BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004D03 646 bp,

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594206.1|  PREDICTED: uncharacterized protein At1g04910...    296   2e-95   Nicotiana tomentosiformis
ref|XP_009786113.1|  PREDICTED: uncharacterized protein At1g04910...    295   3e-95   Nicotiana sylvestris
ref|XP_006357439.1|  PREDICTED: uncharacterized protein At1g04910...    293   1e-94   Solanum tuberosum [potatoes]
ref|XP_006357438.1|  PREDICTED: uncharacterized protein At1g04910...    293   1e-94   Solanum tuberosum [potatoes]
ref|XP_004241868.1|  PREDICTED: uncharacterized protein At1g04910...    291   1e-93   Solanum lycopersicum
ref|XP_010322803.1|  PREDICTED: uncharacterized protein At1g04910...    291   1e-93   Solanum lycopersicum
ref|XP_009765354.1|  PREDICTED: uncharacterized protein At1g04910...    290   3e-93   Nicotiana sylvestris
ref|XP_009587135.1|  PREDICTED: uncharacterized protein At1g04910...    290   5e-93   Nicotiana tomentosiformis
ref|XP_006342865.1|  PREDICTED: uncharacterized protein LOC102606164    286   9e-92   Solanum tuberosum [potatoes]
emb|CDO97753.1|  unnamed protein product                                269   7e-85   Coffea canephora [robusta coffee]
ref|XP_011072734.1|  PREDICTED: uncharacterized protein At1g04910...    263   9e-83   Sesamum indicum [beniseed]
gb|KDP34445.1|  hypothetical protein JCGZ_11916                         261   1e-81   Jatropha curcas
ref|XP_002528288.1|  conserved hypothetical protein                     257   3e-80   Ricinus communis
ref|XP_007023804.1|  O-fucosyltransferase family protein                257   3e-80   Theobroma cacao [chocolate]
ref|XP_007142132.1|  hypothetical protein PHAVU_008G255300g             257   4e-80   Phaseolus vulgaris [French bean]
gb|KJB66472.1|  hypothetical protein B456_010G141100                    252   4e-80   Gossypium raimondii
ref|XP_006379398.1|  hypothetical protein POPTR_0008s00860g             256   5e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002316445.2|  hypothetical protein POPTR_0010s25710g             256   9e-80   Populus trichocarpa [western balsam poplar]
gb|KJB66473.1|  hypothetical protein B456_010G141100                    252   1e-79   Gossypium raimondii
ref|XP_011033030.1|  PREDICTED: uncharacterized protein LOC105131655    256   1e-79   Populus euphratica
ref|XP_011046520.1|  PREDICTED: uncharacterized protein At1g04910       255   1e-79   Populus euphratica
gb|KJB66474.1|  hypothetical protein B456_010G141100                    253   1e-78   Gossypium raimondii
gb|EYU21223.1|  hypothetical protein MIMGU_mgv1a007275mg                253   1e-78   Erythranthe guttata [common monkey flower]
gb|KHG26733.1|  hypothetical protein F383_08102                         252   2e-78   Gossypium arboreum [tree cotton]
gb|KJB56404.1|  hypothetical protein B456_009G118400                    252   3e-78   Gossypium raimondii
gb|KJB66475.1|  hypothetical protein B456_010G141100                    252   4e-78   Gossypium raimondii
ref|NP_001239923.1|  uncharacterized protein LOC100813879               251   8e-78   Glycine max [soybeans]
ref|XP_009349642.1|  PREDICTED: uncharacterized protein At1g04910...    251   9e-78   Pyrus x bretschneideri [bai li]
ref|XP_010696090.1|  PREDICTED: uncharacterized protein LOC104908...    251   1e-77   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010696089.1|  PREDICTED: uncharacterized protein LOC104908...    251   2e-77   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHN38079.1|  DUF246 domain-containing protein                        249   3e-77   Glycine soja [wild soybean]
ref|XP_010110886.1|  hypothetical protein L484_004969                   249   4e-77   Morus notabilis
ref|XP_004303832.1|  PREDICTED: uncharacterized protein LOC101293906    249   5e-77   Fragaria vesca subsp. vesca
ref|XP_010034072.1|  PREDICTED: uncharacterized protein LOC104423261    248   1e-76   Eucalyptus grandis [rose gum]
ref|XP_003529532.1|  PREDICTED: uncharacterized protein At1g04910       248   1e-76   Glycine max [soybeans]
gb|KHN39355.1|  DUF246 domain-containing protein                        248   2e-76   Glycine soja [wild soybean]
ref|XP_009333975.1|  PREDICTED: uncharacterized protein At1g04910...    246   7e-76   Pyrus x bretschneideri [bai li]
ref|XP_008353648.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-75   Malus domestica [apple tree]
ref|XP_008365624.1|  PREDICTED: uncharacterized protein At1g04910...    245   2e-75   Malus domestica [apple tree]
gb|KHG06209.1|  hypothetical protein F383_32398                         245   2e-75   Gossypium arboreum [tree cotton]
gb|AFK36313.1|  unknown                                                 237   5e-75   Lotus japonicus
gb|KDO45579.1|  hypothetical protein CISIN_1g014966mg                   243   6e-75   Citrus sinensis [Valencia orange]
gb|KDO45578.1|  hypothetical protein CISIN_1g014966mg                   243   1e-74   Citrus sinensis [Valencia orange]
ref|XP_006427747.1|  hypothetical protein CICLE_v10025717mg             242   2e-74   Citrus clementina
ref|XP_006492037.1|  PREDICTED: uncharacterized protein LOC102630315    242   2e-74   Citrus sinensis [Valencia orange]
ref|XP_006427746.1|  hypothetical protein CICLE_v10025717mg             241   4e-74   Citrus clementina
ref|XP_010545614.1|  PREDICTED: uncharacterized protein LOC104817925    241   1e-73   Tarenaya hassleriana [spider flower]
gb|AAW56451.1|  unknown                                                 234   3e-73   Flaveria brownii
ref|XP_002275416.1|  PREDICTED: uncharacterized protein LOC100250173    239   3e-73   Vitis vinifera
ref|XP_008227941.1|  PREDICTED: uncharacterized protein At1g04910       238   8e-73   Prunus mume [ume]
ref|XP_007215446.1|  hypothetical protein PRUPE_ppa006341mg             238   8e-73   Prunus persica
gb|AFK48578.1|  unknown                                                 231   8e-73   Lotus japonicus
gb|KEH28614.1|  GDP-fucose protein O-fucosyltransferase                 236   1e-72   Medicago truncatula
ref|XP_010927269.1|  PREDICTED: uncharacterized protein LOC105049343    236   2e-72   Elaeis guineensis
gb|KEH28615.1|  GDP-fucose protein O-fucosyltransferase                 236   4e-72   Medicago truncatula
ref|XP_008799452.1|  PREDICTED: uncharacterized protein At1g04910       236   9e-72   Phoenix dactylifera
ref|XP_010479652.1|  PREDICTED: uncharacterized protein LOC104758474    235   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010461997.1|  PREDICTED: uncharacterized protein LOC104742678    235   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006307609.1|  hypothetical protein CARUB_v10009235mg             235   2e-71   Capsella rubella
ref|XP_008801515.1|  PREDICTED: uncharacterized protein LOC103715609    235   2e-71   Phoenix dactylifera
emb|CDY55666.1|  BnaC06g04700D                                          234   2e-71   Brassica napus [oilseed rape]
ref|XP_002885425.1|  hypothetical protein ARALYDRAFT_479639             234   2e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010500742.1|  PREDICTED: uncharacterized protein LOC104778073    234   2e-71   Camelina sativa [gold-of-pleasure]
gb|KFK35833.1|  hypothetical protein AALP_AA4G043000                    234   3e-71   Arabis alpina [alpine rockcress]
ref|XP_009145508.1|  PREDICTED: uncharacterized protein LOC103869200    234   3e-71   Brassica rapa
emb|CDY19573.1|  BnaA05g19810D                                          234   4e-71   Brassica napus [oilseed rape]
ref|XP_006393024.1|  hypothetical protein EUTSA_v10011516mg             234   4e-71   Eutrema salsugineum
ref|XP_009147757.1|  PREDICTED: uncharacterized protein LOC103871274    233   4e-71   Brassica rapa
ref|XP_010466346.1|  PREDICTED: uncharacterized protein LOC104746536    234   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004141744.1|  PREDICTED: uncharacterized protein LOC101215039    233   5e-71   Cucumis sativus [cucumbers]
ref|XP_008462222.1|  PREDICTED: uncharacterized protein LOC103500628    233   6e-71   
ref|XP_010276723.1|  PREDICTED: uncharacterized protein At1g04910...    233   7e-71   Nelumbo nucifera [Indian lotus]
emb|CDY22855.1|  BnaA06g02220D                                          232   1e-70   Brassica napus [oilseed rape]
emb|CDY50071.1|  BnaC05g30800D                                          232   2e-70   Brassica napus [oilseed rape]
ref|NP_566677.1|  O-fucosyltransferase family protein                   232   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150835.1|  hypothetical protein PHAVU_005G184800g             231   2e-70   Phaseolus vulgaris [French bean]
ref|XP_002894326.1|  hypothetical protein ARALYDRAFT_892138             231   3e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006406304.1|  hypothetical protein EUTSA_v10020803mg             231   4e-70   Eutrema salsugineum
emb|CDY52950.1|  BnaC03g77880D                                          231   4e-70   Brassica napus [oilseed rape]
ref|XP_004159011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   4e-70   
ref|XP_010509815.1|  PREDICTED: uncharacterized protein LOC104786164    231   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009107173.1|  PREDICTED: uncharacterized protein LOC103832835    231   5e-70   Brassica rapa
emb|CDY43916.1|  BnaA05g15260D                                          231   5e-70   Brassica napus [oilseed rape]
ref|XP_009144893.1|  PREDICTED: uncharacterized protein LOC103868560    231   5e-70   Brassica rapa
ref|NP_175574.2|  O-fucosyltransferase family protein                   231   5e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546222.1|  PREDICTED: uncharacterized protein LOC100789...    229   1e-69   Glycine max [soybeans]
ref|XP_006597087.1|  PREDICTED: uncharacterized protein LOC100789...    229   1e-69   Glycine max [soybeans]
gb|AAM65575.1|  unknown                                                 229   2e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27536.1|  BnaC01g32190D                                          228   5e-69   Brassica napus [oilseed rape]
ref|XP_010550817.1|  PREDICTED: uncharacterized protein LOC104821598    228   6e-69   Tarenaya hassleriana [spider flower]
emb|CDY37310.1|  BnaA01g25300D                                          228   7e-69   Brassica napus [oilseed rape]
ref|XP_009109756.1|  PREDICTED: uncharacterized protein LOC103835351    228   8e-69   Brassica rapa
ref|XP_004507011.1|  PREDICTED: uncharacterized protein LOC101492011    228   8e-69   Cicer arietinum [garbanzo]
gb|ACU23517.1|  unknown                                                 227   1e-68   Glycine max [soybeans]
ref|XP_010488108.1|  PREDICTED: uncharacterized protein LOC104766006    227   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010929324.1|  PREDICTED: uncharacterized protein LOC105050840    226   3e-68   Elaeis guineensis
emb|CDX87826.1|  BnaC06g08880D                                          226   3e-68   Brassica napus [oilseed rape]
ref|XP_006297757.1|  hypothetical protein CARUB_v10013792mg             226   4e-68   Capsella rubella
ref|XP_006595200.1|  PREDICTED: uncharacterized protein LOC100807...    225   4e-68   Glycine max [soybeans]
ref|XP_003543719.1|  PREDICTED: uncharacterized protein LOC100807...    225   5e-68   Glycine max [soybeans]
gb|KHN31859.1|  DUF246 domain-containing protein                        225   5e-68   Glycine soja [wild soybean]
gb|EPS57961.1|  hypothetical protein M569_16856                         223   6e-67   Genlisea aurea
ref|XP_009381592.1|  PREDICTED: uncharacterized protein At1g04910...    216   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381590.1|  PREDICTED: uncharacterized protein At1g04910...    216   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG50891.1|AC025294_29  unknown protein                              217   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KHN35827.1|  DUF246 domain-containing protein                        216   4e-64   Glycine soja [wild soybean]
ref|XP_003533745.1|  PREDICTED: uncharacterized protein At1g04910...    216   4e-64   Glycine max [soybeans]
gb|KHN24633.1|  hypothetical protein glysoja_032277                     213   9e-64   Glycine soja [wild soybean]
ref|XP_010656875.1|  PREDICTED: uncharacterized protein At1g04910...    214   1e-63   Vitis vinifera
ref|NP_001242787.1|  uncharacterized protein LOC100818659               212   1e-62   Glycine max [soybeans]
dbj|BAK06813.1|  predicted protein                                      212   1e-62   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009410213.1|  PREDICTED: uncharacterized protein At1g04910...    209   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578366.1|  PREDICTED: uncharacterized protein At1g04910...    209   1e-61   Brachypodium distachyon [annual false brome]
ref|XP_009410212.1|  PREDICTED: uncharacterized protein At1g04910...    209   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004488019.1|  PREDICTED: uncharacterized protein At1g04910...    208   4e-61   Cicer arietinum [garbanzo]
ref|XP_003595107.1|  DUF246 domain-containing protein                   205   4e-60   Medicago truncatula
ref|NP_001063569.1|  Os09g0498800                                       203   2e-59   
gb|EEC84820.1|  hypothetical protein OsI_31907                          203   5e-59   Oryza sativa Indica Group [Indian rice]
gb|AFV79649.1|  mannan synthesis-related protein                        201   1e-58   Trigonella foenum-graecum [fenugreek]
ref|XP_006845774.1|  hypothetical protein AMTR_s00019p00251420          200   1e-58   
ref|XP_006660799.1|  PREDICTED: uncharacterized protein At1g04910...    200   3e-58   Oryza brachyantha
ref|XP_011077745.1|  PREDICTED: uncharacterized protein At1g04910...    199   9e-58   Sesamum indicum [beniseed]
ref|XP_002462607.1|  hypothetical protein SORBIDRAFT_02g028940          196   1e-56   Sorghum bicolor [broomcorn]
gb|ABR16242.1|  unknown                                                 192   3e-55   Picea sitchensis
ref|NP_001143681.1|  uncharacterized protein LOC100276406               191   6e-55   Zea mays [maize]
ref|NP_001131433.1|  uncharacterized protein LOC100192765               191   7e-55   Zea mays [maize]
ref|XP_004957253.1|  PREDICTED: uncharacterized protein At1g04910...    189   4e-54   Setaria italica
ref|XP_009617901.1|  PREDICTED: uncharacterized protein At1g04910...    189   8e-54   Nicotiana tomentosiformis
gb|ABR18129.1|  unknown                                                 188   2e-53   Picea sitchensis
emb|CBI17884.3|  unnamed protein product                                182   2e-53   Vitis vinifera
gb|EYU38735.1|  hypothetical protein MIMGU_mgv1a007007mg                187   4e-53   Erythranthe guttata [common monkey flower]
emb|CAN79033.1|  hypothetical protein VITISV_027517                     187   4e-53   Vitis vinifera
ref|XP_010656876.1|  PREDICTED: uncharacterized protein At1g04910...    184   3e-52   Vitis vinifera
ref|XP_009785320.1|  PREDICTED: uncharacterized protein At1g04910...    184   4e-52   Nicotiana sylvestris
ref|XP_010656874.1|  PREDICTED: uncharacterized protein At1g04910...    182   2e-51   Vitis vinifera
emb|CDP20249.1|  unnamed protein product                                182   3e-51   Coffea canephora [robusta coffee]
gb|EYU18195.1|  hypothetical protein MIMGU_mgv1a023399mg                181   7e-51   Erythranthe guttata [common monkey flower]
gb|KCW78621.1|  hypothetical protein EUGRSUZ_C00086                     177   7e-51   Eucalyptus grandis [rose gum]
ref|XP_004243033.1|  PREDICTED: uncharacterized protein LOC101261246    179   2e-50   Solanum lycopersicum
gb|EMT00881.1|  hypothetical protein F775_06359                         157   1e-41   Aegilops tauschii
gb|EMS49507.1|  hypothetical protein TRIUR3_13058                       149   2e-39   Triticum urartu
ref|XP_006840309.1|  hypothetical protein AMTR_s00045p00073910          134   2e-33   
gb|KHN17373.1|  Auxin response factor 8                                 129   4e-33   Glycine soja [wild soybean]
ref|XP_001768259.1|  predicted protein                                  130   6e-32   Physcomitrella patens
gb|KHN10874.1|  hypothetical protein glysoja_050265                     113   3e-28   Glycine soja [wild soybean]
gb|KHN22353.1|  Auxin response factor 8                                 109   5e-26   Glycine soja [wild soybean]
ref|XP_001769456.1|  predicted protein                                  110   3e-25   Physcomitrella patens
emb|CAN79661.1|  hypothetical protein VITISV_004325                     102   2e-22   Vitis vinifera
ref|XP_009399603.1|  PREDICTED: uncharacterized protein LOC103983964  91.7    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645321.1|  PREDICTED: uncharacterized protein At1g04910...  88.2    3e-17   Zea mays [maize]
gb|EYU18193.1|  hypothetical protein MIMGU_mgv1a018780mg              81.3    4e-16   Erythranthe guttata [common monkey flower]
gb|EYU18194.1|  hypothetical protein MIMGU_mgv1a024726mg              79.3    2e-15   Erythranthe guttata [common monkey flower]
gb|AEW09387.1|  hypothetical protein UMN_CL309Contig1_03              75.1    2e-14   Pinus lambertiana
gb|AEW09386.1|  hypothetical protein UMN_CL309Contig1_03              74.3    4e-14   Pinus radiata
ref|XP_007155670.1|  hypothetical protein PHAVU_003G221400g           66.6    2e-09   Phaseolus vulgaris [French bean]
ref|XP_010542225.1|  PREDICTED: uncharacterized protein At1g04910     66.6    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_010240213.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    3e-08   Brachypodium distachyon [annual false brome]
gb|KHG20792.1|  hypothetical protein F383_01946                       62.8    3e-08   Gossypium arboreum [tree cotton]
ref|XP_003580282.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    5e-08   Brachypodium distachyon [annual false brome]
ref|XP_007157293.1|  hypothetical protein PHAVU_002G057900g           62.4    5e-08   Phaseolus vulgaris [French bean]
ref|XP_002510658.1|  conserved hypothetical protein                   62.0    5e-08   Ricinus communis
ref|XP_004508925.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    5e-08   Cicer arietinum [garbanzo]
ref|XP_002448290.1|  hypothetical protein SORBIDRAFT_06g024620        61.6    6e-08   Sorghum bicolor [broomcorn]
ref|XP_003611321.1|  DUF246 domain-containing protein                 62.0    6e-08   Medicago truncatula
ref|XP_003550910.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    7e-08   Glycine max [soybeans]
ref|XP_004976441.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    1e-07   Setaria italica
ref|XP_010242865.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010055484.1|  PREDICTED: uncharacterized protein At1g04910     60.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_011088688.1|  PREDICTED: uncharacterized protein At1g04910     60.8    1e-07   Sesamum indicum [beniseed]
ref|XP_010933656.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    1e-07   Elaeis guineensis
ref|XP_009621470.1|  PREDICTED: uncharacterized protein LOC104113082  58.5    1e-07   Nicotiana tomentosiformis
gb|KDP39880.1|  hypothetical protein JCGZ_03411                       60.8    1e-07   Jatropha curcas
ref|XP_006440300.1|  hypothetical protein CICLE_v10019483mg           60.5    2e-07   Citrus clementina
ref|NP_001152142.1|  growth regulator like protein                    60.1    2e-07   Zea mays [maize]
tpg|DAA36552.1|  TPA: growth regulator like protein                   60.1    2e-07   Zea mays [maize]
ref|XP_003525569.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    2e-07   Glycine max [soybeans]
gb|KHN44075.1|  DUF246 domain-containing protein                      60.1    2e-07   Glycine soja [wild soybean]
ref|XP_002303356.2|  hypothetical protein POPTR_0003s07520g           60.1    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002530648.1|  conserved hypothetical protein                   59.7    3e-07   Ricinus communis
gb|KJB39735.1|  hypothetical protein B456_007G028400                  59.7    3e-07   Gossypium raimondii
ref|XP_006355513.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    3e-07   Solanum tuberosum [potatoes]
ref|XP_011001504.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    3e-07   Populus euphratica
dbj|BAK04280.1|  predicted protein                                    59.3    3e-07   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006838201.1|  hypothetical protein AMTR_s00106p00146200        59.7    3e-07   
ref|XP_004241998.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    3e-07   Solanum lycopersicum
ref|XP_011031885.1|  PREDICTED: uncharacterized protein At1g04910     59.7    4e-07   Populus euphratica
ref|XP_008796107.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    4e-07   Phoenix dactylifera
ref|XP_010242866.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010325489.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    4e-07   Solanum lycopersicum
ref|XP_010538412.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    4e-07   Tarenaya hassleriana [spider flower]
dbj|BAK05951.1|  predicted protein                                    59.3    4e-07   Hordeum vulgare subsp. vulgare [barley]
gb|KHN34931.1|  DUF246 domain-containing protein                      59.3    5e-07   Glycine soja [wild soybean]
emb|CAE75903.1|  OSJNBb0034G17.19                                     58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389009.1|  PREDICTED: uncharacterized protein At1g04910     59.3    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004245776.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    5e-07   Solanum lycopersicum
gb|EEE61454.1|  hypothetical protein OsJ_15700                        58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67151.1|  OSIGBa0122F23.8                                      58.9    5e-07   Oryza sativa Indica Group [Indian rice]
emb|CAE01682.2|  OSJNBa0010H02.2                                      58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003538741.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    5e-07   Glycine max [soybeans]
ref|XP_006369018.1|  hypothetical protein POPTR_0001s15750g           58.9    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006477177.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    5e-07   Citrus sinensis [Valencia orange]
ref|XP_010264337.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    7e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010110838.1|  hypothetical protein L484_011821                 58.5    7e-07   Morus notabilis
ref|XP_010666088.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    7e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009764467.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    7e-07   Nicotiana sylvestris
ref|XP_010264336.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    8e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010258886.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    9e-07   Nelumbo nucifera [Indian lotus]
gb|EMT06117.1|  hypothetical protein F775_26149                       58.2    9e-07   Aegilops tauschii
ref|XP_003614789.1|  Growth regulator-related protein                 58.5    9e-07   Medicago truncatula
gb|EMS68353.1|  hypothetical protein TRIUR3_18244                     58.2    9e-07   Triticum urartu
ref|XP_009615915.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    9e-07   Nicotiana tomentosiformis
ref|XP_009615914.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   Nicotiana tomentosiformis
ref|XP_006652611.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    1e-06   Oryza brachyantha
ref|XP_009604868.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   Nicotiana tomentosiformis
ref|XP_001757712.1|  predicted protein                                57.8    1e-06   Physcomitrella patens
gb|AES90897.2|  GDP-fucose O-fucosyltransferase-like protein          57.8    1e-06   Medicago truncatula
ref|XP_010677047.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB51853.1|  hypothetical protein B456_008G234600                  57.4    2e-06   Gossypium raimondii
ref|XP_010272986.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   Nelumbo nucifera [Indian lotus]
gb|KHG05427.1|  hypothetical protein F383_01689                       57.4    2e-06   Gossypium arboreum [tree cotton]
ref|XP_009768450.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   Nicotiana sylvestris
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   Glycine max [soybeans]
emb|CDP11502.1|  unnamed protein product                              57.4    2e-06   Coffea canephora [robusta coffee]
ref|XP_009793733.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   Nicotiana sylvestris
ref|XP_009591037.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Nicotiana tomentosiformis
ref|XP_010272984.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010272985.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Nelumbo nucifera [Indian lotus]
gb|KHG11598.1|  hypothetical protein F383_00648                       57.0    2e-06   Gossypium arboreum [tree cotton]
gb|KJB15940.1|  hypothetical protein B456_002G205500                  57.0    3e-06   Gossypium raimondii
gb|EYU19327.1|  hypothetical protein MIMGU_mgv1a003931mg              57.0    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_008349183.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    3e-06   
ref|XP_008383543.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    3e-06   
ref|XP_011081267.1|  PREDICTED: uncharacterized protein At1g04910     57.0    3e-06   Sesamum indicum [beniseed]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    3e-06   Citrus sinensis [Valencia orange]
ref|XP_002513963.1|  conserved hypothetical protein                   56.6    3e-06   
ref|XP_001785226.1|  predicted protein                                56.6    3e-06   Physcomitrella patens
gb|KHG15636.1|  hypothetical protein F383_08162                       56.6    3e-06   Gossypium arboreum [tree cotton]
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    3e-06   Citrus sinensis [Valencia orange]
gb|EPS71477.1|  hypothetical protein M569_03283                       55.5    3e-06   Genlisea aurea
ref|XP_006828944.1|  hypothetical protein AMTR_s00001p00225660        56.6    3e-06   Amborella trichopoda
ref|XP_002533764.1|  conserved hypothetical protein                   56.6    3e-06   Ricinus communis
ref|XP_002985325.1|  hypothetical protein SELMODRAFT_234769           56.2    4e-06   Selaginella moellendorffii
ref|XP_002970137.1|  hypothetical protein SELMODRAFT_171255           56.2    4e-06   Selaginella moellendorffii
ref|XP_003608700.1|  DUF246 domain-containing protein                 56.6    4e-06   
gb|KJB25568.1|  hypothetical protein B456_004G197900                  56.6    4e-06   Gossypium raimondii
ref|XP_008796109.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    4e-06   
ref|XP_007141089.1|  hypothetical protein PHAVU_008G166600g           56.6    4e-06   Phaseolus vulgaris [French bean]
ref|XP_009407812.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009345471.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    4e-06   Pyrus x bretschneideri [bai li]
tpg|DAA62654.1|  TPA: hypothetical protein ZEAMMB73_414326            56.2    4e-06   Zea mays [maize]
ref|NP_567509.2|  O-fucosyltransferase family protein                 56.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152623.1|  PREDICTED: DUF246 domain-containing protein ...  56.2    5e-06   Cucumis sativus [cucumbers]
ref|XP_008448833.1|  PREDICTED: uncharacterized protein At1g04910     56.2    5e-06   Cucumis melo [Oriental melon]
ref|XP_004147217.1|  PREDICTED: DUF246 domain-containing protein ...  56.2    5e-06   
gb|KEH36297.1|  GDP-fucose O-fucosyltransferase-like protein          56.2    5e-06   Medicago truncatula
tpg|DAA62653.1|  TPA: hypothetical protein ZEAMMB73_414326            55.8    5e-06   Zea mays [maize]
gb|KHN26036.1|  DUF246 domain-containing protein                      55.8    5e-06   Glycine soja [wild soybean]
ref|XP_006283475.1|  hypothetical protein CARUB_v10004523mg           56.2    5e-06   Capsella rubella
ref|XP_009777248.1|  PREDICTED: uncharacterized protein At1g04910...  55.8    5e-06   Nicotiana sylvestris
ref|XP_004957556.1|  PREDICTED: uncharacterized protein At1g04910...  55.8    5e-06   
ref|XP_009777243.1|  PREDICTED: uncharacterized protein At1g04910...  55.8    6e-06   Nicotiana sylvestris
ref|XP_002870141.1|  hypothetical protein ARALYDRAFT_493211           55.8    6e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_008238511.1|  PREDICTED: uncharacterized protein At1g04910     55.8    6e-06   Prunus mume [ume]
gb|KJB32710.1|  hypothetical protein B456_005G258400                  55.8    6e-06   Gossypium raimondii
ref|XP_007041650.1|  O-fucosyltransferase family protein              55.8    6e-06   Theobroma cacao [chocolate]
gb|EPS63860.1|  hypothetical protein M569_10923                       55.5    6e-06   Genlisea aurea
gb|KJB32709.1|  hypothetical protein B456_005G258400                  55.8    6e-06   Gossypium raimondii
gb|EYU40470.1|  hypothetical protein MIMGU_mgv1a018303mg              55.8    6e-06   Erythranthe guttata [common monkey flower]
ref|XP_009605341.1|  PREDICTED: uncharacterized protein At1g04910...  55.8    7e-06   Nicotiana tomentosiformis
gb|EYU42230.1|  hypothetical protein MIMGU_mgv1a025229mg              55.5    7e-06   Erythranthe guttata [common monkey flower]
gb|KHG11432.1|  hypothetical protein F383_07205                       55.8    7e-06   Gossypium arboreum [tree cotton]
ref|XP_004292679.1|  PREDICTED: uncharacterized protein At1g04910     55.8    7e-06   Fragaria vesca subsp. vesca
ref|XP_008805903.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    7e-06   Phoenix dactylifera
ref|XP_008355402.1|  PREDICTED: topless-related protein 1-like is...  54.7    7e-06   
gb|EMT23447.1|  hypothetical protein F775_14543                       55.5    8e-06   Aegilops tauschii
ref|XP_008805901.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   
ref|XP_008653053.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   Zea mays [maize]
ref|XP_010449737.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   Camelina sativa [gold-of-pleasure]
emb|CDY40517.1|  BnaC01g19950D                                        55.5    8e-06   Brassica napus [oilseed rape]
ref|XP_008805902.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   
ref|XP_009145647.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   
ref|XP_010266129.1|  PREDICTED: uncharacterized protein At1g04910     55.5    8e-06   
gb|KHN42692.1|  DUF246 domain-containing protein                      55.5    8e-06   
ref|XP_008344608.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    8e-06   
gb|KDO61426.1|  hypothetical protein CISIN_1g0081651mg                55.5    8e-06   
ref|XP_003516662.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    8e-06   
ref|XP_007039815.1|  O-fucosyltransferase family protein isoform 2    55.5    8e-06   
ref|XP_010434789.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    9e-06   
ref|XP_004301193.1|  PREDICTED: uncharacterized protein At1g04910     55.5    9e-06   
emb|CDP01105.1|  unnamed protein product                              55.5    9e-06   
ref|XP_007039814.1|  O-fucosyltransferase family protein isoform 1    55.5    9e-06   
ref|XP_008653052.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    9e-06   
gb|KDP36824.1|  hypothetical protein JCGZ_08115                       55.5    9e-06   
ref|XP_008355401.1|  PREDICTED: topless-related protein 1-like is...  54.7    9e-06   
ref|XP_010440121.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    9e-06   
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_011101082.1|  PREDICTED: uncharacterized protein At1g04910     55.1    1e-05   
emb|CDY53645.1|  BnaA08g30350D                                        55.1    1e-05   
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_011458084.1|  PREDICTED: uncharacterized protein At1g04910     55.1    1e-05   
ref|XP_009123029.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_009145111.1|  PREDICTED: uncharacterized protein At1g04910     55.1    1e-05   
emb|CDP09977.1|  unnamed protein product                              55.1    1e-05   
ref|XP_001753856.1|  predicted protein                                55.1    1e-05   
emb|CDX73383.1|  BnaC05g27230D                                        55.1    1e-05   
ref|NP_849755.1|  O-fucosyltransferase-like protein                   55.1    1e-05   
ref|XP_010060050.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_010646204.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    1e-05   
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg           55.1    1e-05   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg           54.7    1e-05   
ref|XP_010536455.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   
ref|XP_010315417.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   
emb|CAB10440.1|  growth regulator like protein                        55.1    1e-05   
ref|XP_010461371.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   
emb|CAE01922.2|  OSJNBb0078D11.5                                      54.7    1e-05   
gb|KDO80742.1|  hypothetical protein CISIN_1g047008mg                 53.9    1e-05   
ref|XP_008233904.1|  PREDICTED: uncharacterized protein At1g04910     54.7    1e-05   
emb|CBI37793.3|  unnamed protein product                              54.7    1e-05   
ref|XP_006434132.1|  hypothetical protein CICLE_v10000652mg           54.7    1e-05   
gb|EEC77803.1|  hypothetical protein OsI_16985                        54.7    1e-05   
ref|XP_010461373.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   
ref|NP_683362.1|  O-fucosyltransferase-like protein                   54.7    1e-05   
ref|XP_010461370.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_004231085.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
gb|EEE61496.1|  hypothetical protein OsJ_15784                        54.7    2e-05   
gb|KHG05439.1|  hypothetical protein F383_31655                       54.3    2e-05   
ref|XP_007136010.1|  hypothetical protein PHAVU_009G010300g           54.7    2e-05   
ref|XP_006472724.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_006365316.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_010314756.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_007221795.1|  hypothetical protein PRUPE_ppa003430mg           54.7    2e-05   
gb|EEE52890.1|  hypothetical protein OsJ_35473                        54.7    2e-05   
ref|XP_002267185.2|  PREDICTED: uncharacterized protein At1g04910     54.7    2e-05   
ref|NP_001066339.1|  Os12g0190100                                     54.3    2e-05   
ref|XP_004231086.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_006364527.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
ref|XP_003545060.2|  PREDICTED: uncharacterized protein At1g04910...  54.7    2e-05   
gb|KHN46874.1|  DUF246 domain-containing protein                      54.3    2e-05   
ref|XP_010315415.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_003576982.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_010471775.1|  PREDICTED: uncharacterized protein At1g04910     54.3    2e-05   
emb|CDX73250.1|  BnaC06g36980D                                        54.3    2e-05   
ref|XP_006653675.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_009344152.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
emb|CAN66567.1|  hypothetical protein VITISV_039538                   54.3    2e-05   
gb|KJB51854.1|  hypothetical protein B456_008G234600                  54.3    2e-05   
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg           54.3    2e-05   
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_009136801.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_002302312.2|  hypothetical protein POPTR_0002s10050g           54.3    2e-05   
ref|XP_010431531.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
ref|XP_006414319.1|  hypothetical protein EUTSA_v10024831mg           54.3    2e-05   
emb|CDX90501.1|  BnaA03g42800D                                        54.3    2e-05   
gb|KJB29676.1|  hypothetical protein B456_005G113300                  54.3    2e-05   
gb|KJB14307.1|  hypothetical protein B456_002G118200                  53.9    2e-05   
gb|KJB14302.1|  hypothetical protein B456_002G118200                  54.3    2e-05   
ref|XP_010692819.1|  PREDICTED: uncharacterized protein At1g04910     54.3    2e-05   
ref|XP_011034893.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    2e-05   
emb|CDY50845.1|  BnaC08g47910D                                        53.9    2e-05   
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_010918225.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.9    3e-05   
ref|XP_009106284.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
gb|KJB14306.1|  hypothetical protein B456_002G118200                  53.9    3e-05   
emb|CBI19065.3|  unnamed protein product                              53.9    3e-05   
ref|XP_009106283.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
emb|CDX87622.1|  BnaA07g32510D                                        53.9    3e-05   
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_010103337.1|  hypothetical protein L484_014377                 53.9    3e-05   
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_006645023.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_004249701.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_010066322.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_006307131.1|  hypothetical protein CARUB_v10008720mg           53.9    3e-05   
ref|XP_001765320.1|  predicted protein                                53.5    3e-05   
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                53.9    3e-05   
ref|XP_009344792.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    3e-05   
ref|XP_002460613.1|  hypothetical protein SORBIDRAFT_02g031900        53.9    3e-05   
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    3e-05   
ref|XP_008354034.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    3e-05   
emb|CBI19199.3|  unnamed protein product                              53.5    3e-05   
ref|XP_008219343.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    3e-05   
gb|KDP41419.1|  hypothetical protein JCGZ_15826                       53.5    3e-05   
ref|XP_009101946.1|  PREDICTED: uncharacterized protein At1g04910     53.5    3e-05   
ref|XP_002513766.1|  conserved hypothetical protein                   53.5    3e-05   
ref|XP_010649380.1|  PREDICTED: uncharacterized protein At1g04910     53.5    3e-05   
ref|XP_007221810.1|  hypothetical protein PRUPE_ppa004094mg           53.5    3e-05   
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_009373425.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
gb|AES59903.2|  O-fucosyltransferase family protein                   53.5    4e-05   
ref|XP_002307782.1|  hypothetical protein POPTR_0005s27130g           53.5    4e-05   
ref|XP_011041258.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_002300651.1|  hypothetical protein POPTR_0002s01230g           53.5    4e-05   
ref|XP_010539799.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_010419220.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_007018000.1|  O-fucosyltransferase family protein              53.5    4e-05   
emb|CAN71444.1|  hypothetical protein VITISV_036923                   53.5    4e-05   
gb|KCW64186.1|  hypothetical protein EUGRSUZ_G01835                   53.5    4e-05   
ref|XP_009632008.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
ref|XP_010664349.1|  PREDICTED: uncharacterized protein At1g04910     53.5    4e-05   
ref|XP_010061151.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
gb|EEC68978.1|  hypothetical protein OsI_37727                        53.1    4e-05   
ref|XP_004977171.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
ref|XP_010061150.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    4e-05   
ref|XP_006302074.1|  hypothetical protein CARUB_v10020057mg           53.5    4e-05   
gb|EMS63467.1|  hypothetical protein TRIUR3_20709                     53.5    4e-05   
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
gb|KJB25570.1|  hypothetical protein B456_004G197900                  53.1    4e-05   
gb|KJB77797.1|  hypothetical protein B456_012G158200                  53.1    4e-05   
ref|XP_007137714.1|  hypothetical protein PHAVU_009G149700g           53.1    4e-05   
ref|XP_004977170.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
ref|XP_004977168.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    4e-05   
emb|CDY29524.1|  BnaA06g14460D                                        53.1    4e-05   
gb|AAF17638.1|AC009978_14  T23E18.20                                  53.1    5e-05   
ref|XP_009627178.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_008448197.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_002889072.1|  hypothetical protein ARALYDRAFT_476779           53.1    5e-05   
gb|KJB14304.1|  hypothetical protein B456_002G118200                  53.1    5e-05   
ref|XP_004977169.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_009627177.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_009627180.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_008448199.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
emb|CDY31477.1|  BnaC05g15860D                                        53.1    5e-05   
ref|NP_565129.1|  O-fucosyltransferase-like protein                   53.1    5e-05   
ref|XP_004976498.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    5e-05   
ref|XP_009627179.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
ref|XP_009149531.1|  PREDICTED: uncharacterized protein At1g04910     53.1    5e-05   
gb|KFK42045.1|  hypothetical protein AALP_AA2G204600                  53.1    5e-05   
ref|XP_010531513.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    5e-05   
gb|AAF16673.1|AC012394_22  putative auxin-independent growth prom...  53.1    5e-05   
ref|XP_002965248.1|  hypothetical protein SELMODRAFT_63007            52.8    5e-05   
ref|XP_003576801.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    6e-05   
ref|XP_010919595.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    6e-05   
ref|XP_009334236.1|  PREDICTED: uncharacterized protein At1g04910     53.1    6e-05   
ref|XP_008377083.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    6e-05   
ref|XP_009632007.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_006285490.1|  hypothetical protein CARUB_v10006918mg           53.1    6e-05   
ref|XP_002986571.1|  hypothetical protein SELMODRAFT_43041            52.8    6e-05   
ref|XP_010446346.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_010431774.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_006390216.1|  hypothetical protein EUTSA_v10018355mg           52.8    6e-05   
ref|XP_006306299.1|  hypothetical protein CARUB_v10012165mg           52.8    6e-05   
ref|XP_009632006.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_008338786.1|  PREDICTED: uncharacterized protein At1g04910     52.8    6e-05   
ref|XP_006664407.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
gb|EMS52186.1|  hypothetical protein TRIUR3_20101                     52.8    6e-05   
ref|XP_008677206.1|  PREDICTED: auxin-independent growth promoter...  52.8    6e-05   
gb|KDP24728.1|  hypothetical protein JCGZ_25329                       52.8    6e-05   
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g           52.8    6e-05   
ref|XP_011016837.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_006581764.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_010436932.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_008235937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    6e-05   
ref|XP_011012509.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
gb|KJB65278.1|  hypothetical protein B456_010G087600                  52.8    6e-05   
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
ref|XP_008377066.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    6e-05   
gb|EMT33036.1|  hypothetical protein F775_09618                       52.8    7e-05   
ref|XP_002451572.1|  hypothetical protein SORBIDRAFT_04g004090        52.8    7e-05   
gb|KJB14305.1|  hypothetical protein B456_002G118200                  52.8    7e-05   
ref|XP_004291232.1|  PREDICTED: uncharacterized protein At1g04910     52.8    7e-05   
ref|XP_002307421.1|  hypothetical protein POPTR_0005s16060g           52.8    7e-05   
ref|XP_002441951.1|  hypothetical protein SORBIDRAFT_08g005420        52.8    7e-05   
ref|XP_003526859.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    7e-05   
gb|KCW64187.1|  hypothetical protein EUGRSUZ_G01835                   52.4    7e-05   
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    7e-05   
gb|EYU17502.1|  hypothetical protein MIMGU_mgv1a003569mg              52.8    7e-05   
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    7e-05   
gb|AFW62357.1|  auxin-independent growth promoter                     52.8    7e-05   
ref|XP_008656228.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    7e-05   
ref|XP_011016822.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    7e-05   
gb|EMT31676.1|  hypothetical protein F775_05595                       52.8    8e-05   
ref|XP_008656230.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    8e-05   
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    8e-05   
ref|XP_002445712.1|  hypothetical protein SORBIDRAFT_07g024570        52.8    8e-05   
ref|NP_001148095.1|  auxin-independent growth promoter                52.8    8e-05   
gb|ACN31634.1|  unknown                                               51.6    8e-05   
ref|XP_011097784.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    8e-05   
ref|XP_010664086.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    8e-05   
ref|XP_007222870.1|  hypothetical protein PRUPE_ppa004307mg           52.4    8e-05   
ref|XP_004951839.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    8e-05   
ref|XP_004974167.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    9e-05   
ref|XP_008656231.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    9e-05   
gb|KFK44171.1|  hypothetical protein AALP_AA1G223800                  52.4    9e-05   
ref|XP_002284838.2|  PREDICTED: uncharacterized protein At1g04910...  52.4    9e-05   
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732           52.4    9e-05   
ref|XP_001765585.1|  predicted protein                                52.4    9e-05   
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    9e-05   
ref|XP_008444860.1|  PREDICTED: uncharacterized protein At1g04910     52.4    1e-04   
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    1e-04   
gb|AFW81745.1|  hypothetical protein ZEAMMB73_945459                  52.4    1e-04   
ref|XP_008656229.1|  PREDICTED: uncharacterized protein At1g04910...  52.0    1e-04   
ref|XP_009334549.1|  PREDICTED: uncharacterized protein At1g04910     52.4    1e-04   
ref|XP_010478971.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    1e-04   
ref|XP_003522491.1|  PREDICTED: uncharacterized protein At1g04910...  52.0    1e-04   



>ref|XP_009594206.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=403

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSCQGN + RSKSC+ PQEIA FLRKLGFN  TTIYLTQ+RWDSSLD
Sbjct  240  FIAVDLRVDILEKKSCQGNSASRSKSCFGPQEIAMFLRKLGFNKDTTIYLTQSRWDSSLD  299

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFP+TYTKESIMPIDKKA+FLD + SELEKVID ++CS+SDVFVPAISGLFYANVA
Sbjct  300  ALKDLFPRTYTKESIMPIDKKARFLDTENSELEKVIDFHMCSQSDVFVPAISGLFYANVA  359

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI+ SSASLTD+ISHYVSK+NHFAYSCFC
Sbjct  360  GKRIASGKTQILVPADISGSSASLTDYISHYVSKRNHFAYSCFC  403



>ref|XP_009786113.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=403

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSCQGN   RSKSC+ PQEIA FLRKLGFN  TTIYLTQ+RWDSSLD
Sbjct  240  FIAVDLRVDILEKKSCQGNSGSRSKSCFGPQEIAMFLRKLGFNKDTTIYLTQSRWDSSLD  299

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFP+TYTKESIMPIDKKA+FLD + SELEKVID ++CS+SDVFVPAISGLFYANVA
Sbjct  300  ALKDLFPRTYTKESIMPIDKKARFLDTENSELEKVIDFHMCSQSDVFVPAISGLFYANVA  359

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI+ SSASLTD+ISHYVSK+NHFAYSCFC
Sbjct  360  GKRIASGKTQILVPADISGSSASLTDYISHYVSKRNHFAYSCFC  403



>ref|XP_006357439.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=405

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSCQG+ S +SKSCY P+EI  FLRK+GFN  TT+YLTQ+RWDSSLD
Sbjct  242  FIAVDLRVDILEKKSCQGDSSLKSKSCYGPEEIGMFLRKIGFNKDTTLYLTQSRWDSSLD  301

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFPKTYTKESIMPIDKKAKFLD+++SELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  302  ALKDLFPKTYTKESIMPIDKKAKFLDSESSELEKVIDFYMCSESDVFVPAISGLFYANVA  361

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+LTD+ISHYVSKKNHFAYSCFC
Sbjct  362  GKRIASGKTQILVPADIPGSSAALTDYISHYVSKKNHFAYSCFC  405



>ref|XP_006357438.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=406

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSCQG+ S +SKSCY P+EI  FLRK+GFN  TT+YLTQ+RWDSSLD
Sbjct  243  FIAVDLRVDILEKKSCQGDSSLKSKSCYGPEEIGMFLRKIGFNKDTTLYLTQSRWDSSLD  302

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFPKTYTKESIMPIDKKAKFLD+++SELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  303  ALKDLFPKTYTKESIMPIDKKAKFLDSESSELEKVIDFYMCSESDVFVPAISGLFYANVA  362

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+LTD+ISHYVSKKNHFAYSCFC
Sbjct  363  GKRIASGKTQILVPADIPGSSAALTDYISHYVSKKNHFAYSCFC  406



>ref|XP_004241868.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=406

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL KKSCQG+ S +SKSCY P+EI  FLRK+GFN  TT+YLTQ+RWDSSLD
Sbjct  243  FVAVDLRVDILEKKSCQGDSSLKSKSCYGPEEIGMFLRKIGFNKDTTLYLTQSRWDSSLD  302

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFPKTYTKESIMPIDKKAKFLD+++SELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  303  ALKDLFPKTYTKESIMPIDKKAKFLDSESSELEKVIDFYMCSESDVFVPAISGLFYANVA  362

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+ TD+ISHYVSKKNHFAYSCFC
Sbjct  363  GKRIASGKTQILVPADIPGSSAASTDYISHYVSKKNHFAYSCFC  406



>ref|XP_010322803.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=405

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL KKSCQG+ S +SKSCY P+EI  FLRK+GFN  TT+YLTQ+RWDSSLD
Sbjct  242  FVAVDLRVDILEKKSCQGDSSLKSKSCYGPEEIGMFLRKIGFNKDTTLYLTQSRWDSSLD  301

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFPKTYTKESIMPIDKKAKFLD+++SELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  302  ALKDLFPKTYTKESIMPIDKKAKFLDSESSELEKVIDFYMCSESDVFVPAISGLFYANVA  361

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+ TD+ISHYVSKKNHFAYSCFC
Sbjct  362  GKRIASGKTQILVPADIPGSSAASTDYISHYVSKKNHFAYSCFC  405



>ref|XP_009765354.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=408

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDILGKKSCQGN + +SKSCY P+EI  FL K+GFN  TT+YLTQ+RWDSSLD
Sbjct  245  FIAVDLRVDILGKKSCQGNSALKSKSCYGPEEIGVFLSKVGFNKDTTLYLTQSRWDSSLD  304

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFPKTYTKESIMPIDKKAKFLD++++ELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  305  ALKDLFPKTYTKESIMPIDKKAKFLDSESTELEKVIDFYMCSESDVFVPAISGLFYANVA  364

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+LTD+ISHYV+KKNHF YSCFC
Sbjct  365  GKRIASGKTQILVPADIPGSSAALTDYISHYVTKKNHFTYSCFC  408



>ref|XP_009587135.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=408

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL +KSCQGN + +SKSCY P+EI  FLRK+GFN+ TT+YLTQ+RWDSSLD
Sbjct  245  FIAVDLRVDILERKSCQGNSALKSKSCYGPEEIGVFLRKVGFNTDTTLYLTQSRWDSSLD  304

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK LFPKTYTKESIMPIDKKAKFLD++++ELEKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  305  ALKNLFPKTYTKESIMPIDKKAKFLDSESTELEKVIDFYMCSESDVFVPAISGLFYANVA  364

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  SSA+LTD+ISHYV+KKNHF+YSCFC
Sbjct  365  GKRIASGKTQILVPADIPGSSAALTDYISHYVTKKNHFSYSCFC  408



>ref|XP_006342865.1| PREDICTED: uncharacterized protein LOC102606164 [Solanum tuberosum]
Length=402

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK CQGN + +SKSCY PQEIA FLRK+GFN  TTIYLTQ+RWD+SLD
Sbjct  239  FIAVDLRVDMLEKKGCQGNSASKSKSCYGPQEIAMFLRKIGFNKDTTIYLTQSRWDNSLD  298

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFP+TYTKESIMP+DKKA+FLD + SE+EKVID Y+CSESDVFVPAISGLFYANVA
Sbjct  299  ALKDLFPRTYTKESIMPMDKKARFLDMENSEVEKVIDFYMCSESDVFVPAISGLFYANVA  358

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPA I+ SSAS TD+ISHYVSKKNHFAYSCFC
Sbjct  359  GKRIASGKTQILVPAHISGSSASSTDYISHYVSKKNHFAYSCFC  402



>emb|CDO97753.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KK CQG+G+ RSKSCY P+E+A FLRK+GF+  TT+YLTQ+RWDSSLD
Sbjct  257  FIAVDLRVDILEKKGCQGSGTSRSKSCYGPREVALFLRKIGFDKDTTLYLTQSRWDSSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+ FPKTYTKE IMP DKK +FLD++ASELEKVID YI +ESDVFVPAISGLFYANVA
Sbjct  317  ALKDFFPKTYTKEGIMPADKKERFLDSEASELEKVIDFYISTESDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RIASG+T+ILVPA I  SSAS  D +SHYV+K+NHFAYSCFC
Sbjct  377  GQRIASGRTRILVPAKIPGSSASSADFMSHYVTKRNHFAYSCFC  420



>ref|XP_011072734.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=413

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR+DIL KK C GNG   SKSCY PQEIA FL+K+GF   TT+Y+TQT+W SSLD
Sbjct  250  FVAVDLRIDILEKKGCHGNGGSASKSCYGPQEIALFLKKIGFEKDTTVYVTQTKWHSSLD  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+ FPKTYTKESIMP++KK KFL++D SE EKVID YICSESDVFVPAISGLFYANVA
Sbjct  310  ALKDFFPKTYTKESIMPMEKKDKFLNSDTSEFEKVIDYYICSESDVFVPAISGLFYANVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQ+LVPA I  SSA+  + +SHYV+KKNHFAYSC+C
Sbjct  370  GKRIASGRTQMLVPATIPGSSATSEEFMSHYVTKKNHFAYSCYC  413



>gb|KDP34445.1| hypothetical protein JCGZ_11916 [Jatropha curcas]
Length=421

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSC G+ +  +K+CYS QEIA FLRK+GF+  TTIYLTQ+RWD SLD
Sbjct  258  FIAVDLRVDILEKKSCHGSDAGAAKNCYSAQEIALFLRKIGFDKDTTIYLTQSRWDESLD  317

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKK KFL+++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  318  VLKDIFPKTYTKESIMPEDKKTKFLESEDSEFEKVIDFYLCSQSDVFVPAISGLFYANVA  377

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPA+I  +SAS+T+H S Y+SKKNH AYSCFC
Sbjct  378  GKRIASGKTQILVPANIPGTSASVTNHFSPYISKKNHLAYSCFC  421



>ref|XP_002528288.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34090.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F++VDLRV+IL KKSC G+G   +K+CYS QEIA FLRK+GF+  T IYLTQ+RWD SL+
Sbjct  258  FISVDLRVEILEKKSCHGSGGGGAKTCYSAQEIALFLRKIGFDKDTAIYLTQSRWDDSLN  317

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKK KFL ++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  318  VLKDIFPKTYTKESIMPEDKKTKFLQSEDSEFEKVIDFYMCSQSDVFVPAISGLFYANVA  377

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA+GKTQILVPADI  SSAS+T+H S Y+SKKNH AYSCFC
Sbjct  378  GKRIAAGKTQILVPADIPGSSASVTNHFSPYISKKNHLAYSCFC  421



>ref|XP_007023804.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY26426.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=422

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL  K+C G+GS  +KSCY+ QEIA FLRK+GF++ TTIYLTQ+RWDSSL 
Sbjct  259  FIAVDLRVEILENKNCHGSGSTGAKSCYNAQEIALFLRKVGFDTDTTIYLTQSRWDSSLS  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP +KK KFL+++ SE EKVID YICS+SDVFVPAISGLFYANVA
Sbjct  319  VLKDIFPKTYTKESIMPEEKKGKFLESEDSEFEKVIDFYICSQSDVFVPAISGLFYANVA  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGK QILVPADI  +SA++T+++S YVSKKNH AYSCFC
Sbjct  379  GKRIASGKPQILVPADIPGTSAAITNYLSPYVSKKNHLAYSCFC  422



>ref|XP_007142132.1| hypothetical protein PHAVU_008G255300g [Phaseolus vulgaris]
 gb|ESW14126.1| hypothetical protein PHAVU_008G255300g [Phaseolus vulgaris]
Length=417

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRV++L KK CQG+   + KSC++PQE+A FLRK+GF+  TTIY+TQ+RWD SLD
Sbjct  254  FVAVDLRVEMLDKKGCQGSDGDKEKSCFNPQEVAVFLRKIGFDKDTTIYVTQSRWDESLD  313

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKESI+P DKK KFLD+  SELEKVID YI SES+VFVPAISGLFYANVA
Sbjct  314  SLKDLFPKTYTKESIIPADKKKKFLDSKDSELEKVIDFYISSESNVFVPAISGLFYANVA  373

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK+QILVPA+I  SSAS +  +SHYVSKKNHFAYSC+C
Sbjct  374  GKRIGSGKSQILVPANIPDSSASASRFLSHYVSKKNHFAYSCYC  417



>gb|KJB66472.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=274

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+C G+G+  +KSCY+ QEIA FLRK+GFN+ TTIYLTQ++WD+SL 
Sbjct  111  FIAVDLRVDVLENKNCHGSGTNVAKSCYNAQEIALFLRKVGFNTDTTIYLTQSKWDNSLS  170

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP +KK KFL+ + SELEKVID YICS+SDVFVPA+SGLFYANVA
Sbjct  171  VLKDIFPKTYTKENIMPEEKKGKFLEFEGSELEKVIDFYICSKSDVFVPALSGLFYANVA  230

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPADI  +SA++T+++S YV+KKNH AYSCFC
Sbjct  231  GKRIALGKPQILVPADIPGTSATVTNYLSPYVAKKNHLAYSCFC  274



>ref|XP_006379398.1| hypothetical protein POPTR_0008s00860g [Populus trichocarpa]
 gb|ABK93128.1| unknown [Populus trichocarpa]
 gb|ERP57195.1| hypothetical protein POPTR_0008s00860g [Populus trichocarpa]
Length=421

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL KK C G+ S  +KSC+S QEIA FLRK+GF+  TTIYLTQ RWD SLD
Sbjct  257  FIAVDLRVEILEKKGCHGSSSAGTKSCFSAQEIAIFLRKMGFDKDTTIYLTQPRWDESLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKKAKFL+++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  317  VLKDIFPKTYTKESIMPADKKAKFLESEDSEFEKVIDFYMCSQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVP+DI  SSA++T H S Y+SKKNH A+SC+C
Sbjct  377  GKRIASGKTQILVPSDIPGSSAAVTSHFSPYISKKNHMAHSCYC  420



>ref|XP_002316445.2| hypothetical protein POPTR_0010s25710g [Populus trichocarpa]
 gb|EEF02616.2| hypothetical protein POPTR_0010s25710g [Populus trichocarpa]
Length=420

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL KK C G+ +  +KSC+S QEIA FLRK+GF   TTIYLTQ RWD SLD
Sbjct  257  FIAVDLRVEILDKKGCHGSSATGTKSCFSAQEIAIFLRKIGFGKDTTIYLTQPRWDESLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESI+P DKKAKFL+++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  317  VLKDIFPKTYTKESILPADKKAKFLESEDSEFEKVIDFYMCSQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  +S+S+T+H S Y+SKKNH A+SCFC
Sbjct  377  GKRIASGKTQILVPADIPGTSSSVTNHFSPYISKKNHMAHSCFC  420



>gb|KJB66473.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=314

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+C G+G+  +KSCY+ QEIA FLRK+GFN+ TTIYLTQ++WD+SL 
Sbjct  151  FIAVDLRVDVLENKNCHGSGTNVAKSCYNAQEIALFLRKVGFNTDTTIYLTQSKWDNSLS  210

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP +KK KFL+ + SELEKVID YICS+SDVFVPA+SGLFYANVA
Sbjct  211  VLKDIFPKTYTKENIMPEEKKGKFLEFEGSELEKVIDFYICSKSDVFVPALSGLFYANVA  270

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPADI  +SA++T+++S YV+KKNH AYSCFC
Sbjct  271  GKRIALGKPQILVPADIPGTSATVTNYLSPYVAKKNHLAYSCFC  314



>ref|XP_011033030.1| PREDICTED: uncharacterized protein LOC105131655 [Populus euphratica]
Length=421

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL KK C G+ S  +KSC+S QEIA FLRK+GF+  TTIYLTQ RWD SLD
Sbjct  257  FIAVDLRVEILEKKGCHGSSSAGTKSCFSAQEIAIFLRKMGFDKDTTIYLTQPRWDESLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK+ FPKTYTKESIMP DKKAKFL+++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  317  VLKDRFPKTYTKESIMPADKKAKFLESEDSEFEKVIDFYMCSQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVP+DI  SSAS+T H S Y+SKKNH A+SC+C
Sbjct  377  GKRIASGKTQILVPSDIPGSSASVTSHFSPYISKKNHVAHSCYC  420



>ref|XP_011046520.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=420

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL KK C G+ +  +KSC+S QEIA FLRK+GF   TTIYLTQ RWD SLD
Sbjct  257  FIAVDLRVEILDKKGCHGSSATGTKSCFSAQEIAIFLRKIGFGKDTTIYLTQPRWDESLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESI+P DKKAKFL+++ SE EKVID Y+CS+SDVFVPAISGLFYANVA
Sbjct  317  VLKDIFPKTYTKESILPADKKAKFLESEDSEFEKVIDFYMCSQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPADI  +S+S+T+H S Y+SKKNH A+SCFC
Sbjct  377  GKRIASGKTQILVPADIPGTSSSVTNHFSPYISKKNHLAHSCFC  420



>gb|KJB66474.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=395

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+C G+G+  +KSCY+ QEIA FLRK+GFN+ TTIYLTQ++WD+SL 
Sbjct  232  FIAVDLRVDVLENKNCHGSGTNVAKSCYNAQEIALFLRKVGFNTDTTIYLTQSKWDNSLS  291

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP +KK KFL+ + SELEKVID YICS+SDVFVPA+SGLFYANVA
Sbjct  292  VLKDIFPKTYTKENIMPEEKKGKFLEFEGSELEKVIDFYICSKSDVFVPALSGLFYANVA  351

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPADI  +SA++T+++S YV+KKNH AYSCFC
Sbjct  352  GKRIALGKPQILVPADIPGTSATVTNYLSPYVAKKNHLAYSCFC  395



>gb|EYU21223.1| hypothetical protein MIMGU_mgv1a007275mg [Erythranthe guttata]
Length=412

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL KKSC       SKSCYSPQE+A FL+K+GF   TT+Y+TQT+W SSLD
Sbjct  249  FVAVDLRVDILEKKSCLKISGSGSKSCYSPQEVAIFLKKIGFGKDTTVYVTQTKWHSSLD  308

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+ FP+TYTKE +MP++KK KFLD+++SE +KVID YICSESDVFVPAISGLFYANVA
Sbjct  309  ALKDFFPRTYTKEFLMPMEKKDKFLDSESSEFQKVIDYYICSESDVFVPAISGLFYANVA  368

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RIASG+TQILVPA+I  SSA+  + +SHYVSKKNHFAYSCFC
Sbjct  369  GRRIASGQTQILVPANIPTSSAASEEFLSHYVSKKNHFAYSCFC  412



>gb|KHG26733.1| hypothetical protein F383_08102 [Gossypium arboreum]
Length=422

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV IL  K+C G+GS R+KSCY+ QEIA FLRK+GF++ TTIYLTQ+RWD+SL 
Sbjct  259  FIAVDLRVGILENKNCHGSGSARAKSCYNAQEIALFLRKVGFDTDTTIYLTQSRWDNSLS  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             L+++FPKTYTKES+MP +KK KFL+++ SE EKVID +ICS+SDVFVPAISGLFYANVA
Sbjct  319  VLRDIFPKTYTKESVMPDEKKGKFLESEDSEFEKVIDFHICSQSDVFVPAISGLFYANVA  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGK QILVPADI  +SA +T+++S YV+K+NH AYSCFC
Sbjct  379  GKRIASGKPQILVPADIPGTSAPITNYLSPYVAKRNHLAYSCFC  422



>gb|KJB56404.1| hypothetical protein B456_009G118400 [Gossypium raimondii]
Length=422

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL  K+C G+GS R+K+CY+ QEIA FLRK+GF++ TTIYLTQ+RWD+SL 
Sbjct  259  FIAVDLRVEILENKNCHGSGSARAKNCYNAQEIALFLRKVGFDTDTTIYLTQSRWDNSLG  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             L+++FPKTYTKE +MP +KK KFL+++ SE EKVID +ICS+SDVFVPAISGLFYANVA
Sbjct  319  VLRDIFPKTYTKERVMPDEKKGKFLESEDSEFEKVIDFHICSQSDVFVPAISGLFYANVA  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGK QILVPADI A+SA +T+++S YV+K+NH AYSCFC
Sbjct  379  GKRIASGKPQILVPADIPATSAPITNYLSPYVAKRNHLAYSCFC  422



>gb|KJB66475.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
 gb|KJB66476.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=422

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+C G+G+  +KSCY+ QEIA FLRK+GFN+ TTIYLTQ++WD+SL 
Sbjct  259  FIAVDLRVDVLENKNCHGSGTNVAKSCYNAQEIALFLRKVGFNTDTTIYLTQSKWDNSLS  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP +KK KFL+ + SELEKVID YICS+SDVFVPA+SGLFYANVA
Sbjct  319  VLKDIFPKTYTKENIMPEEKKGKFLEFEGSELEKVIDFYICSKSDVFVPALSGLFYANVA  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPADI  +SA++T+++S YV+KKNH AYSCFC
Sbjct  379  GKRIALGKPQILVPADIPGTSATVTNYLSPYVAKKNHLAYSCFC  422



>ref|NP_001239923.1| uncharacterized protein LOC100813879 [Glycine max]
 gb|ACU20870.1| unknown [Glycine max]
Length=415

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQG+ S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  252  FIAVDLRVEMLNKKGCQGSDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  311

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKESI+P DKK KFLD++ SELEKVID YI SESDVFVPAISGLFYANVA
Sbjct  312  SLKDLFPKTYTKESIIPADKKKKFLDSEDSELEKVIDFYISSESDVFVPAISGLFYANVA  371

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK+QILVPA+I  SSAS +  +SHYVSKKNHFAYSC+C
Sbjct  372  GKRIGSGKSQILVPANIPDSSASASSFLSHYVSKKNHFAYSCYC  415



>ref|XP_009349642.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=420

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL KK CQG    R+KSCY+ QEIA FLRKLGF   TTIYLT+++WDSSLD
Sbjct  257  FVAVDLRVDILEKKGCQGGDETRTKSCYNAQEIALFLRKLGFAKDTTIYLTESKWDSSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+K+LD+  SE EK+ID Y+C++SDVFVPAISGLFYANVA
Sbjct  317  ALKDIFPKTYIKDGIIPADKKSKYLDSKGSEFEKIIDFYVCAQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RIAS KTQILVPADI  +SAS +  I+HYVSKKNH AYSC+C
Sbjct  377  GERIASSKTQILVPADIPDASASASKFITHYVSKKNHLAYSCYC  420



>ref|XP_010696090.1| PREDICTED: uncharacterized protein LOC104908654 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVD+L KK C+      SKSCY+  EIA FLRKLGF   TTIYLTQ+RWDSSLD
Sbjct  285  FVAVDLRVDVLEKKGCKDKAGSGSKSCYNAGEIATFLRKLGFGKDTTIYLTQSRWDSSLD  344

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LKELFPKTYTKE IMP+DKK +FL+ +A  LE+V+D +ICSESDVFVPAISGLFYAN A
Sbjct  345  ALKELFPKTYTKEGIMPMDKKDQFLNPEAPTLEEVVDFHICSESDVFVPAISGLFYANAA  404

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RI++GKTQILVPADI+ASSAS   ++SHYV+K+NH AYSC+C
Sbjct  405  GRRISTGKTQILVPADISASSASPDKYLSHYVTKQNHLAYSCYC  448



>ref|XP_010696089.1| PREDICTED: uncharacterized protein LOC104908654 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=450

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVD+L KK C+      SKSCY+  EIA FLRKLGF   TTIYLTQ+RWDSSLD
Sbjct  286  FVAVDLRVDVLEKKGCKDKAGSGSKSCYNAGEIATFLRKLGFGKDTTIYLTQSRWDSSLD  345

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LKELFPKTYTKE IMP+DKK +FL+ +A  LE+V+D +ICSESDVFVPAISGLFYAN A
Sbjct  346  ALKELFPKTYTKEGIMPMDKKDQFLNPEAPTLEEVVDFHICSESDVFVPAISGLFYANAA  405

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RI++GKTQILVPADI+ASSAS   ++SHYV+K+NH AYSC+C
Sbjct  406  GRRISTGKTQILVPADISASSASPDKYLSHYVTKQNHLAYSCYC  449



>gb|KHN38079.1| DUF246 domain-containing protein [Glycine soja]
Length=415

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQG+ S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  252  FIAVDLRVEMLNKKGCQGSDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  311

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKESI+P DKK KFLD++ SELEKVID YI SESDVFVPAISGLFYANVA
Sbjct  312  SLKDLFPKTYTKESIIPADKKKKFLDSEDSELEKVIDFYISSESDVFVPAISGLFYANVA  371

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK+QILVPA+I  SSAS +  +SHYVS+KNHFAYSC+C
Sbjct  372  GKRIGSGKSQILVPANIPDSSASASSFLSHYVSEKNHFAYSCYC  415



>ref|XP_010110886.1| hypothetical protein L484_004969 [Morus notabilis]
 gb|EXC28839.1| hypothetical protein L484_004969 [Morus notabilis]
Length=420

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRV++L  K C+G+G   +K CYS +EIA FL+KLGFN  TT+YLT+++WDSSLD
Sbjct  257  FVAVDLRVELLEHKGCRGDGESGTKICYSAEEIASFLKKLGFNKDTTVYLTESKWDSSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK++FPKTYTK+ I+P DKK K LD++ SE EKV+D Y+CS+SDVFVPAISGLFY+NVA
Sbjct  317  SLKDVFPKTYTKDGIIPADKKTKILDSETSEFEKVVDFYVCSQSDVFVPAISGLFYSNVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPA I  SSA  TD ++HYVSKKNH AYSCFC
Sbjct  377  GKRIASGKTQILVPAYIPDSSALATDFVTHYVSKKNHLAYSCFC  420



>ref|XP_004303832.1| PREDICTED: uncharacterized protein LOC101293906 [Fragaria vesca 
subsp. vesca]
Length=417

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRV++L +  CQG+ S  +KSCY+PQEIA FLRK+GF   TTIY+T+++WDSSLD
Sbjct  255  FVAVDLRVEMLEQNGCQGDESG-TKSCYNPQEIALFLRKIGFGKDTTIYVTESKWDSSLD  313

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+KFLD++ SE EK+ID Y+CS+SDVFVPAISGLFYANVA
Sbjct  314  NLKDIFPKTYIKDGIVPADKKSKFLDSEGSEYEKIIDYYVCSQSDVFVPAISGLFYANVA  373

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIAS KT+ILVPADI+ SSAS  + I+HYVSKKNH AYSCFC
Sbjct  374  GKRIASSKTEILVPADISGSSASAANFITHYVSKKNHMAYSCFC  417



>ref|XP_010034072.1| PREDICTED: uncharacterized protein LOC104423261 [Eucalyptus grandis]
 gb|KCW53954.1| hypothetical protein EUGRSUZ_J03159 [Eucalyptus grandis]
Length=416

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+CQG     +KSC+  QE+++FL+K+G +  TTIYLTQ+RWDSSL+
Sbjct  258  FLAVDLRVDMLENKNCQG-----TKSCFGTQEVSEFLQKIGIDKDTTIYLTQSRWDSSLN  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+ FPKTYTKE IMP+DKK+KFLD++ SE EKVID YICS+SD+FVPAISGLFYANVA
Sbjct  313  ALKKFFPKTYTKEGIMPVDKKSKFLDSEGSEYEKVIDYYICSQSDIFVPAISGLFYANVA  372

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G RIASGKTQILVPA+I  SSAS  ++IS YVSKKNH AYSCFC
Sbjct  373  GNRIASGKTQILVPANIEGSSASAANYISTYVSKKNHLAYSCFC  416



>ref|XP_003529532.1| PREDICTED: uncharacterized protein At1g04910 [Glycine max]
Length=416

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQG  S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  253  FIAVDLRVEMLDKKGCQGRDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKESI+P DKK ++LD++ SELEKVID YI SESDVFVPAISGLFYANVA
Sbjct  313  SLKDLFPKTYTKESIIPADKKKRYLDSEDSELEKVIDFYISSESDVFVPAISGLFYANVA  372

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK+QILVPA+I  SSAS +  +SHYVSKKNHFAYSC+C
Sbjct  373  GKRIGSGKSQILVPANIPDSSASASSFLSHYVSKKNHFAYSCYC  416



>gb|KHN39355.1| DUF246 domain-containing protein [Glycine soja]
Length=416

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQG  S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  253  FIAVDLRVEMLDKKGCQGRDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKESI+P DKK ++LD++ SELEKVID YI SESDVFVPAISGLFYANVA
Sbjct  313  SLKDLFPKTYTKESIIPADKKKRYLDSEDSELEKVIDFYISSESDVFVPAISGLFYANVA  372

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK+QILVPA+I  SSAS +  +SHYVSKKNHFAYSC+C
Sbjct  373  GKRIGSGKSQILVPANIPDSSASASSFLSHYVSKKNHFAYSCYC  416



>ref|XP_009333975.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=420

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL K  CQG     +KSCY+ QEIA FLRKLGF   TTIYLT+++WDSSLD
Sbjct  257  FVAVDLRVDILEKNGCQGGDESGTKSCYNAQEIALFLRKLGFAKDTTIYLTESKWDSSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+K+LD++ SE EK+ID Y+C++SDVFVPAISGLFYANVA
Sbjct  317  ALKDIFPKTYIKDGIIPADKKSKYLDSEGSEFEKIIDFYVCAQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI S KTQILVPADI  +SAS +  I+HYVSKKNH AY+C+C
Sbjct  377  GKRITSSKTQILVPADIPGASASPSKFITHYVSKKNHLAYACYC  420



>ref|XP_008353648.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=420

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRVDIL KK CQG     +KSCY+ QEIA FLRKLGF   TTIYLT+++WDSSLD
Sbjct  257  FVAVDLRVDILEKKGCQGGDETGTKSCYNAQEIALFLRKLGFAKDTTIYLTESKWDSSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+K+L ++ SE EK+ID Y+C++SDVFVPAISGLFYANVA
Sbjct  317  ALKDIFPKTYIKDGIIPADKKSKYLGSEGSEFEKIIDFYVCAQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIAS KTQILVPADI  +SAS +   +HYVSKKNH AYSC+C
Sbjct  377  GKRIASSKTQILVPADIPDASASASKFXTHYVSKKNHLAYSCYC  420



>ref|XP_008365624.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=420

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FV+VDLRVDIL K  CQG     +KSCY+ QEIA FLRKLGF   TTIYLT+++WD SLD
Sbjct  257  FVSVDLRVDILEKNGCQGGDESGTKSCYNAQEIALFLRKLGFAKDTTIYLTESKWDGSLD  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+K+LD++ SE EK+ID Y+C++SDVFVPAISGLFYANVA
Sbjct  317  ALKDIFPKTYIKDGIIPADKKSKYLDSEGSEFEKIIDFYVCAQSDVFVPAISGLFYANVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIAS KTQILVPADI  +SAS +  I+HYVSKKNH AY+C+C
Sbjct  377  GKRIASSKTQILVPADIPGASASPSKFITHYVSKKNHLAYACYC  420



>gb|KHG06209.1| hypothetical protein F383_32398 [Gossypium arboreum]
Length=422

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L  K+C G+G+  +KSCY+ QEIA FLRK+GF++ TTIYLTQ++WD+SL 
Sbjct  259  FIAVDLRVDVLENKNCHGSGTNVAKSCYNAQEIALFLRKVGFDTDTTIYLTQSKWDNSLS  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP +KK KFL+ + SELEKVID YICS+SDVFVPA+SGLFYANV 
Sbjct  319  VLKDIFPKTYTKENIMPEEKKGKFLEFEGSELEKVIDFYICSKSDVFVPALSGLFYANVV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPADI  +SA++ ++++ YV+KKNH AYSCFC
Sbjct  379  GKRIALGKPQILVPADIPGTSAAVMNYLAPYVAKKNHLAYSCFC  422



>gb|AFK36313.1| unknown [Lotus japonicus]
 gb|AFK41654.1| unknown [Lotus japonicus]
Length=210

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 3/164 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ +G    KSC++ QE+A FLRK+GF   TT+Y+TQ+RWDS LD
Sbjct  50   FIAVDLRVEMLDKKGCQDSGE---KSCFNAQEVAMFLRKVGFEKDTTVYVTQSRWDSRLD  106

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+I+P DKK+KFLD+  SELEKVID YI SESDVFVPAISGL YANVA
Sbjct  107  SLKDLFPKTYTKEAIVPADKKSKFLDSQDSELEKVIDFYISSESDVFVPAISGLLYANVA  166

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKTQILVPADI  SSAS +  +S Y+SKKNHFAYSCFC
Sbjct  167  GKRIGSGKTQILVPADIPDSSASASSFLSSYISKKNHFAYSCFC  210



>gb|KDO45579.1| hypothetical protein CISIN_1g014966mg [Citrus sinensis]
Length=408

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC-QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRVD+L  K C +GNG    KSCY   EIA FLRK+G++  TTIYLTQ+RWDSSL
Sbjct  247  FIAVDLRVDLLDNKGCHEGNGR---KSCYGAHEIAVFLRKIGYDKDTTIYLTQSRWDSSL  303

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK++FPKTYTKE+IMP DKK KFLD+  SE EKVID Y+CS+SD FVPAISGLFYANV
Sbjct  304  SVLKDIFPKTYTKENIMPADKKEKFLDSADSEFEKVIDFYLCSQSDAFVPAISGLFYANV  363

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRIASGK QIL+PADI+ SSAS TD IS YV KKNH A+SCFC
Sbjct  364  AGKRIASGKNQILIPADISGSSASATDFISPYVLKKNHMAHSCFC  408



>gb|KDO45578.1| hypothetical protein CISIN_1g014966mg [Citrus sinensis]
Length=415

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC-QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRVD+L  K C +GNG    KSCY   EIA FLRK+G++  TTIYLTQ+RWDSSL
Sbjct  254  FIAVDLRVDLLDNKGCHEGNGR---KSCYGAHEIAVFLRKIGYDKDTTIYLTQSRWDSSL  310

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK++FPKTYTKE+IMP DKK KFLD+  SE EKVID Y+CS+SD FVPAISGLFYANV
Sbjct  311  SVLKDIFPKTYTKENIMPADKKEKFLDSADSEFEKVIDFYLCSQSDAFVPAISGLFYANV  370

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRIASGK QIL+PADI+ SSAS TD IS YV KKNH A+SCFC
Sbjct  371  AGKRIASGKNQILIPADISGSSASATDFISPYVLKKNHMAHSCFC  415



>ref|XP_006427747.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
 gb|ESR40987.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
Length=408

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC-QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F++VDLRVD+L  K C +GNG    KSCY   EIA FLRK+G++  TTIYLTQ+RWDSSL
Sbjct  247  FISVDLRVDLLDNKGCHEGNGR---KSCYGAHEIAVFLRKIGYDKDTTIYLTQSRWDSSL  303

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK++FPKTYTKE+IMP DKK KFLD+  SE EKVID Y+CS+SD FVPAISGLFYANV
Sbjct  304  SVLKDIFPKTYTKENIMPADKKEKFLDSADSEFEKVIDFYLCSQSDAFVPAISGLFYANV  363

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRIASGK QIL+PADI+ SSAS TD IS YV KKNH A+SCFC
Sbjct  364  AGKRIASGKNQILIPADISGSSASATDFISPYVLKKNHMAHSCFC  408



>ref|XP_006492037.1| PREDICTED: uncharacterized protein LOC102630315 [Citrus sinensis]
Length=415

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC-QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRVD+L  K C +GNG    KSCY   EIA FLRK+G++  TTIYLTQ+RWDSSL
Sbjct  254  FIAVDLRVDLLDNKGCHEGNGR---KSCYGAHEIAVFLRKIGYDKDTTIYLTQSRWDSSL  310

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK++FPKTYTKE+I P DKK KFLD++ SE EKVID Y+CS+SD FVPAISGLFYANV
Sbjct  311  SVLKDIFPKTYTKENITPADKKEKFLDSEDSEFEKVIDFYLCSQSDAFVPAISGLFYANV  370

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRIASGK QILVPADI+ SSAS TD IS YV KKNH A+SCFC
Sbjct  371  AGKRIASGKNQILVPADISGSSASATDFISPYVLKKNHMAHSCFC  415



>ref|XP_006427746.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
 gb|ESR40986.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
Length=415

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC-QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F++VDLRVD+L  K C +GNG    KSCY   EIA FLRK+G++  TTIYLTQ+RWDSSL
Sbjct  254  FISVDLRVDLLDNKGCHEGNGR---KSCYGAHEIAVFLRKIGYDKDTTIYLTQSRWDSSL  310

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK++FPKTYTKE+IMP DKK KFLD+  SE EKVID Y+CS+SD FVPAISGLFYANV
Sbjct  311  SVLKDIFPKTYTKENIMPADKKEKFLDSADSEFEKVIDFYLCSQSDAFVPAISGLFYANV  370

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRIASGK QIL+PADI+ SSAS TD IS YV KKNH A+SCFC
Sbjct  371  AGKRIASGKNQILIPADISGSSASATDFISPYVLKKNHMAHSCFC  415



>ref|XP_010545614.1| PREDICTED: uncharacterized protein LOC104817925 [Tarenaya hassleriana]
Length=425

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRVDIL KK+C       SKSCY  QEIA FLRK+GFN+ TTIYLTQ RWDSSL+
Sbjct  260  FIAIDLRVDILEKKNCHETAVAGSKSCYDAQEIALFLRKVGFNTDTTIYLTQPRWDSSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP DKK+K+L++  SE EKVID YI S SDVFVPAISGLFYAN  
Sbjct  320  ILKDIFPKTYTKETIMPADKKSKYLESKDSEYEKVIDFYISSRSDVFVPAISGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+IT +SA  TD +S Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEITGTSALATDFVSPYISKKNHLAYSCFC  423



>gb|AAW56451.1| unknown [Flaveria brownii]
Length=242

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 7/164 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR+D+L +K CQG     SK CY PQEIA FL+KLGF+  + +YLTQ+RWDSSLD
Sbjct  86   FVAVDLRLDMLEQKGCQG-----SKKCYGPQEIAVFLKKLGFDKNSAVYLTQSRWDSSLD  140

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            S+K+ FPKTYTKE IMP++KK KFL +D+SE EKVID Y+C+ESDVFVPAISGLFYANVA
Sbjct  141  SIKDFFPKTYTKEGIMPMEKKPKFLGSDSSEYEKVIDFYVCAESDVFVPAISGLFYANVA  200

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI  GKT+I+VP D  ++SA++ ++IS YVSKK H AY+C+C
Sbjct  201  GKRIGLGKTKIVVPDD--SASANIANYISRYVSKKTHMAYTCYC  242



>ref|XP_002275416.1| PREDICTED: uncharacterized protein LOC100250173 [Vitis vinifera]
 emb|CBI25299.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+IL KK C G     +K+CY P EI+ FL+K+GF+   T+YLTQTRW  SLD
Sbjct  256  FIAVDLRVEILEKKGCLGGDG--TKTCYGPDEISAFLQKIGFDKDATVYLTQTRWHGSLD  313

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLKE FPKTY KE+IMP DKK KFLD++ SE  KVID YICS+SDVFVPAISGLFYANVA
Sbjct  314  SLKESFPKTYIKENIMPADKKPKFLDSETSEFMKVIDFYICSQSDVFVPAISGLFYANVA  373

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA+GK QILVPA I+ ++AS +D IS Y+SKKNH AYSCFC
Sbjct  374  GKRIATGKNQILVPATISEATASASDFISSYISKKNHLAYSCFC  417



>ref|XP_008227941.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=416

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRV+IL +  CQG     +KSCY+ QE+A FLRK+GF  GTTIYLT+++WDSSLD
Sbjct  253  FVAVDLRVEILEQNGCQGGDESGTKSCYNAQEVALFLRKVGFGKGTTIYLTESKWDSSLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+KFLD++ SE EK+ID Y+CS+SDVFVPAISGLFYANVA
Sbjct  313  ALKDIFPKTYIKDGIIPADKKSKFLDSEGSEFEKIIDFYVCSQSDVFVPAISGLFYANVA  372

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIAS KTQILVP DI+ SSAS ++ I+HYVSKKNH AYSC C
Sbjct  373  GKRIASSKTQILVPTDISDSSASASNFITHYVSKKNHLAYSCLC  416



>ref|XP_007215446.1| hypothetical protein PRUPE_ppa006341mg [Prunus persica]
 gb|EMJ16645.1| hypothetical protein PRUPE_ppa006341mg [Prunus persica]
Length=416

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLRV+IL +  CQG     +KSCY+ QE+A FLRK+GF  GTTIYLT+++WDSSLD
Sbjct  253  FVAVDLRVEILEQNGCQGGDESGTKSCYNAQEVALFLRKVGFGKGTTIYLTESKWDSSLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK++FPKTY K+ I+P DKK+KFLD++ SE EK+ID Y+CS+SDVFVPAISGLFYANVA
Sbjct  313  ALKDIFPKTYIKDGIIPADKKSKFLDSEGSEFEKIIDFYVCSQSDVFVPAISGLFYANVA  372

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIAS KTQILVP DI+ SSAS ++ I+HYVSKKNH AYSC C
Sbjct  373  GKRIASSKTQILVPTDISDSSASASNFITHYVSKKNHLAYSCLC  416



>gb|AFK48578.1| unknown [Lotus japonicus]
Length=210

 Score =   231 bits (589),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 3/164 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ +G    KSC++ QE+A FLRK+GF   TT+Y+T++RWDS LD
Sbjct  50   FIAVDLRVEMLDKKGCQDSGE---KSCFNAQEVAMFLRKVGFEKDTTVYVTRSRWDSRLD  106

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+I+P DKK+KFLD+  SELEKVID YI SESDVFVPAISGL  ANVA
Sbjct  107  SLKDLFPKTYTKEAIVPADKKSKFLDSQDSELEKVIDFYISSESDVFVPAISGLLCANVA  166

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKTQILVPADI  SSAS +  +S Y+SKKNHFAYSCFC
Sbjct  167  GKRIGSGKTQILVPADIPDSSASASSFLSSYISKKNHFAYSCFC  210



>gb|KEH28614.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=368

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNG-SPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRV++L KK CQGN  +   K+C++ QEIA FLRK+G +  TTIYLTQ+RWD SL
Sbjct  204  FIAVDLRVEMLNKKGCQGNDDNDGEKTCFNAQEIAVFLRKIGIDKDTTIYLTQSRWDDSL  263

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            DSLK+LFPKTYTKESIMP DKK KFLD+  SELE VID YI +ESDVFVPAISGL YANV
Sbjct  264  DSLKDLFPKTYTKESIMPADKKTKFLDSKDSELENVIDFYISTESDVFVPAISGLLYANV  323

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRI SGKTQILVPA I+ SSAS +  +S Y+SKKNHFAYSC+C
Sbjct  324  AGKRIGSGKTQILVPAVISDSSASASSFLSPYISKKNHFAYSCYC  368



>ref|XP_010927269.1| PREDICTED: uncharacterized protein LOC105049343 [Elaeis guineensis]
Length=374

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSC+ +     KSCYS QEI  FLRK+GFN  TTIYLTQT W  SL+
Sbjct  211  FIAVDLRVDILEKKSCKESRDRGRKSCYSAQEIGDFLRKIGFNGDTTIYLTQTWWHESLN  270

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLKE+FPKTYTK+ I+P DKK  FL + +SELEK +D +ICS SDVFVPAISGLFY NVA
Sbjct  271  SLKEIFPKTYTKDDIIPADKKGAFLRSQSSELEKALDFHICSHSDVFVPAISGLFYGNVA  330

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ + ASSA  ++ IS YV+KKNH AYSC+C
Sbjct  331  GKRIASGRTQILVPSQVRASSAPASNFISAYVTKKNHLAYSCYC  374



>gb|KEH28615.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=419

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNG-SPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRV++L KK CQGN  +   K+C++ QEIA FLRK+G +  TTIYLTQ+RWD SL
Sbjct  255  FIAVDLRVEMLNKKGCQGNDDNDGEKTCFNAQEIAVFLRKIGIDKDTTIYLTQSRWDDSL  314

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            DSLK+LFPKTYTKESIMP DKK KFLD+  SELE VID YI +ESDVFVPAISGL YANV
Sbjct  315  DSLKDLFPKTYTKESIMPADKKTKFLDSKDSELENVIDFYISTESDVFVPAISGLLYANV  374

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRI SGKTQILVPA I+ SSAS +  +S Y+SKKNHFAYSC+C
Sbjct  375  AGKRIGSGKTQILVPAVISDSSASASSFLSPYISKKNHFAYSCYC  419



>ref|XP_008799452.1| PREDICTED: uncharacterized protein At1g04910 [Phoenix dactylifera]
Length=424

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDILGK+ C+ +G    KSCY+ QE+  FL K+GF+  TTIYLTQT W  SLD
Sbjct  261  FIAVDLRVDILGKERCKESGGTGRKSCYNAQEVGDFLSKIGFDGDTTIYLTQTWWHESLD  320

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ +MP DKK +FL  ++SELE+V+D +ICS  DVFVPAISGLFY NVA
Sbjct  321  PLKEIFPKTYTKDDLMPADKKGEFLGLESSELERVVDFHICSRGDVFVPAISGLFYGNVA  380

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ +  SSA  +D IS YV+KKNH AYSC+C
Sbjct  381  GKRIASGRTQILVPSQVPGSSAPASDFISAYVTKKNHLAYSCYC  424



>ref|XP_010479652.1| PREDICTED: uncharacterized protein LOC104758474 [Camelina sativa]
Length=423

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+S TTIYLTQ RW+SSL+
Sbjct  260  FLAIDLRVEILEKKNCHEAGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKESIMPSDKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGTSGRSTDYISPYISKKNHLAYSCFC  423



>ref|XP_010461997.1| PREDICTED: uncharacterized protein LOC104742678 [Camelina sativa]
Length=423

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+S TTIYLTQ RW+SSL+
Sbjct  260  FLAIDLRVEILEKKNCHAAGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKESIMPSDKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+S+KNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGTSGRCTDYISPYISRKNHLAYSCFC  423



>ref|XP_006307609.1| hypothetical protein CARUB_v10009235mg [Capsella rubella]
 gb|EOA40507.1| hypothetical protein CARUB_v10009235mg [Capsella rubella]
Length=423

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF + TTIYLTQ RW+SSL+
Sbjct  260  FIAIDLRVEILEKKNCHETGAMGSKTCYNAQEIALFLRKLGFGTDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKEAIMPSDKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ SS   TD+IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGSSGRSTDYISPYISKKNHLAYSCFC  423



>ref|XP_008801515.1| PREDICTED: uncharacterized protein LOC103715609 [Phoenix dactylifera]
Length=424

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KKSC+ +     KSCYS QEI  FLRK+GF+  TTIYLTQT W  SL+
Sbjct  261  FLAVDLRVDILEKKSCKESRDTGRKSCYSAQEIGDFLRKIGFDGDTTIYLTQTWWHESLN  320

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ I+P+DKK +FL +++SELE+ +D +ICS SDVFVPAISGLFY NVA
Sbjct  321  PLKEIFPKTYTKDDIIPVDKKGEFLRSESSELERALDFHICSRSDVFVPAISGLFYGNVA  380

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ + ASSA   D IS YV+KKNH AYSC+C
Sbjct  381  GKRIASGRTQILVPSQVPASSARPPDFISGYVTKKNHLAYSCYC  424



>emb|CDY55666.1| BnaC06g04700D [Brassica napus]
Length=414

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C+  G+  SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  251  FIAIDLRVEILEKKNCRETGAVGSKTCYNAQEIALFLRKLGFGSDTTIYLTQPRWESSLN  310

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  311  ILKDIFPKTFTKEAIMPADKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  370

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ SS   TD+IS Y+SKKNH AYSCFC
Sbjct  371  GKRIALGKPQVLVPAEISGSSGLSTDYISPYISKKNHLAYSCFC  414



>ref|XP_002885425.1| hypothetical protein ARALYDRAFT_479639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61684.1| hypothetical protein ARALYDRAFT_479639 [Arabidopsis lyrata subsp. 
lyrata]
Length=422

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++++SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAIMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGRATDFISPYISKKNHLAYSCFC  422



>ref|XP_010500742.1| PREDICTED: uncharacterized protein LOC104778073 [Camelina sativa]
Length=423

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+S TTIYLTQ RW+SSL+
Sbjct  260  FLAIDLRVEILEKKNCHEAGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESIMP DKK+K+L+ + SE E VID YI S+SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKESIMPSDKKSKYLELENSEYENVIDFYISSKSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+S+KNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGTSGRSTDYISPYISRKNHLAYSCFC  423



>gb|KFK35833.1| hypothetical protein AALP_AA4G043000 [Arabis alpina]
Length=423

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DLRV+IL KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  260  FVAIDLRVEILEKKNCHETGVAGSKTCYNAQEIALFLRKLGFGSDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKESIMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTFTKESIMPSDKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ SS   TD+IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGSSGLSTDYISPYISKKNHLAYSCFC  423



>ref|XP_009145508.1| PREDICTED: uncharacterized protein LOC103869200 [Brassica rapa]
 ref|XP_009145509.1| PREDICTED: uncharacterized protein LOC103869200 [Brassica rapa]
Length=422

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIDILEKKHCHSTGVVGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  KK+K+L++++SE E VID YI S SDVFVPAISGLFYAN+ 
Sbjct  319  ILKDIFPKTFTKEAIMPASKKSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANIV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  422



>emb|CDY19573.1| BnaA05g19810D [Brassica napus]
Length=422

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIDILEKKHCHSTGVVGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  KK+K+L++++SE E VID YI S SDVFVPAISGLFYAN+ 
Sbjct  319  ILKDIFPKTFTKEAIMPASKKSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANIV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  422



>ref|XP_006393024.1| hypothetical protein EUTSA_v10011516mg [Eutrema salsugineum]
 gb|ESQ30310.1| hypothetical protein EUTSA_v10011516mg [Eutrema salsugineum]
Length=422

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  259  FIAIDLRVEILEKKNCHETGAVGSKTCYNAQEIALFLRKLGFGSDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP DKK+K+L+ + SE E VID YI S+SDVFVPAI GLFYAN  
Sbjct  319  ILKDIFPKTFTKEAIMPSDKKSKYLELENSEYENVIDFYISSKSDVFVPAIPGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISGTSGLSTDYISPYISKKNHLAYSCFC  422



>ref|XP_009147757.1| PREDICTED: uncharacterized protein LOC103871274 [Brassica rapa]
Length=414

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  251  FIAIDLRVEILEKKNCHETGGMGSKTCYNAQEIALFLRKLGFGSDTTIYLTQPRWESSLN  310

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  311  ILKDIFPKTFTKEAIMPADKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  370

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ SS   TD+IS Y+SKKNH AYSCFC
Sbjct  371  GKRIALGKPQVLVPAEISGSSGLSTDYISPYISKKNHLAYSCFC  414



>ref|XP_010466346.1| PREDICTED: uncharacterized protein LOC104746536 [Camelina sativa]
Length=423

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  260  FIAVDLRIDVLEKKNCHTTGVGGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++++SE E  ID YI S SDVF+PAISGLFYAN  
Sbjct  320  ILKDIFPKTFTKEAIMPASKRSKYLESESSEYENAIDFYISSRSDVFIPAISGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GKTQ+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKTQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  423



>ref|XP_004141744.1| PREDICTED: uncharacterized protein LOC101215039 [Cucumis sativus]
 gb|KGN45424.1| hypothetical protein Csa_7G447860 [Cucumis sativus]
Length=413

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+++LG+  CQ      SKSCY+ Q+IA FL+K+GF+   TIYLTQ RW++SLD
Sbjct  252  FIAVDLRIEMLGENGCQEASG--SKSCYTAQDIALFLKKIGFDKDATIYLTQPRWENSLD  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK+LFPKTYTKESIMP D+KAKFL++ +SE EKVID Y+CS+SDVFVPAISGLFY+NVA
Sbjct  310  DLKDLFPKTYTKESIMPADQKAKFLNSKSSEYEKVIDFYLCSQSDVFVPAISGLFYSNVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPA I   +AS ++ IS Y++KKNH AYSCFC
Sbjct  370  GKRIALGKNQILVPATIREPTASASNFISSYITKKNHLAYSCFC  413



>ref|XP_008462222.1| PREDICTED: uncharacterized protein LOC103500628 [Cucumis melo]
Length=413

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+++LG+  CQ      SKSCY+ Q+IA FL+K+GF+   TIYLTQ RW++SLD
Sbjct  252  FIAVDLRIEMLGENGCQEASG--SKSCYTAQDIALFLKKIGFDKDATIYLTQPRWENSLD  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK+LFPKTYTKESIMP D+KAKFL++ +SE EKVID Y+CS+SDVFVPAISGLFY+NVA
Sbjct  310  DLKDLFPKTYTKESIMPADQKAKFLNSKSSEYEKVIDFYLCSQSDVFVPAISGLFYSNVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPA I   +AS ++ IS Y++KKNH AYSCFC
Sbjct  370  GKRIALGKNQILVPATIREPTASASNFISSYITKKNHLAYSCFC  413



>ref|XP_010276723.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=413

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L  K CQG+G    KSCY+ QEI +FLRK+GF+ GTTIYLTQ+ W SS D
Sbjct  255  FIAVDLRVEMLESKGCQGSGK---KSCYNAQEIGEFLRKIGFSRGTTIYLTQSWWHSSFD  311

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LKE+FP  YTKE+IMP +KK KFL++ +  LE  ID YICS+SDVFVPAISGLFYANVA
Sbjct  312  ALKEIFPNVYTKENIMPAEKKYKFLNSGS--LESAIDFYICSQSDVFVPAISGLFYANVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKTQIL+PA ++ SSAS +D IS YVSK+NHF YSCFC
Sbjct  370  GKRITSGKTQILIPAQVSNSSASASDFISSYVSKRNHFVYSCFC  413



>emb|CDY22855.1| BnaA06g02220D [Brassica napus]
Length=414

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C+  G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  251  FIAIDLRVEILEKKNCRETGGMGSKTCYNAQEIALFLRKLGFGSDTTIYLTQPRWESSLN  310

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP +KK K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  311  ILKDIFPKTFTKEAIMPAEKKGKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  370

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ SS   TD+IS Y+SKKNH AYSCFC
Sbjct  371  GKRIALGKPQVLVPAEISGSSGLSTDYISPYISKKNHLAYSCFC  414



>emb|CDY50071.1| BnaC05g30800D [Brassica napus]
Length=422

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSLD
Sbjct  259  FIAVDLRIDLLEKKHCHSTGVVGSKTCYNAQEIALFLRKLGFAGDTTIYLTQPRWDSSLD  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+I P  KK+K+L++++SE E VID YI S SDVFVPAISGLFYAN+ 
Sbjct  319  ILKDIFPKTFTKEAIFPASKKSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANIV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  422



>ref|NP_566677.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB01710.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO64166.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04069.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00437.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76474.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=422

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++ +SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAIMPASKRSKYLESVSSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  422



>ref|XP_007150835.1| hypothetical protein PHAVU_005G184800g [Phaseolus vulgaris]
 gb|ESW22829.1| hypothetical protein PHAVU_005G184800g [Phaseolus vulgaris]
Length=410

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ + +   KSCY+ QEIA FLR++GF+  TT+Y+T++RWDSSLD
Sbjct  254  FIAVDLRVEMLDKKGCQNSDNDGEKSCYNAQEIAVFLRQIGFDKDTTVYVTESRWDSSLD  313

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK KFLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  314  SLKDLFPKTYTKEAIMPADKKKKFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  370

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    ASSAS ++ +S YVS KNHFAYSC+C
Sbjct  371  GKRIGSGKTRILVP----ASSASASNFLSPYVSNKNHFAYSCYC  410



>ref|XP_002894326.1| hypothetical protein ARALYDRAFT_892138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70585.1| hypothetical protein ARALYDRAFT_892138 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+  TTIYLTQ RW+SSL+
Sbjct  260  FIAIDLRVEILEKKNCHETGAVGSKTCYNAQEIALFLRKLGFDRDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP DKK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKEAIMPSDKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   T++IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGTSGVPTNYISPYISKKNHLAYSCFC  423



>ref|XP_006406304.1| hypothetical protein EUTSA_v10020803mg [Eutrema salsugineum]
 gb|ESQ47757.1| hypothetical protein EUTSA_v10020803mg [Eutrema salsugineum]
Length=422

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK+C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIDILEKKNCHSTGVVGSKTCYNAQEIALFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK +FPKT+TKE+IMP  K++K+L+++ SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKNIFPKTFTKEAIMPASKRSKYLESENSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGIATDFISPYISKKNHLAYSCFC  422



>emb|CDY52950.1| BnaC03g77880D [Brassica napus]
Length=418

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C+  G+  SK+CY+ QEIA FLRKLGF+  TTIYLTQ RW+SSL+
Sbjct  255  FIAIDLRVEILEKKNCRETGAGGSKTCYNAQEIAVFLRKLGFDGDTTIYLTQPRWESSLN  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP +KK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  315  ILKDIFPKTFTKEAIMPAEKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  374

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  375  GKRIALGKPQVLVPAEISGTSGLSTDYISPYISKKNHLAYSCFC  418



>ref|XP_004159011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230932 
[Cucumis sativus]
Length=413

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+++LG+  CQ      SKSCY+ Q+IA F +K+GF+   TIYLTQ RW++SLD
Sbjct  252  FIAVDLRIEMLGENGCQEASG--SKSCYTAQDIALFXKKIGFDKDATIYLTQPRWENSLD  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK+LFPKTYTKESIMP D+KAKFL++ +SE EKVID Y+CS+SDVFVPAISGLFY+NVA
Sbjct  310  DLKDLFPKTYTKESIMPADQKAKFLNSKSSEYEKVIDFYLCSQSDVFVPAISGLFYSNVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK QILVPA I   +AS ++ IS Y++KKNH AYSCFC
Sbjct  370  GKRIALGKNQILVPATIREPTASASNFISSYITKKNHLAYSCFC  413



>ref|XP_010509815.1| PREDICTED: uncharacterized protein LOC104786164 [Camelina sativa]
Length=423

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  260  FIAVDLRIDVLEKKNCHTTGVGGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++++SE E  ID YI S SDVF+PAISGLFYAN  
Sbjct  320  ILKDIFPKTFTKEAIMPASKRSKYLESESSEYENAIDFYISSRSDVFIPAISGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  423



>ref|XP_009107173.1| PREDICTED: uncharacterized protein LOC103832835 [Brassica rapa]
 emb|CDY46550.1| BnaA08g01890D [Brassica napus]
Length=418

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C+  G+  SK+CY+ QEIA FLRKLGF+  TTIYLTQ RW+SSL+
Sbjct  255  FIAIDLRVEILEKKNCRETGAGGSKTCYNAQEIAVFLRKLGFDGDTTIYLTQPRWESSLN  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP +KK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  315  ILKDIFPKTFTKEAIMPAEKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  374

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  375  GKRIALGKPQVLVPAEISGTSGLSTDYISPYISKKNHLAYSCFC  418



>emb|CDY43916.1| BnaA05g15260D [Brassica napus]
Length=411

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DLRV++L KK+C+  G+  SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  248  FVAIDLRVEVLEKKNCRETGAVGSKTCYNAQEIALFLRKLGFESDTTIYLTQPRWESSLN  307

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  KK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  308  ILKDIFPKTFTKEAIMPASKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  367

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  368  GKRIALGKPQVLVPAEISGTSGLSTDYISPYISKKNHLAYSCFC  411



>ref|XP_009144893.1| PREDICTED: uncharacterized protein LOC103868560 [Brassica rapa]
Length=411

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DLRV++L KK+C+  G+  SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+SSL+
Sbjct  248  FVAIDLRVEVLEKKNCRETGAVGSKTCYNAQEIALFLRKLGFESDTTIYLTQPRWESSLN  307

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  KK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  308  ILKDIFPKTFTKEAIMPASKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  367

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD+IS Y+SKKNH AYSCFC
Sbjct  368  GKRIALGKPQVLVPAEISGTSGLSTDYISPYISKKNHLAYSCFC  411



>ref|NP_175574.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAF01044.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32693.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=423

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+S TTIYLTQ RW+SSL+
Sbjct  260  FIAIDLRVEILEKKNCHETGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE+IMP DKK K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  320  ILKDIFPKTYTKEAIMPSDKKTKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S    ++IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISGTSGLPANYISPYISKKNHLAYSCFC  423



>ref|XP_003546222.1| PREDICTED: uncharacterized protein LOC100789772 isoform X1 [Glycine 
max]
 gb|KHN22386.1| DUF246 domain-containing protein [Glycine soja]
Length=411

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 134/164 (82%), Gaps = 7/164 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ +     KSCY+ QEIA FLR++GF+  TT+Y+T++RWDSSLD
Sbjct  255  FIAVDLRVEMLNKKGCQNSDIDGEKSCYNAQEIAVFLRQIGFDKDTTVYVTESRWDSSLD  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK KFLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  315  SLKDLFPKTYTKEAIMPADKKKKFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  371

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A+SAS ++ +S YVS KNHFAYSC+C
Sbjct  372  GKRIGSGKTRILVP----ATSASASNFLSPYVSNKNHFAYSCYC  411



>ref|XP_006597087.1| PREDICTED: uncharacterized protein LOC100789772 isoform X2 [Glycine 
max]
Length=409

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 134/164 (82%), Gaps = 7/164 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ +     KSCY+ QEIA FLR++GF+  TT+Y+T++RWDSSLD
Sbjct  253  FIAVDLRVEMLNKKGCQNSDIDGEKSCYNAQEIAVFLRQIGFDKDTTVYVTESRWDSSLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK KFLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  313  SLKDLFPKTYTKEAIMPADKKKKFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A+SAS ++ +S YVS KNHFAYSC+C
Sbjct  370  GKRIGSGKTRILVP----ATSASASNFLSPYVSNKNHFAYSCYC  409



>gb|AAM65575.1| unknown [Arabidopsis thaliana]
Length=422

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+DIL KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWD SL+
Sbjct  259  FIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDISLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++ +SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAIMPASKRSKYLESVSSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  422



>emb|CDY27536.1| BnaC01g32190D [Brassica napus]
Length=422

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR++ L KK+C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIEALEKKNCHSTGVGGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE++MP  K++K+L++++SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAVMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S+  TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSSLATDFISPYISKKNHLAYSCFC  422



>ref|XP_010550817.1| PREDICTED: uncharacterized protein LOC104821598 [Tarenaya hassleriana]
Length=423

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR++IL KK+C      +SK+CY  QEIA FLRK+GFN+ TTIYLTQ RW+SSL+
Sbjct  260  FIAVDLRLEILEKKNCHETSIAKSKTCYDSQEIAVFLRKIGFNTDTTIYLTQPRWNSSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKESI+P DKK+K+L++  SE EKVID YI S SDVFVPAISGLFYAN  
Sbjct  320  ILKDIFPKTYTKESIIPGDKKSKYLESANSEYEKVIDFYISSRSDVFVPAISGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA  K Q+L+PA+I  +SA  TD IS Y+ KKNH AYSCFC
Sbjct  380  GKRIALNKNQVLIPAEIAGTSALATDFISPYIWKKNHLAYSCFC  423



>emb|CDY37310.1| BnaA01g25300D [Brassica napus]
Length=422

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR++ L KK+C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIEALEKKNCHSTGVGGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE++MP  K++K+L++++SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAVMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S+  TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSSLATDFISPYISKKNHLAYSCFC  422



>ref|XP_009109756.1| PREDICTED: uncharacterized protein LOC103835351 [Brassica rapa]
Length=422

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR++ L KK+C   G   SK+CY+ QEIA FLRKLGF   TTIYLTQ RWDSSL+
Sbjct  259  FIAVDLRIEALEKKNCHSTGVGGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLN  318

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE++MP  K++K+L++++SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  319  ILKDIFPKTFTKEAVMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTV  378

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S+  TD IS Y+SKKNH AYSCFC
Sbjct  379  GKRIALGKPQVLVPAEISETSSLATDFISPYISKKNHLAYSCFC  422



>ref|XP_004507011.1| PREDICTED: uncharacterized protein LOC101492011 [Cicer arietinum]
Length=419

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGN-GSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+AVDLRV++L KK CQGN  +   KSC++ QEIA FLRK+G +  TTIY+TQ+RWD SL
Sbjct  255  FIAVDLRVEMLNKKGCQGNEDNDGEKSCFNAQEIAVFLRKIGIDKDTTIYVTQSRWDDSL  314

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            DSLK+LF KTYTKESIMP DKK KFLD+  SELEKVID YI +ESDVF+PAISGL YANV
Sbjct  315  DSLKDLFHKTYTKESIMPADKKTKFLDSKDSELEKVIDFYISTESDVFIPAISGLLYANV  374

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AGKRI SGKTQILVP++I+ SSAS +  +S Y+SKKNHFAYSC+C
Sbjct  375  AGKRIGSGKTQILVPSEISDSSASASSFLSPYISKKNHFAYSCYC  419



>gb|ACU23517.1| unknown [Glycine max]
Length=411

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 7/164 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQ +     KSCY+ QEIA FLR++GF+  TT+Y+T++RWDSSLD
Sbjct  255  FIAVDLRVEMLNKKGCQNSDIDGEKSCYNAQEIAVFLRQIGFDKDTTVYVTESRWDSSLD  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK KFLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  315  SLKDLFPKTYTKEAIMPADKKKKFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  371

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A+ AS ++ +S YVS KNHFAYSC+C
Sbjct  372  GKRIGSGKTRILVP----ATFASASNFLSPYVSNKNHFAYSCYC  411



>ref|XP_010488108.1| PREDICTED: uncharacterized protein LOC104766006 [Camelina sativa]
Length=423

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  260  FIAVDLRIDVLEKKNCHTTGVGGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L++++SE E  ID  I S SDVF+PAISGLFYAN  
Sbjct  320  ILKDIFPKTFTKEAIMPASKRSKYLESESSEYENAIDFDISSRSDVFIPAISGLFYANTV  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+I+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  380  GKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSCFC  423



>ref|XP_010929324.1| PREDICTED: uncharacterized protein LOC105050840 [Elaeis guineensis]
Length=426

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVDIL KK C+ +   R KSCY+ +EI  FLRK+GF+  TT+YLTQT W  SL+
Sbjct  262  FIAVDLRVDILEKKRCKESRGTRRKSCYNAREIGDFLRKIGFDGDTTVYLTQTWWHESLN  321

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ ++P DKK KFL + +SELE+ +D +ICS SDVFVPAISGLFY NVA
Sbjct  322  PLKEIFPKTYTKDDLIPADKKGKFLRSGSSELERALDFHICSRSDVFVPAISGLFYGNVA  381

Query  362  GKRIASGKTQILVPADI-TASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ +   SSA  +D IS YV+KKNH AYSC+C
Sbjct  382  GKRIASGRTQILVPSQVPPGSSAPASDFISTYVTKKNHLAYSCYC  426



>emb|CDX87826.1| BnaC06g08880D [Brassica napus]
Length=419

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DLR+++L KK+C+  G+  SK+CY+ QEIA FLRKLGF S TTIYLTQ RW+S L+
Sbjct  256  FVAIDLRLEVLEKKNCRETGAVGSKTCYNAQEIALFLRKLGFESDTTIYLTQPRWESRLN  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE IMP  KK+K+L+ + SE E VID YI S SDVFVPAI GLFYAN  
Sbjct  316  ILKDIFPKTFTKEVIMPASKKSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTV  375

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPADI+ +S   TD IS Y+SKKNH AYSCFC
Sbjct  376  GKRIALGKPQVLVPADISGTSGLSTDCISPYISKKNHLAYSCFC  419



>ref|XP_006297757.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 ref|XP_006297758.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 gb|EOA30655.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 gb|EOA30656.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
Length=421

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK+C   G   SK+CY+ QEIA FLRKLGF S TTIYLTQ RWDSSL+
Sbjct  261  FIAVDLRIDVLEKKNCHTTGVTGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN  320

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKT+TKE+IMP  K++K+L+ ++SE E VID YI S SDVFVPAISGLFYAN  
Sbjct  321  ILKDIFPKTFTKEAIMPASKRSKYLETESSEYENVIDFYISSRSDVFVPAISGLFYANTV  380

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIA GK Q+LVPA+   +S   TD IS Y+SKKNH AYSCFC
Sbjct  381  GKRIALGKPQVLVPAE---TSGLATDFISPYISKKNHLAYSCFC  421



>ref|XP_006595200.1| PREDICTED: uncharacterized protein LOC100807062 isoform X2 [Glycine 
max]
Length=407

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 9/164 (5%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK CQ   S   KSCY+ QEIA F R++GF+  TT+Y+T++RWDSSLD
Sbjct  253  FIAVDLRVDMLNKKGCQN--SDIEKSCYNAQEIAVFFRQIGFDKDTTVYVTESRWDSSLD  310

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK +FLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  311  SLKDLFPKTYTKEAIMPADKKKRFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  367

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A SAS ++ +S YVS KNHFAYSC+C
Sbjct  368  GKRIGSGKTRILVP----APSASASNFLSPYVSNKNHFAYSCYC  407



>ref|XP_003543719.1| PREDICTED: uncharacterized protein LOC100807062 isoform X1 [Glycine 
max]
Length=409

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 9/164 (5%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK CQ   S   KSCY+ QEIA F R++GF+  TT+Y+T++RWDSSLD
Sbjct  255  FIAVDLRVDMLNKKGCQN--SDIEKSCYNAQEIAVFFRQIGFDKDTTVYVTESRWDSSLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK +FLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  313  SLKDLFPKTYTKEAIMPADKKKRFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A SAS ++ +S YVS KNHFAYSC+C
Sbjct  370  GKRIGSGKTRILVP----APSASASNFLSPYVSNKNHFAYSCYC  409



>gb|KHN31859.1| DUF246 domain-containing protein [Glycine soja]
Length=409

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 9/164 (5%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK CQ   S   KSCY+ QEIA F R++GF+  TT+Y+T++RWDSSLD
Sbjct  255  FIAVDLRVDMLNKKGCQN--SDIEKSCYNAQEIAVFFRQIGFDKDTTVYVTESRWDSSLD  312

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SLK+LFPKTYTKE+IMP DKK +FLD   SE EKVID Y+ +ESDVFVPAISGLFYANV 
Sbjct  313  SLKDLFPKTYTKEAIMPADKKKRFLD---SEFEKVIDFYVSAESDVFVPAISGLFYANVV  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGKT+ILVP    A SAS ++ +S YVS KNHFAYSC+C
Sbjct  370  GKRIGSGKTRILVP----APSASASNFLSPYVSNKNHFAYSCYC  409



>gb|EPS57961.1| hypothetical protein M569_16856 [Genlisea aurea]
Length=409

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+D+R+D+L KK C+     RSKSC++PQEIA FL+K+GF   T +Y+TQT+WDSSLD
Sbjct  249  FVAIDVRIDMLKKKGCRKGDGSRSKSCFNPQEIALFLKKIGFGKDTVLYVTQTKWDSSLD  308

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +LK+LFP TYTK+SIM  +K     + D  ELEK ID YICSESDVFVPAISGLFYANVA
Sbjct  309  ALKDLFPNTYTKKSIMGNEK-----EMDDDELEKAIDMYICSESDVFVPAISGLFYANVA  363

Query  362  GKRIASGKTQILVPA--DITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGKTQILVPA  D    + S  D +SHYV +KNH AYSCFC
Sbjct  364  GKRIASGKTQILVPAVVDNDVPTPSARDFLSHYVLEKNHLAYSCFC  409



>ref|XP_009381592.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=413

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK C+  G+ + K CY+P EI  FL+K+GFNS  TIYLTQT W  SL+
Sbjct  250  FIAVDLRVDVLEKKGCKEKGNGK-KPCYTPMEIRDFLKKVGFNSDHTIYLTQTWWHESLN  308

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ ++P +KKA FL +  +EL++ +D  ICS+SDVFVPAI+GLFY NVA
Sbjct  309  PLKEMFPKTYTKDDLVPAEKKAHFLQSGGAELQRALDFQICSKSDVFVPAIAGLFYGNVA  368

Query  362  GKRIASGKTQILVPADITASSA-SLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ + +SS  + ++ IS YVSKKNH AYSCFC
Sbjct  369  GKRIASGRTQILVPSQVPSSSPIASSNFISTYVSKKNHLAYSCFC  413



>ref|XP_009381590.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=414

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRVD+L KK C+  G+ + K CY+P EI  FL+K+GFNS  TIYLTQT W  SL+
Sbjct  251  FIAVDLRVDVLEKKGCKEKGNGK-KPCYTPMEIRDFLKKVGFNSDHTIYLTQTWWHESLN  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ ++P +KKA FL +  +EL++ +D  ICS+SDVFVPAI+GLFY NVA
Sbjct  310  PLKEMFPKTYTKDDLVPAEKKAHFLQSGGAELQRALDFQICSKSDVFVPAIAGLFYGNVA  369

Query  362  GKRIASGKTQILVPADITASSA-SLTDHISHYVSKKNHFAYSCFC  493
            GKRIASG+TQILVP+ + +SS  + ++ IS YVSKKNH AYSCFC
Sbjct  370  GKRIASGRTQILVPSQVPSSSPIASSNFISTYVSKKNHLAYSCFC  414



>gb|AAG50891.1|AC025294_29 unknown protein [Arabidopsis thaliana]
Length=460

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 132/190 (69%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLRV+IL KK+C   G+  SK+CY+ QEIA FLRKLGF+S TTIYLTQ RW+SSL+
Sbjct  271  FIAIDLRVEILEKKNCHETGAVGSKTCYNAQEIALFLRKLGFDSDTTIYLTQPRWESSLN  330

Query  182  SLKELFPKTYTK--------------------------ESIMPIDKKAKFLDADASELEK  283
             LK++FPKTYTK                          E+IMP DKK K+L+ + SE E 
Sbjct  331  ILKDIFPKTYTKVRKTLHYLVSEVFTHLLILTFFCKWQEAIMPSDKKTKYLELENSEYEN  390

Query  284  VIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITASSASLTDHISHYVSK  463
            VID YI S SDVFVPAI GLFYAN  GKRIA GK Q+LVPA+I+ +S    ++IS Y+SK
Sbjct  391  VIDFYISSRSDVFVPAIPGLFYANTVGKRIALGKPQVLVPAEISGTSGLPANYISPYISK  450

Query  464  KNHFAYSCFC  493
            KNH AYSCFC
Sbjct  451  KNHLAYSCFC  460



>gb|KHN35827.1| DUF246 domain-containing protein [Glycine soja]
Length=420

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTI-YLTQTRWDSSL  178
            F+AVDLR +++G++  + + S R K CY P EI +FL+K+GF+  TT+ Y+TQT+W+S L
Sbjct  257  FIAVDLRTEMVGRECHKKDVSGR-KLCYQPHEIGEFLKKIGFSPETTVVYVTQTKWNSDL  315

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            D+LK++FPKTYTKE++M  DKK KFL + +SE EKVID YICS+S+VFVP+I GLFYANV
Sbjct  316  DALKDIFPKTYTKETVMAEDKKGKFLRSKSSEFEKVIDFYICSKSEVFVPSIPGLFYANV  375

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AG RI SGK QILVPA+I   SAS +D+IS Y S+KNHFAY+CFC
Sbjct  376  AGMRILSGKNQILVPAEIAGPSASASDYISSYESQKNHFAYACFC  420



>ref|XP_003533745.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=420

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTI-YLTQTRWDSSL  178
            F+AVDLR +++G++  + + S R K CY P EI +FL+K+GF+  TT+ Y+TQT+W+S L
Sbjct  257  FIAVDLRTEMVGRECHKKDVSGR-KLCYQPHEIGEFLKKIGFSPETTVVYVTQTKWNSDL  315

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            D+LK++FPKTYTKE++M  DKK KFL + +SE EKVID YICS+S+VFVP+I GLFYANV
Sbjct  316  DALKDIFPKTYTKETVMAEDKKGKFLRSKSSEFEKVIDFYICSKSEVFVPSIPGLFYANV  375

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AG RI SGK QILVPA+I   SAS +D+IS Y S+KNHFAY+CFC
Sbjct  376  AGMRILSGKNQILVPAEIAGPSASASDYISSYESQKNHFAYACFC  420



>gb|KHN24633.1| hypothetical protein glysoja_032277 [Glycine soja]
Length=370

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTI-YLTQTRWDSSL  178
            F+AVDLR +++ K+  + + S R K CY P EI +FL+K+GF+  TT+ Y+TQ++W+S L
Sbjct  207  FIAVDLRTEMVAKECHKKDVSGR-KLCYQPHEIGEFLKKIGFSPETTVVYVTQSKWNSDL  265

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            D+LK++FPKTYTKE++M  DKK K L + +SE EKVID YICS+S+VFVP+I GLFYANV
Sbjct  266  DALKDIFPKTYTKETVMAEDKKGKSLSSQSSEFEKVIDFYICSQSEVFVPSIPGLFYANV  325

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AG RI SGK QILVPA+I++ SAS +D+IS YVS+KNHFAY+CFC
Sbjct  326  AGMRIVSGKNQILVPAEISSPSASASDYISPYVSQKNHFAYACFC  370



>ref|XP_010656875.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Vitis vinifera]
 emb|CBI17883.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR  +L ++ C+   +   K+CY+ +EI  FL+K+GF+  T IYLTQ++W  SLD
Sbjct  257  FVAVDLRFKVL-ERECRRREAKGKKNCYNAEEIGVFLKKIGFDRDTAIYLTQSKWHHSLD  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FPKT+TKE IM  +KKAKFL +++SE EK ID YICSESDVFVP+ISGLFYANV 
Sbjct  316  ALREIFPKTFTKEGIMLAEKKAKFLSSESSEFEKAIDFYICSESDVFVPSISGLFYANVV  375

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRIASGK+QILVPA +T SS S++ +IS Y+SK+NHFAYSCFC
Sbjct  376  GKRIASGKSQILVPAQVTVSSTSVSSYISRYISKRNHFAYSCFC  419



>ref|NP_001242787.1| uncharacterized protein LOC100818659 [Glycine max]
 gb|ACU17958.1| unknown [Glycine max]
Length=420

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTI-YLTQTRWDSSL  178
            F+AVDLR +++ K+  + + S R K CY P EI +FL+K+GF+  TT+ Y+TQ++W+S L
Sbjct  257  FIAVDLRTEMVAKECHKKDVSGR-KLCYQPHEIGEFLKKIGFSPETTVVYVTQSKWNSDL  315

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
            D+LK++FPKTYTKE++M  DKK K L + +SE EKVID YICS+S+VFVP+I GLFYANV
Sbjct  316  DALKDIFPKTYTKETVMAEDKKGKSLSSQSSEFEKVIDFYICSQSEVFVPSIPGLFYANV  375

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AG RI SGK Q LVPA+I++ SAS +D+IS YVS+KNHFAY+CFC
Sbjct  376  AGMRIVSGKNQTLVPAEISSPSASASDYISPYVSQKNHFAYACFC  420



>dbj|BAK06813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +AVD+R D+L KK+C+ +G  R K CY+PQE+  FL+K+GF++ TTIYLT+T W   L++
Sbjct  255  LAVDMRTDLLEKKTCKTSGGARRKGCYNPQEVLNFLKKVGFSANTTIYLTETWWHKGLNN  314

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LK+ FP TYTK+ IMP +KK +FL++  S+L + +D  +CS+SDVFVPAI G+FY NVAG
Sbjct  315  LKKAFPHTYTKDDIMPAEKKGEFLNSGDSDLARALDLEVCSQSDVFVPAIPGMFYGNVAG  374

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            +RIASG TQILVPA +  +SA  +D +S Y++KK+HFAYSC+C
Sbjct  375  RRIASGLTQILVPAPVGGASAQASDFVSTYITKKSHFAYSCYC  417



>ref|XP_009410213.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVD+RVD+L KKSC+   + R K CY+  EI  FLRK+GFN+  TIYLT+T W  SL+
Sbjct  250  FIAVDIRVDVLEKKSCREKSNGR-KPCYTAVEIRDFLRKVGFNADNTIYLTETWWHESLN  308

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ ++P +KK  FL +  +EL++ +D  ICS+SDVFVPAISGLFY NVA
Sbjct  309  PLKEVFPKTYTKDDLIPAEKKGHFLQSGGAELQRALDFQICSKSDVFVPAISGLFYGNVA  368

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI  G+TQILVP+ + +SS + ++  S YVSK+NH AYSCFC
Sbjct  369  GKRITLGRTQILVPSQVPSSSPTASNFFSPYVSKRNHVAYSCFC  412



>ref|XP_003578366.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=420

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +AVD+R D+LGKK C+ +G  R K CY+PQE+  FL+K+GF + TTIYLT+T W   L++
Sbjct  258  LAVDMRTDLLGKKICKTSGGARRKGCYNPQEVLNFLKKVGFAANTTIYLTETWWHKGLNN  317

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LK+ FP TYTK+ IMP + K +FL++  S+L + +D  ICS+SD+FVPAI+G+FY +V G
Sbjct  318  LKKAFPNTYTKDDIMPTENKGEFLNSGDSDLSRALDLEICSKSDIFVPAIAGMFYGHVTG  377

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG TQILVPA + ++S+  +D IS Y+SKK+HFAYSC+C
Sbjct  378  KRIASGLTQILVPAPMASASSQASDFISTYISKKSHFAYSCYC  420



>ref|XP_009410212.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=413

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVD+RVD+L KKSC+   + R K CY+  EI  FLRK+GFN+  TIYLT+T W  SL+
Sbjct  251  FIAVDIRVDVLEKKSCREKSNGR-KPCYTAVEIRDFLRKVGFNADNTIYLTETWWHESLN  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LKE+FPKTYTK+ ++P +KK  FL +  +EL++ +D  ICS+SDVFVPAISGLFY NVA
Sbjct  310  PLKEVFPKTYTKDDLIPAEKKGHFLQSGGAELQRALDFQICSKSDVFVPAISGLFYGNVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI  G+TQILVP+ + +SS + ++  S YVSK+NH AYSCFC
Sbjct  370  GKRITLGRTQILVPSQVPSSSPTASNFFSPYVSKRNHVAYSCFC  413



>ref|XP_004488019.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=420

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLR+D+L KK C G      K C+   EI +FL+K+GF   T +Y+TQT+W   L+
Sbjct  258  FIAVDLRIDVL-KKECNGKDEKGRKQCFQGHEIGEFLKKIGFGQETVVYVTQTKWSPDLN  316

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+ +FPKTYTKE+IM   KK KFL +++ E EKVID YICS+SD+FVP+I G FY NVA
Sbjct  317  ALRYMFPKTYTKENIMSATKKEKFLSSESIEFEKVIDFYICSQSDIFVPSIPGPFYDNVA  376

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI SGK QILVP++I + SAS ++H S YV++K+HFAY+CFC
Sbjct  377  GKRIVSGKNQILVPSEIVSPSASASEHFSPYVTQKSHFAYACFC  420



>ref|XP_003595107.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES65358.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=423

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR ++L KK C G      K CY   EI +FL+++GF   T IY+TQT+W   L+
Sbjct  261  FVAVDLRTEVL-KKGCNGKDGKGRKQCYQGYEIGEFLKRVGFGQETVIYVTQTKWSPDLN  319

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SL+ +FPKTYTKE+IM   KK KFL +++ ELEK ID YICSESDVFVP++ G FY NVA
Sbjct  320  SLRHMFPKTYTKENIMSATKKEKFLSSESIELEKAIDFYICSESDVFVPSVPGPFYENVA  379

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G RI SGK Q++VP++I +  AS ++H+S YV+KKNH AY CFC
Sbjct  380  GMRIVSGKDQVIVPSEIVSPEASASEHMSPYVTKKNHIAYKCFC  423



>ref|NP_001063569.1| Os09g0498800 [Oryza sativa Japonica Group]
 dbj|BAF25483.1| Os09g0498800 [Oryza sativa Japonica Group]
 dbj|BAG92036.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69988.1| hypothetical protein OsJ_29893 [Oryza sativa Japonica Group]
Length=425

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DL+ ++L KK C+ NG  R + CY PQE+  FL+K+GF++ TTIYLT+T W  SLD+
Sbjct  263  IAIDLQTELLEKKICKTNGGARRRGCYYPQEVVHFLKKVGFSADTTIYLTETWWHKSLDT  322

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ IMP   K +FL +  S L + +D  ICSESDVFVPAI GLFY +VAG
Sbjct  323  LKEAFPNTYTKDDIMPAANKGEFLKSGDSYLARALDLKICSESDVFVPAIPGLFYGHVAG  382

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIA+G T I+VPA +++SSA  ++ +S YVSKK+H AYSC+C
Sbjct  383  KRIAAGLTNIIVPAPVSSSSALASEFVSTYVSKKSHLAYSCYC  425



>gb|EEC84820.1| hypothetical protein OsI_31907 [Oryza sativa Indica Group]
Length=471

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DL+ ++L KK C+ NG  R + CY PQE+  FL+K+GF++ TTIYLT+T W  SLD+
Sbjct  309  IAIDLQTELLEKKICKTNGGARRRGCYYPQEVVHFLKKVGFSADTTIYLTETWWHKSLDT  368

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ IMP   K +FL +  S L + +D  ICSESDVFVPAI GLFY +VAG
Sbjct  369  LKEAFPNTYTKDDIMPAANKGEFLKSGDSYLARALDLKICSESDVFVPAIPGLFYGHVAG  428

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIA+G T I+VPA +++SSA  ++ +S YVSKK+H AYSC+C
Sbjct  429  KRIAAGLTNIIVPAPVSSSSALASEFVSTYVSKKSHLAYSCYC  471



>gb|AFV79649.1| mannan synthesis-related protein [Trigonella foenum-graecum]
Length=413

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR++ L K  C G      K CY   EI +FL+++GF   T IY+TQT+W   L+
Sbjct  251  FVAVDLRIEGL-KNECNGKDGKGRKQCYQGHEIGEFLKRIGFGQETVIYVTQTKWSPDLN  309

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            SL+ +FPKTYTKE+IM   KK KF+++++ E EK ID YICSESDVFVP+I G FY NVA
Sbjct  310  SLRYMFPKTYTKENIMSSTKKEKFINSESIEFEKAIDFYICSESDVFVPSILGPFYENVA  369

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G RI SGK +I+VP+++ + SAS ++H+S YV+KKNH AY CFC
Sbjct  370  GMRIVSGKNEIIVPSEVVSPSASASEHMSPYVTKKNHLAYKCFC  413



>ref|XP_006845774.1| hypothetical protein AMTR_s00019p00251420 [Amborella trichopoda]
 gb|ERN07449.1| hypothetical protein AMTR_s00019p00251420 [Amborella trichopoda]
Length=392

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQ---GNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDS  172
            F+AVDL +++L +KSCQ    +     K CY+P E+  FLR++GF S T IYLTQ+ W  
Sbjct  227  FIAVDLSIELLQQKSCQVSQNDNLAGRKRCYTPGEVGTFLRQIGFQSETVIYLTQSGWHE  286

Query  173  SLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYA  352
            SL +LKE+FPK YTKE+I+P +KK KFL + +  LEK +D +ICS SDVFVPAISGLFYA
Sbjct  287  SLSTLKEIFPKIYTKENIIPAEKKDKFLKSGSPGLEKALDFHICSRSDVFVPAISGLFYA  346

Query  353  NVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            NVAG+RI  GKTQILVP + +++S S TD++S +VS+K+H AYSCFC
Sbjct  347  NVAGQRIPYGKTQILVP-NGSSTSTSATDYLSAFVSQKSHLAYSCFC  392



>ref|XP_006660799.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=422

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +AVD++ ++L KK+C+ +G  R + CY PQE+  FL+K+GF++ TTIYLT+T W  SL++
Sbjct  260  IAVDMQTELLEKKNCKTSGGSRRRGCYYPQEVLNFLKKVGFSANTTIYLTETWWHKSLNT  319

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ IMP   K +FL +  S L + +D  ICSESDVFVPAI GLFY +VAG
Sbjct  320  LKEAFPNTYTKDDIMPAANKGEFLKSGDSYLARALDLKICSESDVFVPAIPGLFYGHVAG  379

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG T I+VPA ++++SA  ++ IS Y+SKK+H AYSC+C
Sbjct  380  KRIASGLTNIIVPAPVSSTSALASEFISTYISKKSHLAYSCYC  422



>ref|XP_011077745.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=417

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++LGKKSC+      SK C + +EI  FL K+GF++ TTIYLTQT W SSL+
Sbjct  257  FIAVDLRVEMLGKKSCRETDE-TSKQCQNAEEIGVFLEKIGFHTDTTIYLTQTGWHSSLN  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+++FP T+TKE+I+P D+KAKF+D+++ E EK ID Y+C+  DVFVPA    FYA++ 
Sbjct  316  ALRDVFPNTFTKEAIIPADEKAKFMDSESHEYEKFIDFYMCTVGDVFVPAFRSRFYASIV  375

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            GKRI  G TQIL+PA  T +SA+  D+IS Y++KK+HFAYSCFC
Sbjct  376  GKRIGDGNTQILLPAMNTTTSAA--DYISPYIAKKSHFAYSCFC  417



>ref|XP_002462607.1| hypothetical protein SORBIDRAFT_02g028940 [Sorghum bicolor]
 gb|EER99128.1| hypothetical protein SORBIDRAFT_02g028940 [Sorghum bicolor]
Length=422

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DLR D+L KKSC+     R K CY+P+E+  FLR +GF++ TTIYLT+T W   L+ 
Sbjct  261  LAIDLRTDLLEKKSCKTTRGARRKGCYNPEEVLAFLRNVGFSANTTIYLTETWWHKGLND  320

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ IMP + K +FL +  ++L + +D  ICS+SDVF+PA++GLFY +V G
Sbjct  321  LKEEFPNTYTKDDIMPAENKGEFLKSSNADLARALDLEICSQSDVFIPAVAGLFYGHVTG  380

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG+TQI+VP+  +++S   +D IS Y+S KNH AYSC+C
Sbjct  381  KRIASGRTQIIVPSQ-SSTSTHASDFISTYISNKNHLAYSCYC  422



>gb|ABR16242.1| unknown [Picea sitchensis]
Length=428

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQ-GNGSPRS--KSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDS  172
            FVA+DLR+DIL +K C+   GS RS  K C+  Q++  FLRK+GF + T +YLTQ+ W  
Sbjct  262  FVAIDLRMDILLEKGCENAGGSIRSGTKKCFGAQDVGIFLRKVGFQTDTPLYLTQSTWHE  321

Query  173  SLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYA  352
            +L+SLK++FP  YTKE+ MP D+K +   +  +E E+ +D +ICS SDVFVPAISG+FYA
Sbjct  322  NLNSLKDIFPNVYTKENSMPSDEKEQLFHSGRTEFERALDFFICSNSDVFVPAISGMFYA  381

Query  353  NVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            NV G RIA+G+TQILVP     S+A L+D +S Y+  KNH AYSC C
Sbjct  382  NVVGHRIAAGRTQILVPTTKQNSTALLSDSVSRYIIDKNHLAYSCLC  428



>ref|NP_001143681.1| uncharacterized protein LOC100276406 [Zea mays]
 gb|ACG34025.1| hypothetical protein [Zea mays]
 gb|ACN29160.1| unknown [Zea mays]
 tpg|DAA62118.1| TPA: hypothetical protein ZEAMMB73_312698 [Zea mays]
Length=421

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DLR D+L KKSC+     R K CY+P E+  FLR +GF++ TTIYLT+T W   L+ 
Sbjct  260  LAIDLRTDLLEKKSCKTTSGARRKGCYNPNEVLAFLRSVGFSANTTIYLTETWWHKGLND  319

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ IMP + K +FL +  ++L   +D  ICS+SDVF+PA++GLFY +V G
Sbjct  320  LKEEFPNTYTKDDIMPAENKGEFLKSSNADLASALDLEICSQSDVFIPAVAGLFYGHVTG  379

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG+TQI+VP+  +++S   +D  S Y+S KNH AY+C+C
Sbjct  380  KRIASGRTQIIVPSQ-SSTSTHASDFTSTYISNKNHLAYTCYC  421



>ref|NP_001131433.1| uncharacterized protein LOC100192765 [Zea mays]
 gb|ACF79838.1| unknown [Zea mays]
 tpg|DAA40441.1| TPA: hypothetical protein ZEAMMB73_044632 [Zea mays]
Length=421

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 119/163 (73%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DLR D+L KKSC+     R K CYSP E+  FLR +GF++ TTIYLT+T W   LD 
Sbjct  260  LAIDLRTDLLEKKSCKTTRGARRKGCYSPDEVLAFLRSVGFSANTTIYLTETSWYKGLDV  319

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP T+ K  IMP + KA+FL +  ++L + +D  ICS+SDVFVPA++GLFY +V G
Sbjct  320  LKEEFPNTWYKGDIMPAENKAEFLKSSNADLARALDLEICSQSDVFVPAVAGLFYGHVTG  379

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG+TQI+VP+  +++S   +D IS Y+S KNH AY+C+C
Sbjct  380  KRIASGRTQIVVPSQ-SSTSTHASDFISTYISNKNHLAYACYC  421



>ref|XP_004957253.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=420

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DLR D+L KK+C+     R K CY+  E+  FLR +GF++ TTIYLT+T W   L+ 
Sbjct  260  LAIDLRTDLLEKKACKTTRGARRKGCYNTDEVLGFLRSVGFSANTTIYLTETWWHKGLND  319

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
            LKE FP TYTK+ I+P + K +FL A  ++L + +D  ICS+SDVFVPAI+GLFY +V G
Sbjct  320  LKEEFPNTYTKDDIIPAENKGEFLKASNADLARALDLEICSQSDVFVPAIAGLFYGHVTG  379

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG+TQILVP+   ++ AS  D IS Y+S KNH AY C+C
Sbjct  380  KRIASGRTQILVPSPSASTQAS--DFISTYISSKNHLAYKCYC  420



>ref|XP_009617901.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDL+V+ LG   C+GN   ++K CY+ +EI +FL+K+GF   TTIYLTQ  W SS+D
Sbjct  257  FVAVDLKVEALGS-MCKGN-VIKTKQCYNAKEIGEFLKKIGFQRHTTIYLTQNGWHSSID  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FP T+TK++I+P  +KAK+    + E EKVID  IC+++DVFVP IS LFY NV 
Sbjct  315  ALREIFPNTFTKDAIIPAYEKAKYQITKSPEFEKVIDFQICTQADVFVPTISNLFYTNVV  374

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
             KRIASGKT++LVP    ++S+   +++S Y+SKK+H+AYSC C
Sbjct  375  AKRIASGKTEVLVPTQKVSTSSVAMEYVSPYISKKSHWAYSCLC  418



>gb|ABR18129.1| unknown [Picea sitchensis]
Length=426

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKS----CYSPQEIAQFLRKLGFNSGTTIYLTQTRWD  169
            F+AVDLRVD+L +K C  + S   KS    C +  E+ +FL++LGF + T IYLTQ+RWD
Sbjct  257  FIAVDLRVDLLQRKGCTNSTSEHDKSKTKKCVTALEVGEFLKELGFPTDTAIYLTQSRWD  316

Query  170  SSLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFY  349
            ++LD L+E+FP  YTKE  MP +++ + L +  ++ EK +D YICS+SD+FVPAISG+FY
Sbjct  317  ATLDPLREIFPNVYTKEYSMPFNEERQILYSGKTQFEKALDFYICSQSDIFVPAISGMFY  376

Query  350  ANVAGKRIASGKTQILVPADI--TASSASLTDHISHYVSKKNHFAYSCFC  493
            + VAG+RI+ GKTQILVP+    T S   L D +S YV+KK+H  YSCFC
Sbjct  377  STVAGQRISLGKTQILVPSSKHDTTSKIRLVDSLSRYVTKKDHSVYSCFC  426



>emb|CBI17884.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  128  NSGTTIYLTQTRWDSSLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICS  307
            N  TTIYLTQ +W  SLD+L+++FPKTYTKE +MP DKKAKFL ++  E EKVID YICS
Sbjct  101  NVDTTIYLTQFQWHLSLDALRKIFPKTYTKEGVMPADKKAKFLSSENYEFEKVIDFYICS  160

Query  308  ESDVFVPAISGLFYANVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSC  487
            +SDVFVP++SGLFYAN  GKRIASGK+QILVPA +T SSA     IS Y+S+KNHFAYSC
Sbjct  161  QSDVFVPSVSGLFYANAVGKRIASGKSQILVPAQVTVSSALNFSFISPYISRKNHFAYSC  220

Query  488  FC  493
            FC
Sbjct  221  FC  222



>gb|EYU38735.1| hypothetical protein MIMGU_mgv1a007007mg [Erythranthe guttata]
Length=423

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR D+L  KSCQ       K+C++ +E+++F  K+GF+S TT Y+TQT W S+L+
Sbjct  261  FVAVDLRDDMLEGKSCQEKNDAEEKTCFNAEELSKFFIKIGFHSDTTFYVTQTGWSSNLN  320

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             L+++FP T TK++I+P D+KAKF+D  + E EK ID Y+C E DVF+PA  G FY +V 
Sbjct  321  PLRKVFPNTLTKDAIIPADQKAKFMDLKSREYEKFIDYYMCVEGDVFIPAFRGRFYGSVV  380

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RIA G TQI +P+  T SS S  D+IS YVSKK+H AYSC+C
Sbjct  381  GERIAYGNTQIFLPSKNT-SSESAVDYISPYVSKKSHVAYSCYC  423



>emb|CAN79033.1| hypothetical protein VITISV_027517 [Vitis vinifera]
Length=415

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR  +L ++ C+   +   K+CY+ +EI  FL+K+GF+  T IYLTQ++W  SLD
Sbjct  257  FVAVDLRFXVL-ERECRRREAKGKKNCYNAEEIGVFLKKIGFDRDTAIYLTQSKWHHSLD  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FPKT+TKE IMP +KKAKFL +++SE EK ID YICSESDVFVP+ISGLFYANV 
Sbjct  316  ALREIFPKTFTKEGIMPAEKKAKFLSSESSEFEKAIDFYICSESDVFVPSISGLFYANVV  375

Query  362  GKRIASGKTQILVPA  406
            GKRIASGK+QILVPA
Sbjct  376  GKRIASGKSQILVPA  390



>ref|XP_010656876.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Vitis vinifera]
 ref|XP_010656877.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Vitis vinifera]
Length=398

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR  +L ++ C+   +   K+CY+ +EI  FL+K+GF+  T IYLTQ++W  SLD
Sbjct  257  FVAVDLRFKVL-ERECRRREAKGKKNCYNAEEIGVFLKKIGFDRDTAIYLTQSKWHHSLD  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FPKT+TKE IM  +KKAKFL +++SE EK ID YICSESDVFVP+ISGLFYANV 
Sbjct  316  ALREIFPKTFTKEGIMLAEKKAKFLSSESSEFEKAIDFYICSESDVFVPSISGLFYANVV  375

Query  362  GKRIASGKTQILVPADI  412
            GKRIASGK+QILVPA +
Sbjct  376  GKRIASGKSQILVPAQV  392



>ref|XP_009785320.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=418

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DL+V+ L +  C+GN   ++K CY+ +EI +FL+K+GF   TTIYLTQ  W  SLD
Sbjct  257  FVALDLKVEAL-ESMCKGN-VIKTKHCYNAKEIGEFLKKIGFQRHTTIYLTQNGWHKSLD  314

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FP T+TK++I+P  +KAK+    + E EKVID  IC+++DVFVP IS LFY NV 
Sbjct  315  ALREIFPNTFTKDAIIPAYEKAKYQITKSPEFEKVIDFQICTQADVFVPTISNLFYTNVV  374

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
             KRIAS KT++LVP+   ++S++  +++S Y+SKK+H+AYSCFC
Sbjct  375  AKRIASEKTEVLVPSQKVSTSSAAMEYVSPYISKKSHWAYSCFC  418



>ref|XP_010656874.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Vitis vinifera]
Length=422

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVAVDLR  +L ++ C+   +   K+CY+ +EI  FL+K+GF+  T IYLTQ++W  SLD
Sbjct  257  FVAVDLRFKVL-ERECRRREAKGKKNCYNAEEIGVFLKKIGFDRDTAIYLTQSKWHHSLD  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
            +L+E+FPKT+TKE IM  +KKAKFL +++SE EK ID YICSESDVFVP+ISGLFYANV 
Sbjct  316  ALREIFPKTFTKEGIMLAEKKAKFLSSESSEFEKAIDFYICSESDVFVPSISGLFYANVV  375

Query  362  GKRIASGKTQILVPA  406
            GKRIASGK+QILVPA
Sbjct  376  GKRIASGKSQILVPA  390



>emb|CDP20249.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +2

Query  2    FVAVDLRV-DILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSL  178
            F+ VD++V +   K SCQ N +   + CY  +EI QFL K+GF  GTT+YLTQT W  SL
Sbjct  257  FITVDVKVTEFKNKLSCQRNDTTSKEYCYGAEEIGQFLEKIGFRKGTTVYLTQTEWHESL  316

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              L++ FP T+TK+++MPID KA++LD+   E EK ID Y+C +SDVFV     +FY NV
Sbjct  317  RPLRKYFPNTFTKDAVMPIDLKARYLDSGNFEYEKFIDFYLCMQSDVFVATTMNMFYNNV  376

Query  359  AGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            A  RIASGKTQIL+PA+  ++SA+  D++S ++ KKNH AYSC C
Sbjct  377  AEMRIASGKTQILIPANKLSTSAA--DYLSPHILKKNHMAYSCLC  419



>gb|EYU18195.1| hypothetical protein MIMGU_mgv1a023399mg [Erythranthe guttata]
Length=421

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQ---GNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDS  172
            FV+VDLR ++  + SC+    +G    + CY+ + I +FL+K+GF+  TT+YLTQT WD+
Sbjct  258  FVSVDLRAEMFTETSCKLLGSSGGHNKRWCYNGERIGEFLKKIGFHEDTTVYLTQTGWDT  317

Query  173  SLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYA  352
            SL++L+++FP T+TK++IMP D+KAKF DA++    K ID Y+C++ DVFVPA    FY 
Sbjct  318  SLNALRDVFPNTFTKDAIMPADEKAKFTDAES---RKTIDFYVCAQGDVFVPAYPSRFYE  374

Query  353  NVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
             V G+RI  GKTQI +PA+  ++S S TD++S YV+ ++HFA+SCFC
Sbjct  375  AVVGERIGLGKTQIFIPAEKDSNSDSATDYVSPYVANRSHFAHSCFC  421



>gb|KCW78621.1| hypothetical protein EUGRSUZ_C00086 [Eucalyptus grandis]
Length=292

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV+ L   SCQ +GS   K CY  Q+  + L K+G ++ T IY+T++RW  +L 
Sbjct  134  FIAVDLRVEALQGNSCQRSGSVEMKFCYHAQDFGEILTKIGISTETPIYVTRSRWHKNLK  193

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             LK++FPKTYTKE +MP DKK  F+ + + ELEKV+  ++ SESD+FVPA + LFYA VA
Sbjct  194  PLKDIFPKTYTKEFLMPPDKKEMFVSSASCELEKVMGFHLASESDIFVPASADLFYATVA  253

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCF  490
            G RIASG+T+ILVP     +S S   HIS Y+S+K H+AYSCF
Sbjct  254  GSRIASGRTRILVP-----TSTSSLSHISPYISEKKHYAYSCF  291



>ref|XP_004243033.1| PREDICTED: uncharacterized protein LOC101261246 [Solanum lycopersicum]
Length=419

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            FVA+DL+V+ LG   C+GN   ++K C+  ++I +FL+K+G+   TTIYLTQ+ W SSLD
Sbjct  258  FVAMDLKVESLGN-LCKGN-VIKTKDCFEAKDIGEFLKKIGYQRHTTIYLTQSGWHSSLD  315

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
              +++FP T+TK++I+P  +KAK+    +S+ EKVID  +C+++DVFVP IS LFY NV 
Sbjct  316  DFRKIFPNTFTKDAIIPAYEKAKYQITKSSDFEKVIDFQVCTQADVFVPTISNLFYTNVV  375

Query  362  GKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
             KRIASGKT++L P    ++S+S+ +++S Y+SKK+H+AYSCFC
Sbjct  376  AKRIASGKTEVLDPTQKDSTSSSIVNYVSPYISKKSHWAYSCFC  419



>gb|EMT00881.1| hypothetical protein F775_06359 [Aegilops tauschii]
Length=441

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 105/163 (64%), Gaps = 23/163 (14%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +AVD R D+L KK+C+ +   R K CY+PQE+  FL+K+ FN  + I             
Sbjct  302  LAVDTRTDLLEKKTCKTSAGARRKGCYNPQEVLNFLKKI-FNLQSVI-------------  347

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
                      ++ IMP +KK +FL++  S+L + +D  ICS+SDVFVPAI G+FY NVAG
Sbjct  348  ---------AQDDIMPAEKKGEFLNSGDSDLARALDLEICSQSDVFVPAIPGMFYGNVAG  398

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIASG TQILVPA +   SA  +D +S Y++KK+HFAYSC+C
Sbjct  399  KRIASGLTQILVPAPVVGGSAQASDFVSTYITKKSHFAYSCYC  441



>gb|EMS49507.1| hypothetical protein TRIUR3_13058 [Triticum urartu]
Length=358

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 33/163 (20%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +AVD+R D+L KK+C+ +   R K CY+PQE+  FL+K                      
Sbjct  229  LAVDMRTDLLEKKTCKTSAGARRKGCYNPQEVLNFLKK----------------------  266

Query  185  LKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAG  364
                       + IMP +KK +FL++  S+L + +D  +CS++DVFVPAI G+FY NVAG
Sbjct  267  -----------DDIMPAEKKGEFLNSGDSDLARALDLEVCSQTDVFVPAIPGMFYGNVAG  315

Query  365  KRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            KRIA+G TQILVPA +   SA  +D +S Y++KK+HFAYSC+C
Sbjct  316  KRIAAGLTQILVPAPVVGGSAQASDFVSTYITKKSHFAYSCYC  358



>ref|XP_006840309.1| hypothetical protein AMTR_s00045p00073910 [Amborella trichopoda]
 gb|ERN01984.1| hypothetical protein AMTR_s00045p00073910 [Amborella trichopoda]
Length=426

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 99/168 (59%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSP----RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWD  169
            F+ +DLRV+ L +  C  + +      +K C +   I  FL  +GF   T IYLTQ+RWD
Sbjct  253  FICLDLRVEYLLRNGCNFSMNEGDILDNKKCVNVSYIGGFLEHIGFPEDTAIYLTQSRWD  312

Query  170  SSLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFY  349
              L+ L + F   +TKE  MP +++ + L +  +  E+ +D YICS SDVFVPA SG+FY
Sbjct  313  MRLNPLGKTFLNIHTKEYSMPFNEEKQILYSGNTRFERALDFYICSRSDVFVPASSGMFY  372

Query  350  ANVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
             +VAG+RI  G T ILVP     SS +    +S YV+++ HF Y C C
Sbjct  373  THVAGERILLGNTHILVPFR-RCSSLAKDCPMSRYVTRREHFVYKCAC  419



>gb|KHN17373.1| Auxin response factor 8 [Glycine soja]
Length=207

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+ VDLRV++L KK CQG  S + +SC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  105  FIVVDLRVEMLDKKGCQGRDSEKEESCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  164

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDA  262
            SLK+LFPKTYTKESI+P DKK ++LD+
Sbjct  165  SLKDLFPKTYTKESIIPADKKKRYLDS  191



>ref|XP_001768259.1| predicted protein [Physcomitrella patens]
 gb|EDQ66873.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 95/168 (57%), Gaps = 4/168 (2%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            +VAVD R      +  +     +SK C SP+ +   L+  GF   T IYLTQTR D S D
Sbjct  240  YVAVDYRSTDTACEEERDVVHTKSKRCLSPRALGLLLQSHGFARETAIYLTQTRLDESFD  299

Query  182  SLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVA  361
             L  LFP   TKE  MP +++++FL +  ++LE  ID YICS SDV VP  S  FY  VA
Sbjct  300  PLLNLFPNVITKEYSMPFNEESQFLYSGRTQLELAIDFYICSHSDVLVPIHSNTFYTAVA  359

Query  362  GKRIASGKTQILVPADIT----ASSASLTDHISHYVSKKNHFAYSCFC  493
            G+RI  G   ILVP+ +T    A+  +L   +S  V+ K H AYSC C
Sbjct  360  GERIKLGLPHILVPSLVTRPKQATETTLLLGVSQMVAAKTHPAYSCLC  407



>gb|KHN10874.1| hypothetical protein glysoja_050265 [Glycine soja]
Length=97

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+AVDLRV++L KK CQG  S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  23   FIAVDLRVEMLDKKGCQGRDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  82

Query  182  SLKELFPKTYTK  217
            SLK+LFPKTYTK
Sbjct  83   SLKDLFPKTYTK  94



>gb|KHN22353.1| Auxin response factor 8 [Glycine soja]
Length=171

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+ VDLRV++L KK CQG  S + KSC++ QE+A FLRK+GF   TTIY+TQ+RWD SLD
Sbjct  95   FIVVDLRVEMLDKKGCQGRDSEKEKSCFNAQEVAVFLRKIGFEKDTTIYVTQSRWDESLD  154

Query  182  SLKELFPKTYTK  217
            SLK+LFPKTYTK
Sbjct  155  SLKDLFPKTYTK  166



>ref|XP_001769456.1| predicted protein [Physcomitrella patens]
 gb|EDQ65825.1| predicted protein, partial [Physcomitrella patens]
Length=340

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 93/172 (54%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSC---QGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDS  172
            +VAVD R      K+C     N     K C SP ++   L+  GF   T IYLTQTR D 
Sbjct  154  YVAVDYRST---DKACGQRTDNVFTMPKGCLSPLDLGLLLQSHGFARETAIYLTQTRLDE  210

Query  173  SLDSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYA  352
            S D L +L+P   TKE  MP +++ +FL +  ++ E  ID YICS SDV VP  S  FY 
Sbjct  211  SFDPLLKLYPIVITKEYSMPFNEENQFLYSGMTQFELAIDFYICSHSDVLVPIHSSTFYT  270

Query  353  NVAGKRIASGKTQILVP-----ADITASSASLTDHISHYVSKKNHFAYSCFC  493
             +AG+RI  G T +LVP     A     + SLT  +   V+K+ H AYSC C
Sbjct  271  ALAGERIKQGFTHMLVPRLLRIAREAPEATSLTLGVPRIVTKRLHPAYSCLC  322



>emb|CAN79661.1| hypothetical protein VITISV_004325 [Vitis vinifera]
Length=352

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  218  ESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQIL  397
            E +MP DKKAKFL +   E EKVID YICS+SDVFVP++SGLFYAN  GKRIASGK+QIL
Sbjct  242  EGVMPADKKAKFLSSXNYEFEKVIDFYICSQSDVFVPSVSGLFYANAVGKRIASGKSQIL  301

Query  398  VPADI  412
            VPA +
Sbjct  302  VPAQV  306



>ref|XP_009399603.1| PREDICTED: uncharacterized protein LOC103983964 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLD  181
            F+A+DLR D L K+ C+     RSK+C+  +E A+FLR++GFN    IY+TQTRWD SLD
Sbjct  187  FIAIDLRSDALVKRGCK-ESDGRSKACFGARETAEFLRRIGFNGDNPIYVTQTRWDESLD  245

Query  182  SLKELFPKTYTKES  223
             L+E FP++YTK S
Sbjct  246  PLREFFPRSYTKVS  259



>ref|XP_008645321.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
Length=334

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    VAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSSLDS  184
            +A+DLR D+L KKSC+     R K CYSP E+  FLR +GF++ TTIYLT+T W   LD 
Sbjct  258  LAIDLRTDLLEKKSCKTTRGARRKGCYSPDEVLAFLRSVGFSANTTIYLTETSWHKGLDV  317

Query  185  LKELFPKTY  211
            LKE FP T+
Sbjct  318  LKEEFPNTW  326



>gb|EYU18193.1| hypothetical protein MIMGU_mgv1a018780mg, partial [Erythranthe 
guttata]
Length=106

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQ--GNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSS  175
            FV+VDL V++L + SC+   +G    + CY+ ++I +FL+K+GF+  T++YLTQT WD+S
Sbjct  33   FVSVDLHVEMLTETSCKLLESGGRNRRWCYNSEKIGEFLKKIGFHEDTSVYLTQTGWDTS  92

Query  176  LDSLKELFPKTYTK  217
            L++L+ +FP T+TK
Sbjct  93   LNALRNVFPNTFTK  106



>gb|EYU18194.1| hypothetical protein MIMGU_mgv1a024726mg, partial [Erythranthe 
guttata]
Length=106

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQ--GNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTRWDSS  175
            FV+VDL V++L + SC+   +     + CY+  +I +FL+K+GF+  TT+YLTQT WD+S
Sbjct  33   FVSVDLHVEMLTETSCKLLESSGHNKRWCYNSSKIGEFLKKIGFHEDTTVYLTQTGWDTS  92

Query  176  LDSLKELFPKTYTK  217
            L++L+ +FP T+TK
Sbjct  93   LNALRNVFPNTFTK  106



>gb|AEW09387.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus lambertiana]
 gb|AFB34944.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34945.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34946.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34947.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34948.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34949.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34950.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34951.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
 gb|AFB34952.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus cembra]
Length=55

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  329  AISGLFYANVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AISG+FYANV G+RIA+G+TQILVP     S+A L+D +S Y+  KNH AYSC C
Sbjct  1    AISGMFYANVVGQRIAAGRTQILVPTTKQNSAAMLSDSVSRYIIDKNHLAYSCLC  55



>gb|AEW09386.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus radiata]
 gb|AFB34953.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus mugo]
 gb|AFB34954.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus mugo]
 gb|AFB34955.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus mugo]
 gb|AFB34956.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus mugo]
 gb|AFB34957.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus mugo]
 gb|AFG65782.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65783.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65784.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65785.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65786.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65787.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65788.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65789.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65790.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65791.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65792.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65793.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65794.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65795.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65796.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65797.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65798.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
 gb|AFG65799.1| hypothetical protein UMN_CL309Contig1_03, partial [Pinus taeda]
Length=55

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  329  AISGLFYANVAGKRIASGKTQILVPADITASSASLTDHISHYVSKKNHFAYSCFC  493
            AISG+FYANV G+RIA+G+TQILVP     S A L+D +S Y+  KNH AYSC C
Sbjct  1    AISGMFYANVVGQRIAAGRTQILVPTTKQNSVAMLSDSVSRYIIDKNHLAYSCLC  55



>ref|XP_007155670.1| hypothetical protein PHAVU_003G221400g [Phaseolus vulgaris]
 gb|ESW27664.1| hypothetical protein PHAVU_003G221400g [Phaseolus vulgaris]
Length=530

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 6/128 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        D +++ LK LFP  YTKE  M  +
Sbjct  322  RGKCPLTPHEVGLMLRALGFTNDTYLYVASGEIYGGDETMEPLKNLFPNIYTKE--MLAE  379

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            ++ K L+  +S L   ID  +C ES+VFV   +G     +AG+R   G  +I+ P     
Sbjct  380  EELKPLNPYSSRL-AAIDYIVCDESNVFVTNNNGNMAKILAGRRRYMGHKRIIRPNAKKL  438

Query  419  SSASLTDH  442
            S+  ++ H
Sbjct  439  SALFMSRH  446



>ref|XP_010542225.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=570

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 59/120 (49%), Gaps = 16/120 (13%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKE-----S  223
            R K   +PQE+   LR LGF +GT IY+        + +L  L+ELFP  YTKE      
Sbjct  358  RGKCPLTPQEVGLMLRALGFGNGTYIYVASGEIYGGEETLQPLRELFPNFYTKEMLANDE  417

Query  224  IMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            IMP  + +  L A        ID  +C ESDVF+   +G     +AG+R   G  + + P
Sbjct  418  IMPFLRYSSRLAA--------IDYIVCDESDVFITNNNGNMAKILAGRRRYMGHKRTIRP  469



>ref|XP_010240213.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Brachypodium 
distachyon]
Length=506

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 6/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L +     +   R K   +P EI   LR LGF + T +Y+        + +L  L+
Sbjct  304  RWDTLPQDLSAEDERNRGKCLLTPHEIGLMLRALGFGNDTYLYVASGEIYGGEETLKPLR  363

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            ELFP  YTKE ++  D K  FL    S     ID  +C ESDVFV   +G     +AG+R
Sbjct  364  ELFPNFYTKEMLVGDDLKP-FL--SFSSRMAAIDFIVCDESDVFVTNNNGNMAKVLAGRR  420

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  421  RYMGHKRTIRP  431



>gb|KHG20792.1| hypothetical protein F383_01946 [Gossypium arboreum]
Length=551

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L+ LK+LFP  YTKE I+  D
Sbjct  331  RDKCPLTPHEVGLMLRALGFENDTYIYVASGEIYGGEETLEPLKDLFPNFYTKE-ILAND  389

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
                FL    S     ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  390  HLKPFLPF--SSCLAAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  442



>ref|XP_003580282.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Brachypodium 
distachyon]
Length=505

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P EI   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++  D
Sbjct  319  RGKCLLTPHEIGLMLRALGFGNDTYLYVASGEIYGGEETLKPLRELFPNFYTKEMLVGDD  378

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL    S     ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  379  LKP-FL--SFSSRMAAIDFIVCDESDVFVTNNNGNMAKVLAGRRRYMGHKRTIRP  430



>ref|XP_007157293.1| hypothetical protein PHAVU_002G057900g [Phaseolus vulgaris]
 gb|ESW29287.1| hypothetical protein PHAVU_002G057900g [Phaseolus vulgaris]
Length=547

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF++ T +Y+        D ++  LK+LFP  YTKE  M  D
Sbjct  342  RGKCPLTPHEVGLMLRALGFSNDTYLYVASGEIYGGDETMQPLKDLFPNIYTKE--MLAD  399

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  400  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  453



>ref|XP_002510658.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52845.1| conserved hypothetical protein [Ricinus communis]
Length=570

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQT---RWDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LG+ S   IY+      R + SL  LKELFP  YTKE+I   
Sbjct  324  RHGKCPLTPKEVGLMLRALGYGSDVHIYVASGEVYRGEESLAPLKELFPNFYTKETIAGK  383

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++   FL    S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  384  EELEPFL--SFSSRMAALDFIVCDESDVFVTNNNGNMARILAGRRRYFGHKPTIRP  437



>ref|XP_004508925.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=542

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   SP E+   LR LGF + T +Y+        D ++  LK+LFP  YTKE  M ++
Sbjct  329  RGKCPLSPHEVGLMLRALGFTNDTYLYVASGEIYGGDETMKPLKDLFPNIYTKE--MLVE  386

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K   + +S L   ID  +C ES+VFV   +G     +AG+R   G  + + P
Sbjct  387  EELKPFLSFSSRL-AAIDYIVCDESNVFVANNNGNMARILAGRRRYMGHKRTIRP  440



>ref|XP_002448290.1| hypothetical protein SORBIDRAFT_06g024620 [Sorghum bicolor]
 gb|EES12618.1| hypothetical protein SORBIDRAFT_06g024620 [Sorghum bicolor]
Length=500

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 65/131 (50%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +P E+   LR LGF++ T +Y+        D +L  L+
Sbjct  309  RWDTLPELSAEEERS-RGKCPLTPHEVGLMLRALGFDNDTLLYVASGEIYGGDETLQPLR  367

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            ELFP  YTKE +   D    FL   +S L   ID  +C ESDVFV   +G     +AG+R
Sbjct  368  ELFPNFYTKEKLAG-DDLNPFLPF-SSRLA-AIDFIVCDESDVFVTNNNGNMAKVLAGRR  424

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  425  RYMGHKRTIRP  435



>ref|XP_003611321.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES94279.1| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=509

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        D ++  LK+LFP  YTKE  M  D
Sbjct  329  RGKCPLTPHEVGLMLRALGFTNDTYLYVASGEIYGGDETMQPLKDLFPNIYTKE--MLAD  386

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L  V D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  387  EELKPFLPFSSRLAAV-DYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  440



>ref|XP_003550910.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN09828.1| DUF246 domain-containing protein [Glycine soja]
Length=548

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 5/128 (4%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        D ++  LK+LFP  YTKE ++  +
Sbjct  336  RGKCPLTPHEVGLMLRALGFTNDTYLYVASGEIYGGDGTMQPLKDLFPNIYTKE-MLAQE  394

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            ++ K     +S L   ID  +C ES+VFV   +G     +AG+R   G  + + P     
Sbjct  395  EELKPFHPFSSRL-AAIDYIVCDESNVFVTNNNGNMAKILAGRRRYMGHKRTIRPNAKKL  453

Query  419  SSASLTDH  442
            S+  ++ H
Sbjct  454  SALFMSRH  461



>ref|XP_004976441.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=500

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +P E+   LR LGF + T +Y+        + +L  L+
Sbjct  309  RWDTLPELSAEDERS-RGKCPLTPHEVGLMLRALGFGNDTNLYVASGEIYGGEETLRPLR  367

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            ELFP  YTKE +   D K   L    S     ID  +C ESDVFV   +G     +AG+R
Sbjct  368  ELFPNFYTKEMLAGDDLK---LFLPFSSRLAAIDFIVCDESDVFVTNNNGNMAKVLAGRR  424

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  425  RYMGHKRTIRP  435



>ref|XP_010242865.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=580

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 5/135 (4%)
 Frame = +2

Query  8    AVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSL  178
            A+  R   L ++S         K   +P+E+   LR LGF S   IY+        + +L
Sbjct  306  AIRKRWKTLHQRSNPDKERRHGKCPLTPEEVGLMLRALGFGSDIHIYVASGEVYGGEETL  365

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              LK LFP  YTKE+I   ++ A F  +  S     +D  +C ESDVFV   +G     +
Sbjct  366  APLKALFPNFYTKETISSKEELAPF--SSFSSRMAALDFIVCDESDVFVTNNNGNMARML  423

Query  359  AGKRIASGKTQILVP  403
            AG+R   G  + + P
Sbjct  424  AGRRRYFGHKRTIRP  438



>ref|XP_010055484.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW71958.1| hypothetical protein EUGRSUZ_E00413 [Eucalyptus grandis]
Length=554

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF++ T IY+        + +L  L+ELFP  YTKE +   D
Sbjct  353  RGKCPLTPHEVGLMLRALGFSNDTYIYVASGEIYGGEKTLQPLRELFPNFYTKEMLANDD  412

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  413  LKP-FLPF-SSRLA-AIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  464



>ref|XP_011088688.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=595

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 57/115 (50%), Gaps = 5/115 (4%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   SP+E+   LR LGF +   IY+        + +L  LK LFP  +TKE+I   +
Sbjct  343  RGKCPLSPEEVGLMLRALGFGNDVHIYVASGEVYGGEETLAHLKALFPNFHTKETIASKE  402

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            + A+F  +  S     +D  +C ESDVFV   +G     +AGKR   G    + P
Sbjct  403  ELAEF--SSYSSRMAALDFIVCDESDVFVTNNNGNMAKILAGKRRYFGHKPTIRP  455



>ref|XP_010933656.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=502

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + SL  LK+LFP  +TKE +   D
Sbjct  321  RGKCPLTPHEVGLMLRALGFENDTHIYIASGEIYGGEQSLQPLKDLFPNLHTKEMLAGDD  380

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  381  LKP-FLPF-SSRLA-AIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  432



>ref|XP_009621470.1| PREDICTED: uncharacterized protein LOC104113082 [Nicotiana tomentosiformis]
Length=192

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    FVAVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTT--IYLTQTR--WD  169
             + +D+R+ IL  K CQGN + RSKSCY PQ+ A + R +GF   T+  I L   R    
Sbjct  109  LITIDVRIVILENKGCQGNCASRSKSCYGPQDTALYFRYIGFTKDTSALIMLKAMRDIEQ  168

Query  170  SSLDSLKELFP  202
            S+ D+ K L+P
Sbjct  169  SAYDNAKSLWP  179



>gb|KDP39880.1| hypothetical protein JCGZ_03411 [Jatropha curcas]
Length=549

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 7/135 (5%)
 Frame = +2

Query  8    AVDLRVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSL  178
            A+  R D L   S +   + R K   +P E+   LR LGF + T IY+        + +L
Sbjct  334  AIRKRWDTLPDLSAEEERA-RGKCPLTPHEVGLMLRALGFANDTYIYVASGEIYGGEETL  392

Query  179  DSLKELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANV  358
              L+ELFP  YTKE  M  +++ K     +S L   ID  +C ESDVFV   +G     +
Sbjct  393  RPLRELFPNFYTKE--MLANEELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKIL  449

Query  359  AGKRIASGKTQILVP  403
            AG+R  +G  + + P
Sbjct  450  AGRRRYAGHKRTIRP  464



>ref|XP_006440300.1| hypothetical protein CICLE_v10019483mg [Citrus clementina]
 gb|ESR53540.1| hypothetical protein CICLE_v10019483mg [Citrus clementina]
Length=575

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE  M  D
Sbjct  348  RGKCPLTPHEVGLMLRALGFANDTHLYVASGEIYGGEETLRPLRELFPNFYTKE--MLAD  405

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  406  EELKPFLQFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  459



>ref|NP_001152142.1| growth regulator like protein [Zea mays]
 gb|ACG46049.1| growth regulator like protein [Zea mays]
Length=500

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +P E+   LR LGF + T +Y+        DS+L  L+
Sbjct  309  RWDTLPELSAEDERS-RGKCPLTPHEVGLMLRALGFGNDTLLYVASGEIYGGDSTLQPLR  367

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
             LFP  YTKE +   D    FL   +S L   ID  +C ESDVFV   +G     +AG+R
Sbjct  368  GLFPNFYTKEKLAG-DDLNPFLPF-SSRL-AAIDFIVCDESDVFVTNNNGNMAKVLAGRR  424

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  425  RYMGHKRTIRP  435



>tpg|DAA36552.1| TPA: growth regulator like protein [Zea mays]
Length=500

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +P E+   LR LGF + T +Y+        DS+L  L+
Sbjct  309  RWDTLPELSAEDERS-RGKCPLTPHEVGLMLRALGFGNDTLLYVASGEIYGGDSTLQPLR  367

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
             LFP  YTKE +   D    FL   +S L   ID  +C ESDVFV   +G     +AG+R
Sbjct  368  GLFPNFYTKEKLAG-DDLNPFLPF-SSRL-AAIDFIVCDESDVFVTNNNGNMAKVLAGRR  424

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  425  RYMGHKRTIRP  435



>ref|XP_003525569.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=544

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 5/128 (4%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        D ++  L+++FP  YTKE +   +
Sbjct  334  RGKCPLTPHEVGLMLRALGFTNDTYLYVASGEIYGGDETMQPLRDVFPNIYTKEMLAQKE  393

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            +   FL   +S L   ID  +C ES+VFV   +G     +AG+R   G  + + P     
Sbjct  394  ELKPFLPF-SSRLA-AIDYIVCDESNVFVTNNNGNMAKILAGRRRYMGHKRTIRPNAKKL  451

Query  419  SSASLTDH  442
            S+  ++ H
Sbjct  452  SALFMSRH  459



>gb|KHN44075.1| DUF246 domain-containing protein [Glycine soja]
Length=543

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 5/128 (4%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        D ++  L+++FP  YTKE +   +
Sbjct  333  RGKCPLTPHEVGLMLRALGFTNDTYLYVASGEIYGGDETMQPLRDVFPNIYTKEMLAQKE  392

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            +   FL   +S L   ID  +C ES+VFV   +G     +AG+R   G  + + P     
Sbjct  393  ELKPFLPF-SSRLA-AIDYIVCDESNVFVTNNNGNMAKILAGRRRYMGHKRTIRPNAKKL  450

Query  419  SSASLTDH  442
            S+  ++ H
Sbjct  451  SALFMSRH  458



>ref|XP_002303356.2| hypothetical protein POPTR_0003s07520g [Populus trichocarpa]
 gb|EEE78335.2| hypothetical protein POPTR_0003s07520g [Populus trichocarpa]
Length=581

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++ I+
Sbjct  350  RGKCPLTPHEVGLMLRALGFANDTYLYVASGEIYGGEETLRPLRELFPNFYTKE-MLAIE  408

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   F     S     ID  +C ESDVFV   +G     +AG+R  +G  + + P
Sbjct  409  ELKSFFPF--SSRMAAIDYIVCDESDVFVTNNNGNMAKILAGRRRYAGHKRTIRP  461



>ref|XP_002530648.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31717.1| conserved hypothetical protein [Ricinus communis]
Length=592

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L+ELFP  YTKE  M  +
Sbjct  359  RGKCPLTPHEVGLMLRALGFANDTYIYVASGEIYGGEETLRPLRELFPNFYTKE--MLAN  416

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R  +G  + + P
Sbjct  417  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGQRRYAGHKRTIRP  470



>gb|KJB39735.1| hypothetical protein B456_007G028400 [Gossypium raimondii]
Length=537

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 6/122 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF +   IY+        + +L+ LK+LFP  YTKE +   D
Sbjct  318  RGKCPLTPHEVGLMLRALGFENDAYIYVASGEIYGGEETLEPLKDLFPNLYTKEILANED  377

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
             K  FL    S     ID  +C ESDVFV   +G     +AG+R   G  + + P     
Sbjct  378  LKP-FLPF--SSCLATIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRPNSKRL  434

Query  419  SS  424
            SS
Sbjct  435  SS  436



>ref|XP_006355513.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=589

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P EI   LR LGFN+ T +Y+        + +L  L+ELFP  YTKE ++  +
Sbjct  353  RGKCPLTPHEIGLMLRALGFNNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKE-MLAGE  411

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVF    +G     +AG+R   G  + + P
Sbjct  412  ELQPFLPY-SSRL-AAIDYIVCDESDVFATNNNGNMAKILAGRRRYMGHKRTIRP  464



>ref|XP_011001504.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=577

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++ ++
Sbjct  354  RGKCPLTPHEVGLMLRALGFANNTYLYVASGEIYGGEETLRPLRELFPNFYTKE-MLAVE  412

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
                FL   +S L   ID  +C ESDVFV   +G     +AG+R  +G  + + P
Sbjct  413  DLKPFLPF-SSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGERRYAGHKRTIRP  465



>dbj|BAK04280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P EI   LR LGF + T +Y+        + +L  L+ELFP  YTKE +   D
Sbjct  145  RGKCPLTPHEIGLMLRALGFGNETYLYVASGEIYGGEETLRPLRELFPNFYTKEMLAGDD  204

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L   +D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  205  LKP-FLPF-SSRL-AAVDFIVCDESDVFVTNNNGNMAKVLAGRRRYMGHKRTIRP  256



>ref|XP_006838201.1| hypothetical protein AMTR_s00106p00146200 [Amborella trichopoda]
 gb|ERN00770.1| hypothetical protein AMTR_s00106p00146200 [Amborella trichopoda]
Length=609

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQ---TRWDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + + +Y+      R + +L  L++LFP  YTKE+ +  D
Sbjct  394  RGKCPLTPHEVGLMLRALGFGNDSYLYVASGEIYRGEETLRPLRDLFPNFYTKET-LAAD  452

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++   L   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  453  QEIASLLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  506



>ref|XP_004241998.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum]
Length=540

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R +   +P E+   LR LGF + T +Y+        + SL  LKELFP  YTKE I+  D
Sbjct  328  RGRCPLTPHEVGLMLRALGFKNDTYLYVASGEVYGGEKSLQPLKELFPNFYTKE-IVAGD  386

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVFV   +G     +AG R   G  + + P
Sbjct  387  ELKPFLPY-SSRLA-AIDYVVCDESDVFVTNNNGNMAKILAGSRRYMGHKRTIRP  439



>ref|XP_011031885.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=584

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE +   +
Sbjct  353  RGKCPLTPHEVGLMLRALGFANDTYLYVASGEIYGGEETLRPLRELFPNFYTKEMLAIKE  412

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K+ F     S     ID  +C ESDVFV   +G     +AG+R  +G  + + P
Sbjct  413  LKSFF---PFSSRMAAIDYIVCDESDVFVTNNNGNMAKILAGRRRYAGHKRTIRP  464



>ref|XP_008796107.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Phoenix 
dactylifera]
Length=515

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  LK+LFP  YTKE +   D
Sbjct  321  RGKCPLTPHEVGLMLRALGFENDTHIYIASGEIYGGEQTLQPLKDLFPNFYTKEMLAGDD  380

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  F+   +S L   ID  +C ESDVFV   +G     +AG R   G  + + P
Sbjct  381  LKP-FIPF-SSRLA-AIDYIVCGESDVFVTNNNGNMAKILAGHRRYMGHKRTIRP  432



>ref|XP_010242866.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=579

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   IY+        + +L  LK LFP  YTKE+I   
Sbjct  324  RHGKCPLTPEEVGLMLRALGFGSDIHIYVASGEVYGGEETLAPLKALFPNFYTKETISSK  383

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  384  EELAPF--SSFSSRMAALDFIVCDESDVFVTNNNGNMARMLAGRRRYFGHKRTIRP  437



>ref|XP_010325489.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=495

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGFN+ T +Y+        + +L  L+ELFP  YTKE ++  +
Sbjct  259  RGKCPLTPHEVGLMLRALGFNNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKE-MLAGE  317

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVF    +G     +AG+R   G  + + P
Sbjct  318  ELQPFLPY-SSRL-AAIDYIVCDESDVFATNNNGNMAKILAGRRRYMGHKRTIRP  370



>ref|XP_010538412.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=554

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L+ELFP  YTKE  M  +
Sbjct  338  RGKCPLTPMEVGLMLRALGFGNDTYIYVASGEIYGGEETLRPLRELFPNFYTKE--MLAN  395

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             + K L   +S L   ID  +C ESDVF+   +G     +AG+R   G  + + P
Sbjct  396  DELKPLLPYSSRL-AAIDYIVCDESDVFITNNNGNMAKILAGRRRYMGHKRTIRP  449



>dbj|BAK05951.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P EI   LR LGF + T +Y+        + +L  L+ELFP  YTKE +   D
Sbjct  319  RGKCPLTPHEIGLMLRALGFGNETYLYVASGEIYGGEETLRPLRELFPNFYTKEMLAGDD  378

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L  V D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  379  LKP-FLPF-SSRLAAV-DFIVCDESDVFVTNNNGNMAKVLAGRRRYMGHKRTIRP  430



>gb|KHN34931.1| DUF246 domain-containing protein [Glycine soja]
Length=553

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   SP E+   LR LGF++ T +Y+        + ++  L++LFP  YTKE  M  +
Sbjct  348  RGKCPLSPHEVGLMLRALGFSNDTYLYVASGEVYGGEETMQPLRDLFPNIYTKE--MLAE  405

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  406  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  459



>emb|CAE75903.1| OSJNBb0034G17.19 [Oryza sativa Japonica Group]
Length=432

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +PQEI   LR LGF++ T +Y+        + +L  L+
Sbjct  282  RWDTLPELSAEDERS-RGKCPLTPQEIGLMLRALGFSNDTYLYVASGEIYGGEETLQPLR  340

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +LFP  YTKE +   D K  FL   +S L   ID  +C  SDVFV   +G     +AG+R
Sbjct  341  DLFPNYYTKEMLAGNDLKP-FLPF-SSRLA-AIDFIVCDGSDVFVTNNNGNMAKVLAGRR  397

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  398  RYMGHKRTIRP  408



>ref|XP_009389009.1| PREDICTED: uncharacterized protein At1g04910 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 56/115 (49%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +PQE+   LR LGF + T +Y+        ++SL  LK+LFP  YTKE +   D
Sbjct  336  RGKCPLTPQEVGLMLRALGFVNNTYLYVASGEIYGGEASLQPLKDLFPNFYTKEMLAGND  395

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL    S     ID  +C ESDVF    +G     +AG R   G  + + P
Sbjct  396  LKP-FL--PFSSRLAAIDYIVCDESDVFATNNNGNMAKILAGHRRYMGHKRTIRP  447



>ref|XP_004245776.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=592

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGFN+ T +Y+        + +L  L+ELFP  YTKE ++  +
Sbjct  356  RGKCPLTPHEVGLMLRALGFNNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKE-MLAGE  414

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVF    +G     +AG+R   G  + + P
Sbjct  415  ELQPFLPY-SSRL-AAIDYIVCDESDVFATNNNGNMAKILAGRRRYMGHKRTIRP  467



>gb|EEE61454.1| hypothetical protein OsJ_15700 [Oryza sativa Japonica Group]
Length=518

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +PQEI   LR LGF++ T +Y+        + +L  L+
Sbjct  322  RWDTLPELSAEDERS-RGKCPLTPQEIGLMLRALGFSNDTYLYVASGEIYGGEETLQPLR  380

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +LFP  YTKE +   D K  FL   +S L   ID  +C  SDVFV   +G     +AG+R
Sbjct  381  DLFPNYYTKEMLAGNDLKP-FLPF-SSRLA-AIDFIVCDGSDVFVTNNNGNMAKVLAGRR  437

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  438  RYMGHKRTIRP  448



>emb|CAH67151.1| OSIGBa0122F23.8 [Oryza sativa Indica Group]
 gb|EEC77761.1| hypothetical protein OsI_16902 [Oryza sativa Indica Group]
Length=499

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +PQEI   LR LGF++ T +Y+        + +L  L+
Sbjct  303  RWDTLPELSAEDERS-RGKCPLTPQEIGLMLRALGFSNDTYLYVASGEIYGGEETLQPLR  361

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +LFP  YTKE +   D K   L    S     ID  +C  SDVFV   +G     +AG+R
Sbjct  362  DLFPNYYTKEMLAGNDLK---LFLPFSSRLAAIDFIVCDGSDVFVTNNNGNMAKVLAGRR  418

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  419  RYMGHKRTIRP  429



>emb|CAE01682.2| OSJNBa0010H02.2 [Oryza sativa Japonica Group]
Length=499

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L + S +   S R K   +PQEI   LR LGF++ T +Y+        + +L  L+
Sbjct  303  RWDTLPELSAEDERS-RGKCPLTPQEIGLMLRALGFSNDTYLYVASGEIYGGEETLQPLR  361

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +LFP  YTKE +   D K  FL   +S L   ID  +C  SDVFV   +G     +AG+R
Sbjct  362  DLFPNYYTKEMLAGNDLKP-FLPF-SSRLA-AIDFIVCDGSDVFVTNNNGNMAKVLAGRR  418

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  419  RYMGHKRTIRP  429



>ref|XP_003538741.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=553

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   SP E+   LR LGF++ T +Y+        + ++  L++LFP  YTKE  M  +
Sbjct  348  RGKCPLSPHEVGLMLRALGFSNDTYLYVASGEVYGGEETMQPLRDLFPNIYTKE--MLAE  405

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  406  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  459



>ref|XP_006369018.1| hypothetical protein POPTR_0001s15750g [Populus trichocarpa]
 gb|ERP65587.1| hypothetical protein POPTR_0001s15750g [Populus trichocarpa]
Length=539

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++ ++
Sbjct  308  RGKCPLTPHEVGLMLRALGFANNTYLYVASGEIYGGEETLRPLRELFPNFYTKE-MLAVE  366

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
                FL   +S L   ID   C ESDVFV   +G     +AG+R  +G  + + P
Sbjct  367  DLKPFLPF-SSRL-AAIDYIACDESDVFVTNNNGNMAKILAGRRRYAGHKRTIRP  419



>ref|XP_006477177.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=576

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE  M  +
Sbjct  348  RGKCPLTPHEVGLMLRALGFANDTHLYVASGEIYGGEETLRPLRELFPNFYTKE--MLAN  405

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  406  EELKPFLQFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  459



>ref|XP_010264337.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010264338.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=515

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L+ LFP  YTKE +   +
Sbjct  294  RGKCPLTPHEVGLMLRALGFGNDTYIYVASGEIYGGEETLQPLRNLFPNFYTKELL--AN  351

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ +  ++ +S L   +D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  352  EELRPFNSFSSRLA-ALDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  405



>ref|XP_010110838.1| hypothetical protein L484_011821 [Morus notabilis]
 gb|EXC28317.1| hypothetical protein L484_011821 [Morus notabilis]
Length=528

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE  M  +
Sbjct  322  RGKCPLTPHEVGLMLRALGFANDTFLYVASGEIYGGEETLRPLRELFPNFYTKE--MLAN  379

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  380  EELKPFLPYSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  433



>ref|XP_010666088.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=611

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 67/145 (46%), Gaps = 14/145 (10%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            + K   +P+E+   LR LG+NS   IY+        + +L SL+ LFP  ++K+++   +
Sbjct  353  QGKCPLTPEEVGLMLRALGYNSDVHIYVASGEVYGGEETLASLRALFPNFHSKDTLASQE  412

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            + A F  A  S     +D  +C ESDVFV   +G     +AG+R   G    + P     
Sbjct  413  ELAPF--APFSARMAALDFIVCDESDVFVTNNNGNMARILAGRRRYYGHKPTIRPN----  466

Query  419  SSASLTDHISHYVSKKNHFAYSCFC  493
                    ++H  S +N+  +  F 
Sbjct  467  -----AKKLNHLFSNQNNMTWEGFA  486



>ref|XP_009764467.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=565

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++  +
Sbjct  329  RGKCPLTPHEVGLMLRALGFKNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKE-MLASE  387

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  388  ELQPFLPY-SSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHRRTIRP  440



>ref|XP_010264336.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=564

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L+ LFP  YTKE +   +
Sbjct  343  RGKCPLTPHEVGLMLRALGFGNDTYIYVASGEIYGGEETLQPLRNLFPNFYTKELL--AN  400

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ +  ++ +S L   +D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  401  EELRPFNSFSSRLA-ALDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  454



>ref|XP_010258886.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=529

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 7/123 (6%)
 Frame = +2

Query  44   SCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYT  214
            S  G G  R +  ++P+E+   LR LGF + T +Y+          +L  LK+LFP  YT
Sbjct  330  SPDGEGK-RGRCPFTPEEMGLMLRALGFRNDTYLYVASGEIYGGKKTLQPLKDLFPNFYT  388

Query  215  KESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQI  394
            KE  M  +++ +   + +S L   ID  +C ESDVFV   +G     +AG+R   G  + 
Sbjct  389  KE--MLANEELRPFLSFSSRLA-AIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRT  445

Query  395  LVP  403
            + P
Sbjct  446  IRP  448



>gb|EMT06117.1| hypothetical protein F775_26149 [Aegilops tauschii]
Length=475

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P EI   LR +GF + T +Y+        + +L  L+ELFP  YTKE +   D
Sbjct  295  RGKCPLTPHEIGLMLRAVGFGNETYLYVASGEIYGGEETLRPLRELFPNFYTKEMLAGDD  354

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  355  LKP-FLPF-SSRL-AAIDFIVCDESDVFVTNNNGNMAKVLAGRRRYMGHKRTIRP  406



>ref|XP_003614789.1| Growth regulator-related protein [Medicago truncatula]
 gb|AES97747.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=589

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTRW---DSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P E+   LR +GFN+ T+IYL   +    +  L  L ++FP  YTKES+   D+ A F+
Sbjct  392  TPLEVGMMLRGMGFNNSTSIYLASGKIYHAEKYLAPLIKMFPNLYTKESLATTDELAPFM  451

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR--IASGKTQILVP  403
               +S+L   +D  +C  S+VFV    G F   + G R  +  G  + ++P
Sbjct  452  -GYSSQL-AALDYTVCLFSEVFVTTQGGNFPHFLMGHRRFLYGGHAKTIIP  500



>gb|EMS68353.1| hypothetical protein TRIUR3_18244 [Triticum urartu]
Length=438

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 7/131 (5%)
 Frame = +2

Query  20   RVDILGKKSCQGNGSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLK  190
            R D L   S + N   R K   +P EI   LR LGF + T +Y+        + +L  L+
Sbjct  243  RWDTLPDLSAE-NERTRGKCPLTPHEIGLMLRALGFGNETYLYVASGEIYGGEETLRPLR  301

Query  191  ELFPKTYTKESIMPIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            ELFP  YTK+ +   D K  FL   +S L  V D  +C ESDVFV   +G     +AG+R
Sbjct  302  ELFPNFYTKDLLAGDDLKP-FLPF-SSRLAAV-DFIVCDESDVFVTNNNGNMAKVLAGRR  358

Query  371  IASGKTQILVP  403
               G  + + P
Sbjct  359  RYMGHKRTIRP  369



>ref|XP_009615915.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=499

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R +   +P E+   LR LGF + T +Y+        + +L  LKELFP  YTKE +   D
Sbjct  287  RGRCPLTPHEVGLMLRALGFKNDTYLYVASGEIYGGEKTLQPLKELFPNFYTKEMVAG-D  345

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVFV   +G     +AG R   G  + + P
Sbjct  346  ELKPFLPY-SSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGSRRYMGHKRTIRP  398



>ref|XP_009615914.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=538

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R +   +P E+   LR LGF + T +Y+        + +L  LKELFP  YTKE +   D
Sbjct  326  RGRCPLTPHEVGLMLRALGFKNDTYLYVASGEIYGGEKTLQPLKELFPNFYTKEMVAG-D  384

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L   ID  +C ESDVFV   +G     +AG R   G  + + P
Sbjct  385  ELKPFLPY-SSRLA-AIDYIVCDESDVFVTNNNGNMAKILAGSRRYMGHKRTIRP  437



>ref|XP_006652611.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Oryza brachyantha]
Length=499

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +PQEI   LR LGF++ T +Y+        + +L  L++LFP  YTKE +   D
Sbjct  318  RGKCPLTPQEIGLMLRALGFSNDTYLYVASGEIYGGEETLQPLRDLFPNFYTKELLAGDD  377

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S+L   ID  +C  SDVFV   +G     +AG+R   G  + + P
Sbjct  378  LKP-FLPF-SSQLA-AIDFIVCDGSDVFVANNNGNMAKVLAGRRHYLGHKRTIRP  429



>ref|XP_009604868.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=565

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T +Y+        + +L  L+ELFP  YTKE ++  +
Sbjct  329  RGKCPLTPHEVGLMLRALGFKNDTYLYVASGEIYGGEKTLQPLRELFPNFYTKE-MLASE  387

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +   FL   +S L  V D  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  388  ELQPFLPY-SSRLAAV-DYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  440



>ref|XP_001757712.1| predicted protein [Physcomitrella patens]
 gb|EDQ77352.1| predicted protein, partial [Physcomitrella patens]
Length=506

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 16/143 (11%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R+  C  +P+E+   LR LG+ + + +Y+        ++SL  LK +FP  YTK++I   
Sbjct  241  RNGKCPLTPEEVGLMLRALGYGNDSYLYVASGEVYNGEASLAPLKAMFPNYYTKDTISNQ  300

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQI-------  394
             +   FL    S     ID  +CS SDVFV   +G     +AG+R  +G  +        
Sbjct  301  KELQPFLKY--SSRMAAIDYIVCSGSDVFVANNNGNMARILAGERRYNGHKRTIRPNAKK  358

Query  395  ---LVPADITASSASLTDHISHY  454
               L+PA    S A   +++ H+
Sbjct  359  LGRLLPARHNMSWAEFAENVRHF  381



>gb|AES90897.2| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=538

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 6/128 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LG+ + T +Y+        D ++  L++LFP  YTKE  M  +
Sbjct  324  RGKCPLTPHEVGLMLRALGYTNDTYLYVASGEIYGGDETMQPLRDLFPNIYTKE--MLAE  381

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            ++ K   + +S L  V D  +C ES+VFV   +G     +AG+R   G  + + P     
Sbjct  382  EELKPFLSFSSRLAAV-DYIVCDESNVFVANNNGNMARILAGQRRYMGHKRTIRPNAKKL  440

Query  419  SSASLTDH  442
            S+  +  H
Sbjct  441  SALFMARH  448



>ref|XP_010677047.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=576

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P+E+   LR LGF + T +Y+        +++L  L+ELFP   TKE++    
Sbjct  360  RGKCPLTPEEVGVLLRALGFKNDTYLYVASGEIYGGEATLQPLRELFPNFNTKEALA--G  417

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K L   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  418  EELKSLMPYSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTVKP  471



>gb|KJB51853.1| hypothetical protein B456_008G234600 [Gossypium raimondii]
Length=542

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 6/122 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L++LFP  YTKE +   +
Sbjct  338  RGKCPLTPHEVGLMLRALGFANDTYIYVASGEIYGGEETLRPLRDLFPNFYTKEKLA--N  395

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P     
Sbjct  396  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMARILAGRRRYMGHKRTIRPNTKRL  454

Query  419  SS  424
            SS
Sbjct  455  SS  456



>ref|XP_010272986.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Nelumbo nucifera]
Length=395

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+E+A F+  LG+ S T IY+        D+ +  L+  FP   +KE++  +D+   F+
Sbjct  207  TPKEVAMFITALGYPSNTPIYIAAGEIYGGDNQISELRSRFPILMSKENLASVDELEPFM  266

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
               AS++   +D  +  ESDVF+P+ SG     V G R   G  + + P
Sbjct  267  -GHASQM-AALDYIVSVESDVFIPSYSGNMARAVEGHRRFLGHRKTISP  313



>gb|KHG05427.1| hypothetical protein F383_01689 [Gossypium arboreum]
Length=542

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  L++LFP  YTKE +   +
Sbjct  338  RGKCPLTPHEVGLMLRALGFANDTYIYVASGEIYGGEETLRPLRDLFPNFYTKERLA--N  395

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  396  EELKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMARILAGRRRYMGHKRTIRP  449



>ref|XP_009768450.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=602

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R+  C  +P+E+   LR LGF +   IY+        D +L  LK  FP  YTKE++   
Sbjct  341  RNGKCPLTPEEVGLMLRALGFGNDVHIYIASGEIYGGDETLAPLKAFFPNFYTKETLASK  400

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  401  EELAPF--SSFSSRMAALDFIVCDESDVFVSNNNGNMARMLAGRRRYFGHKPTIRP  454



>ref|XP_006596302.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=584

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTRW---DSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P E+   LR +GF++ T+IYL   +    +  L  L ++FP  YTKES+   D+ A F+
Sbjct  393  TPLEVGMMLRGMGFDNNTSIYLASGKIYHAERYLAPLIKMFPNLYTKESLATSDELAPFM  452

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR--IASGKTQILVP  403
               +S+L   +D  +C  S+VFV    G F   + G R  I  G  + ++P
Sbjct  453  -GYSSQL-AALDYTVCLSSEVFVTTQGGNFPHFLMGHRRFIYDGHAKTIIP  501



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 5/98 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+EI   L  LGFN+ TT+YL   +    ++ + +LK+LFP    K+S+   +++AK +
Sbjct  355  TPEEIGLLLAALGFNNSTTLYLASHKVYGGEARISTLKKLFPYMEDKKSLSSAEERAK-V  413

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            D  +S L  V D Y+  +SD+FV A  G  +  + G R
Sbjct  414  DGKSSLLAAV-DYYVGMQSDIFVSASPGNMHNALVGHR  450



>ref|XP_009793733.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
 emb|CAA56570.1| axi 1 [Nicotiana tabacum]
Length=569

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+EI   LR LGF +   IY+        + +L  LK LFP  Y+KE+I   
Sbjct  339  RHGKCPLTPEEIGLMLRALGFGNDVHIYVASGEIYGGEETLAPLKALFPNFYSKETIASK  398

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  399  EELAPF--SSFSSRMAALDFMVCDESDVFVSNNNGNMARMLAGRRRYFGHKPTIRP  452



>ref|XP_009591037.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=569

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+EI   LR LGF +   IY+        + +L  LK LFP  Y+KE+I   
Sbjct  339  RHGKCPLTPEEIGLMLRALGFGNDVHIYVASGEIYGGEETLAPLKALFPNFYSKETIASK  398

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  399  EELAPF--SSFSSRMAALDFMVCDESDVFVSNNNGNMARMLAGRRRYFGHKPTIRP  452



>ref|XP_010272984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=532

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+E+A F+  LG+ S T IY+        D+ +  L+  FP   +KE++  +D+   F+
Sbjct  344  TPKEVAMFITALGYPSNTPIYIAAGEIYGGDNQISELRSRFPILMSKENLASVDELEPFM  403

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
               AS++   +D  +  ESDVF+P+ SG     V G R   G  + + P
Sbjct  404  -GHASQM-AALDYIVSVESDVFIPSYSGNMARAVEGHRRFLGHRKTISP  450



>ref|XP_010272985.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=510

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+E+A F+  LG+ S T IY+        D+ +  L+  FP   +KE++  +D+   F+
Sbjct  344  TPKEVAMFITALGYPSNTPIYIAAGEIYGGDNQISELRSRFPILMSKENLASVDELEPFM  403

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
               AS++   +D  +  ESDVF+P+ SG     V G R   G  + + P
Sbjct  404  -GHASQM-AALDYIVSVESDVFIPSYSGNMARAVEGHRRFLGHRKTISP  450



>gb|KHG11598.1| hypothetical protein F383_00648 [Gossypium arboreum]
Length=580

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQT---RWDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   IY+      R + +L  LK LFP  ++KE+I   
Sbjct  343  RHGRCPLTPEEVGLMLRALGFGSDVHIYVASGEVYRGEETLAPLKALFPNFHSKETIATK  402

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  403  EELAPF--SSFSGRMAALDYIVCDESDVFVTNNNGNMARILAGRRRYFGHKPTIRP  456



>gb|KJB15940.1| hypothetical protein B456_002G205500 [Gossypium raimondii]
Length=594

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQT---RWDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   IY+      R + +L  LK LFP  ++KE+I   
Sbjct  358  RHGRCPLTPEEVGLMLRALGFGSDVHIYVASGEVYRGEETLAPLKALFPNFHSKETIATK  417

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  418  EELAPF--SSFSGRMAALDYIVCDESDVFVTNNNGNMARILAGRRRYFGHKPTIRP  471



>gb|EYU19327.1| hypothetical protein MIMGU_mgv1a003931mg [Erythranthe guttata]
Length=554

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR L F++ T +Y+        + +L  LKELFP  YTKE  M   
Sbjct  351  RGKCPLTPHEVGLLLRALDFDNSTYLYVASGEVYGGEETLRPLKELFPNFYTKE--MLAS  408

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ + L   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  409  QELESLLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  462



>ref|XP_008349183.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=286

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTRW---DSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   +Y+        + +L  LK LFP  +TKE+++  
Sbjct  46   RHGRCPLTPEEVGLMLRALGFGSDVHLYVASGEVYGSEETLAPLKTLFPNFHTKETLLSK  105

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  106  EELAPF--SSFSSRMAALDFIVCDESDVFVTNNNGNMAKMLAGRRRYFGHKPTIRP  159



>ref|XP_008383543.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=286

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTRW---DSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   +Y+        + +L  LK LFP  +TKE+++  
Sbjct  46   RHGRCPLTPEEVGLMLRALGFGSDVHLYVASGEVYGSEETLAPLKTLFPNFHTKETLLSK  105

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  106  EELAPF--SSFSSRMAALDFIVCDESDVFVTNNNGNMAKMLAGRRRYFGHKPTIRP  159



>ref|XP_011081267.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=584

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR L F++ T +Y+        + +L  LKELFP  YTKE  M   
Sbjct  349  RGKCPLTPHEVGLLLRALDFDNNTYLYVASGEIYGGEETLRPLKELFPNFYTKE--MLAG  406

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++   L   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  407  EELNSLLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  460



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 5/98 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+EI   L  LGFN+GT +YL   +    ++ + +L++LFP    K+SI   ++ AK +
Sbjct  357  TPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAK-I  415

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +  AS L   +D Y+  +SD+F+ A  G  +  + G R
Sbjct  416  EGKAS-LSAAVDYYVSMQSDIFISASPGNMHNALVGHR  452



>ref|XP_002513963.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48546.1| conserved hypothetical protein [Ricinus communis]
Length=536

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+EIA FL  LGF S T IY+        D+ +  L+  +P   +KE +  +++   F+
Sbjct  344  TPREIAMFLSALGFPSNTPIYIASGEIYGGDTHMADLQSRYPILMSKEKLASVEELEPFI  403

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +  AS++   +D  +  ESDVF+P+ SG     V G R   G  + + P
Sbjct  404  N-HASQM-AALDYIVSVESDVFIPSYSGNMARAVEGHRRFMGHRKTISP  450



>ref|XP_001785226.1| predicted protein [Physcomitrella patens]
 gb|EDQ49967.1| predicted protein, partial [Physcomitrella patens]
Length=509

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 5/109 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQT---RWDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+E+   LR LG+ + T +Y+        ++SL  LK LFP  YTKE +    +   F 
Sbjct  252  TPEEVGIMLRALGYGNNTYLYVASGDVYNGEASLAPLKALFPNFYTKELLANQVELTPF-  310

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             A+ S     ID  +CS SDVFV   +G     +AG+R  +G  + + P
Sbjct  311  -ANFSSRMAAIDYIVCSRSDVFVANNNGNMVRILAGERRFNGHKRTIRP  358



>gb|KHG15636.1| hypothetical protein F383_08162 [Gossypium arboreum]
Length=513

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R +   +P E+   LR LGF + + IY+        + +L  L++LFP  YTKE  M  D
Sbjct  306  RGRCPLTPHEVGLMLRALGFANDSYIYVASGEIYGGEETLRPLRDLFPNFYTKE--MLAD  363

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            +  K     +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  364  EDLKPFLPFSSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTVRP  417



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 5/98 (5%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P+EI   L  LGFN+GT +YL   +    ++ + +L++LFP    K+SI   ++ AK +
Sbjct  354  TPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAK-I  412

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
            +  AS L   +D Y+  +SD+F+ A  G  +  + G R
Sbjct  413  EGKAS-LSAAVDYYVSMQSDIFISASPGNMHNALVGHR  449



>gb|EPS71477.1| hypothetical protein M569_03283 [Genlisea aurea]
Length=209

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (48%), Gaps = 5/113 (4%)
 Frame = +2

Query  74   KSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKK  244
            K   +P+E+   LR LGF S   IY+        + SL  L+ LFP  +TK S++  ++ 
Sbjct  42   KCVLTPEEVGLMLRALGFGSEVHIYIASGEIYGGEKSLSPLRSLFPNLHTKRSLLSEEEL  101

Query  245  AKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             +F  +  S     +D  +C ESDV     +G     +AG+R   G  + + P
Sbjct  102  GEF--SSHSSRMAALDFMVCDESDVLATNNNGNMAKILAGRRRYFGHKRTIRP  152



>ref|XP_006828944.1| hypothetical protein AMTR_s00001p00225660 [Amborella trichopoda]
 gb|ERM96360.1| hypothetical protein AMTR_s00001p00225660 [Amborella trichopoda]
Length=588

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +PQE+   LR LGF +   IY+        + +L  LKE FP  Y+KE ++  
Sbjct  332  RHGKCPLTPQEVGLMLRALGFGNDVHIYVASGEVYGGEDTLAPLKEFFPNFYSKERLLSK  391

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++   F  +  S     +D  +C ES+VFV   +G     +AG+R   G  + + P
Sbjct  392  EELMPF--SSFSSRMAALDYIVCDESNVFVTNNNGNMARMLAGRRRYFGHKRTIRP  445



>ref|XP_002533764.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28623.1| conserved hypothetical protein [Ricinus communis]
Length=580

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 56/122 (46%), Gaps = 5/122 (4%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            SP+E+   LR LGF S   IY+        + +L  LK LFP  Y+K+++   D+ A F 
Sbjct  344  SPEEVGLMLRALGFGSDVHIYVASGEVYGGEETLAPLKALFPNFYSKDTLASKDELAPF-  402

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITASSASLT  436
             +  S     +D  +C ESDVFV   +G     +AG+R   G    + P         L 
Sbjct  403  -SSFSSRMAALDFSVCDESDVFVTNNNGNMAKILAGRRRYFGHKPTIRPNSKKLYKLFLN  461

Query  437  DH  442
             H
Sbjct  462  QH  463



>ref|XP_002985325.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
 gb|EFJ13819.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
Length=462

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R+  C  +P E+   LR LGF++ T +Y+        +S+L  L+ LFP  +TKES+   
Sbjct  262  RNGKCPLTPMEVGLMLRALGFSNETYLYVASGDIYGGESTLAPLRALFPHFFTKESLAS-  320

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            DK+ +     +S +   ID  +C++SDVFV   +G     +AG R  +G  + + P
Sbjct  321  DKEMEQFSRYSSRM-AAIDYIVCNQSDVFVTNNNGNMARILAGHRRYAGHKRTIRP  375



>ref|XP_002970137.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
 gb|EFJ29261.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
Length=482

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R+  C  +P E+   LR LGF++ T +Y+        +S+L  L+ LFP  +TKES+   
Sbjct  282  RNGKCPLTPMEVGLMLRALGFSNETYLYVASGDIYGGESTLAPLRALFPHFFTKESLAS-  340

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            DK+ +     +S +   ID  +C++SDVFV   +G     +AG R  +G  + + P
Sbjct  341  DKEMEQFSRYSSRM-AAIDYIVCNQSDVFVTNNNGNMARILAGHRRYAGHKRTIRP  395



>ref|XP_003608700.1| DUF246 domain-containing protein [Medicago truncatula]
Length=636

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 6/128 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LG+ + T +Y+        D ++  L++LFP  YTKE  M  +
Sbjct  324  RGKCPLTPHEVGLMLRALGYTNDTYLYVASGEIYGGDETMQPLRDLFPNIYTKE--MLAE  381

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVPADITA  418
            ++ K   + +S L  V D  +C ES+VFV   +G     +AG+R   G  + + P     
Sbjct  382  EELKPFLSFSSRLAAV-DYIVCDESNVFVANNNGNMARILAGQRRYMGHKRTIRPNAKKL  440

Query  419  SSASLTDH  442
            S+  +  H
Sbjct  441  SALFMARH  448



>gb|KJB25568.1| hypothetical protein B456_004G197900 [Gossypium raimondii]
 gb|KJB25569.1| hypothetical protein B456_004G197900 [Gossypium raimondii]
Length=540

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R +   +P E+   LR LGF + + IY+        + +L  L++LFP  YTKE +   D
Sbjct  333  RGRCPLTPHEVGLMLRALGFANDSYIYVASGEIYGGEETLRPLRDLFPNFYTKEMLANED  392

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S L   ID  +C ESDVFV   +G     +AG+R   G  + + P
Sbjct  393  LKP-FLPF-SSRL-AAIDYIVCDESDVFVTNNNGNMAKILAGRRRYMGHKRTIRP  444



>ref|XP_008796109.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Phoenix 
dactylifera]
Length=423

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  LK+LFP  YTKE +   D
Sbjct  321  RGKCPLTPHEVGLMLRALGFENDTHIYIASGEIYGGEQTLQPLKDLFPNFYTKEMLAGDD  380

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR  370
             K  F+   +S L   ID  +C ESDVFV   +G     +AG R
Sbjct  381  LKP-FIPF-SSRLA-AIDYIVCGESDVFVTNNNGNMAKILAGHR  421



>ref|XP_007141089.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
 gb|ESW13083.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
Length=582

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +2

Query  86   SPQEIAQFLRKLGFNSGTTIYLTQTRW---DSSLDSLKELFPKTYTKESIMPIDKKAKFL  256
            +P E+   LR +GF+S T+IY+   +    +  L  L ++FP  YTKES+   D+ A F+
Sbjct  391  TPLEVGMMLRGMGFDSNTSIYIASGKIYHAERYLAPLMKMFPYLYTKESLATSDELAPFM  450

Query  257  DADASELEKVIDSYICSESDVFVPAISGLFYANVAGKR--IASGKTQILVP  403
               +S+L   +D  +C  S+VFV    G F   + G R  +  G  + ++P
Sbjct  451  -GYSSQL-AALDYTVCLSSEVFVTTQGGNFPHFLMGHRRFLYGGHAKTIIP  499



>ref|XP_009407812.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=513

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  68   RSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPID  238
            R K   +P E+   LR LGF + T IY+        + +L  LK+LFP  YTKE +   D
Sbjct  327  RGKCPLTPHEVGLMLRALGFVNKTYIYVASGEIYGGEETLQPLKDLFPNFYTKEMLARED  386

Query  239  KKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
             K  FL   +S+L   ID  IC ESDVF    +G     +AG R   G  + + P
Sbjct  387  LKP-FLPF-SSQL-AAIDYIICDESDVFATNNNGNMAKILAGHRRYIGYKRTIRP  438



>ref|XP_009345471.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Pyrus 
x bretschneideri]
Length=574

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query  68   RSKSC-YSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIMPI  235
            R   C  +P+E+   LR LGF S   +Y+        + +L  LK LFP  +TKE+++  
Sbjct  364  RHGRCPLTPEEVGLMLRALGFGSDVHLYVASGDVYGGEETLAPLKTLFPNFHTKETLLSK  423

Query  236  DKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
            ++ A F  +  S     +D  +C ESDVFV   +G     +AG+R   G    + P
Sbjct  424  EELAPF--SSFSSRMAALDFIVCDESDVFVTNNNGNMAKMLAGRRRYFGHKPTIRP  477



>tpg|DAA62654.1| TPA: hypothetical protein ZEAMMB73_414326 [Zea mays]
Length=514

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 5/118 (4%)
 Frame = +2

Query  59   GSPRSKSCYSPQEIAQFLRKLGFNSGTTIYLTQTR---WDSSLDSLKELFPKTYTKESIM  229
            G  + +   +P+E+   LR LG+ S   IY+        + +L SLK LFP  +TKE++ 
Sbjct  259  GRRQGRCPLTPEEVGLMLRALGYRSDVHIYVASGEIYGGEDTLASLKALFPNFHTKETLS  318

Query  230  PIDKKAKFLDADASELEKVIDSYICSESDVFVPAISGLFYANVAGKRIASGKTQILVP  403
              ++ A FL    S     ID  +C ESD FV    G     +AG+R   G  + + P
Sbjct  319  SQEELAPFL--KFSSRMAAIDFIVCEESDAFVANNIGNMAKILAGQRRYFGHKRTIRP  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250