391.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Stegastes partitus]
Length=611

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  177  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  235

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  236  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  295

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  296  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  330



>ref|XP_004555354.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Maylandia 
zebra]
Length=616

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  182  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  240

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  241  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  300

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  301  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  335



>ref|XP_006792326.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Neolamprologus 
brichardi]
Length=615

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  181  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  239

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  240  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  299

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  300  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  334



>ref|XP_005924708.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Haplochromis 
burtoni]
Length=616

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  182  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  240

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  241  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  300

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  301  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  335



>ref|XP_008332824.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008332825.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X2 [Cynoglossus 
semilaevis]
Length=635

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  201  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLEKHTGCVNTLHFNPSGTRLASGSDDLRVV  259

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH+ N+FQAKF+P + D  +   + DGQ+R+ ++       +T R
Sbjct  260  IWDWANRRAELEFDSGHISNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTMR  319

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  320  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  354



>ref|XP_005846365.1| hypothetical protein CHLNCDRAFT_135819 [Chlorella variabilis]
 gb|EFN54263.1| hypothetical protein CHLNCDRAFT_135819 [Chlorella variabilis]
Length=739

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = +3

Query  219  SEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDWATKTSKLSYPSGH  398
            S  +VK+L L   L GH GCVNT++F+  G +LVSGSDD Q+  WDW   T  L++ SGH
Sbjct  26   SSTLVKRLRLERTLEGHDGCVNTVHFSPDGQLLVSGSDDMQIFFWDWQLGTRTLAFHSGH  85

Query  399  LDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLE---NGEVDTKRLGKHQGRVHSLAVEP  569
             +N+FQA+ MP + +  +VT +ADG VR+  V +      V T+RL  H+GR H LA+EP
Sbjct  86   HNNVFQARIMPHSANSTVVTCAADGLVRVATVQQGSGGAAVGTRRLACHRGRAHKLALEP  145

Query  570  GSPYIFYSCGEDGFVKHYDL  629
            GSP+ F SC  DG V+H+DL
Sbjct  146  GSPHCFLSC--DGEVRHFDL  163



>emb|CAE17623.2| novel protein similar to human H326 protein, partial [Danio rerio]
Length=571

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F R++  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  172  REIGRDS-QQFVRKVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  230

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  231  IWDWARRKAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  290

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  291  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  325



>ref|XP_008332822.1| PREDICTED: DDB1- and CUL4-associated factor 8 isoform X1 [Cynoglossus 
semilaevis]
Length=662

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  228  REIGRDSHQ-FVRRVCGARGLVQRLELQGRLEKHTGCVNTLHFNPSGTRLASGSDDLRVV  286

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH+ N+FQAKF+P + D  +   + DGQ+R+ ++       +T R
Sbjct  287  IWDWANRRAELEFDSGHISNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTMR  346

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  347  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  381



>ref|XP_005802010.1| PREDICTED: DDB1- and CUL4-associated factor 8-like [Xiphophorus 
maculatus]
Length=620

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG ++ + F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  186  REIGRNSHQ-FVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  244

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  245  IWDWAIRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSVTQRCKNTKR  304

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  305  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  339



>ref|XP_001346262.2| PREDICTED: DDB1- and CUL4-associated factor 8 [Danio rerio]
Length=607

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG  + + F R++  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  172  REIGRDS-QQFVRKVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  230

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  231  IWDWARRKAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  290

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA+EP SP  F S GED  V   DL
Sbjct  291  VAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDL  325



>ref|XP_010887844.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Esox lucius]
 ref|XP_010887853.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Esox lucius]
Length=608

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 2/155 (1%)
 Frame = +3

Query  168  REIGFSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVI  347
            REIG      F RR+  +  +V++L+L G+L  H GCVNT++FN +G  L SGSDD +V+
Sbjct  173  REIG-RGLHQFVRRVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVV  231

Query  348  LWDWATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKR  524
            +WDWA + ++L + SGH  N+FQAKF+P + D  +   + DGQ+R+ ++       +TKR
Sbjct  232  IWDWARRRAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKR  291

Query  525  LGKHQGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            + +H+G  H LA++P SP  F S GED  V   DL
Sbjct  292  VAQHKGAAHKLALDPDSPCSFLSAGEDAVVFGIDL  326



>gb|KDR14597.1| WD repeat-containing protein 42A [Zootermopsis nevadensis]
Length=697

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 1/151 (1%)
 Frame = +3

Query  180  FSAARTFSRRISASEAVVKQLDLYGKLNGHQGCVNTINFNSTGDILVSGSDDKQVILWDW  359
            +  A  F +R   S   V++L+L  KL+ HQGCVN ++FNS+G +L SGSDD  +++WDW
Sbjct  244  YRGAELFQQRCYGSLHSVQRLELMYKLDAHQGCVNALHFNSSGTLLASGSDDLSIVVWDW  303

Query  360  ATKTSKLSYPSGHLDNIFQAKFMPFTDDRKIVTASADGQVRLGQVLENGEV-DTKRLGKH  536
            A     ++  SGH  N+FQAKF+PFT D  IV+   DGQVRL ++   G    T+RLG+H
Sbjct  304  AVGKFLVTCDSGHRSNVFQAKFLPFTGDTHIVSCGRDGQVRLAELSVTGLYRSTRRLGQH  363

Query  537  QGRVHSLAVEPGSPYIFYSCGEDGFVKHYDL  629
            +G  H LA+   +P++F S GED  +  +D+
Sbjct  364  RGPAHKLAIHQETPHVFLSSGEDALIMSFDV  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875