BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004B02 646 bp,

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786038.1|  PREDICTED: uncharacterized protein LOC104234204    154   3e-39   Nicotiana sylvestris
ref|XP_009627032.1|  PREDICTED: uncharacterized protein LOC104117664    137   2e-34   Nicotiana tomentosiformis
ref|XP_009594483.1|  PREDICTED: uncharacterized protein LOC104090969    132   1e-32   Nicotiana tomentosiformis
ref|XP_007207754.1|  hypothetical protein PRUPE_ppa026862mg             119   3e-27   Prunus persica
ref|XP_007217848.1|  hypothetical protein PRUPE_ppa024192mg             118   6e-27   Prunus persica
ref|XP_007204932.1|  hypothetical protein PRUPE_ppa016960mg             113   3e-26   Prunus persica
ref|XP_007212530.1|  hypothetical protein PRUPE_ppa019343mg             112   2e-25   Prunus persica
ref|XP_007199214.1|  hypothetical protein PRUPE_ppa021857mg             112   3e-25   Prunus persica
ref|XP_007201656.1|  hypothetical protein PRUPE_ppa022059mg             110   8e-25   Prunus persica
ref|XP_007210252.1|  hypothetical protein PRUPE_ppa014925mg             110   2e-24   Prunus persica
ref|XP_007203322.1|  hypothetical protein PRUPE_ppa020000mg             107   3e-24   Prunus persica
ref|XP_009790290.1|  PREDICTED: uncharacterized protein LOC104237764    106   5e-23   Nicotiana sylvestris
gb|ADN34118.1|  hypothetical protein                                    105   2e-22   Cucumis melo subsp. melo
ref|XP_007207920.1|  hypothetical protein PRUPE_ppa018940mg             103   2e-22   Prunus persica
ref|XP_007212521.1|  hypothetical protein PRUPE_ppa017902mg             102   1e-21   Prunus persica
ref|XP_006377155.1|  hypothetical protein POPTR_0011s01240g           93.6    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007224673.1|  hypothetical protein PRUPE_ppa025899mg           96.3    8e-20   Prunus persica
ref|XP_007225062.1|  hypothetical protein PRUPE_ppa025425mg           95.9    3e-19   Prunus persica
ref|XP_011002234.1|  PREDICTED: uncharacterized protein LOC105109284  89.0    8e-19   Populus euphratica
ref|XP_006373173.1|  hypothetical protein POPTR_0017s09350g           87.8    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007208747.1|  hypothetical protein PRUPE_ppa015409mg           93.2    2e-18   Prunus persica
ref|XP_006376080.1|  hypothetical protein POPTR_0013s08970g           82.4    1e-16   Populus trichocarpa [western balsam poplar]
emb|CAN74865.1|  hypothetical protein VITISV_043090                   76.6    2e-14   Vitis vinifera
ref|XP_008374278.1|  PREDICTED: uncharacterized protein LOC103437571  77.4    7e-14   
gb|KDP33400.1|  hypothetical protein JCGZ_12856                       78.6    1e-13   Jatropha curcas
ref|XP_009615588.1|  PREDICTED: uncharacterized protein LOC104108294  78.2    3e-13   Nicotiana tomentosiformis
ref|XP_007213486.1|  hypothetical protein PRUPE_ppa022696mg           75.5    5e-13   Prunus persica
ref|XP_011470543.1|  PREDICTED: uncharacterized protein LOC105353249  77.0    9e-13   Fragaria vesca subsp. vesca
ref|XP_007212994.1|  hypothetical protein PRUPE_ppa022760mg           70.9    1e-11   Prunus persica
ref|XP_007207873.1|  hypothetical protein PRUPE_ppa021382mg           72.4    1e-11   Prunus persica
ref|XP_008342753.1|  PREDICTED: uncharacterized protein LOC103405520  66.2    7e-11   
ref|XP_009343023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.2    8e-10   Pyrus x bretschneideri [bai li]
gb|KDP36670.1|  hypothetical protein JCGZ_07888                       66.2    1e-09   Jatropha curcas
gb|KDP35489.1|  hypothetical protein JCGZ_10936                       62.8    3e-09   Jatropha curcas
ref|XP_009378244.1|  PREDICTED: uncharacterized protein LOC103966764  63.2    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_009374098.1|  PREDICTED: uncharacterized protein LOC103963041  47.8    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_008383917.1|  PREDICTED: uncharacterized protein LOC103446564  47.4    2e-05   
ref|XP_007224870.1|  hypothetical protein PRUPE_ppa022702mg           53.9    2e-05   Prunus persica
ref|XP_002535994.1|  conserved hypothetical protein                   51.2    2e-05   
ref|XP_002538435.1|  conserved hypothetical protein                   50.8    3e-05   
gb|KGN58004.1|  hypothetical protein Csa_3G426900                     53.5    3e-05   Cucumis sativus [cucumbers]
gb|ABB55315.1|  dna-directed rna polymerase ii - related              53.5    4e-05   Asparagus officinalis
gb|KDP39095.1|  hypothetical protein JCGZ_00852                       51.6    1e-04   Jatropha curcas
gb|ABD63174.1|  hypothetical protein 20.t00026                        51.6    2e-04   Asparagus officinalis
gb|ABB55338.1|  hypothetical protein 16.t00009                        51.6    2e-04   Asparagus officinalis
ref|XP_010324434.1|  PREDICTED: uncharacterized protein LOC101267626  50.4    4e-04   Solanum lycopersicum
ref|XP_009764875.1|  PREDICTED: uncharacterized protein LOC104216514  49.7    6e-04   Nicotiana sylvestris
gb|KDP38611.1|  hypothetical protein JCGZ_05318                       49.3    8e-04   Jatropha curcas
ref|XP_008365248.1|  PREDICTED: uncharacterized protein LOC103428893  49.7    8e-04   



>ref|XP_009786038.1| PREDICTED: uncharacterized protein LOC104234204 [Nicotiana sylvestris]
Length=930

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 79/162 (49%), Positives = 100/162 (62%), Gaps = 2/162 (1%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA G +I L  PVLASIY GLN IS S    Q+   FPIHYVY WLA Y++TH+
Sbjct  329  FKMASMMAGGRQISLIVPVLASIYHGLNKISRSSQLDQVKVSFPIHYVYGWLAHYFKTHY  388

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKG-DVSWLCNSRKDNRDFIFYDNRRG  136
               +  L+ P MV  SGEG ARY+ E D RK+I  G D+ W      ++R + + DN   
Sbjct  389  PLTN-VLSVPLMVAYSGEGVARYFDEKDGRKRIHNGEDIVWAPTMLTNSRPYYYVDNDAP  447

Query  135  SREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
               +  YF+ LR ++L LR G+    +PY PHRF RQFGFYQ
Sbjct  448  QELESNYFMSLRFNYLPLRYGNSFIIKPYSPHRFGRQFGFYQ  489



>ref|XP_009627032.1| PREDICTED: uncharacterized protein LOC104117664 [Nicotiana tomentosiformis]
Length=397

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA G KI LA PVLASIY GLN IS S    Q+   F IHYVY WLA Y++TH+
Sbjct  184  FKMASMMASGRKISLAVPVLASIYHGLNKISCSSQLDQVKVYFHIHYVYGWLAHYFKTHY  243

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKG-DVSWLCNSRKDNRDFIFYDNRRG  136
                 + + P MV  S EG ARY+ E DARK I  G D+ W      ++R + + DN   
Sbjct  244  PLAKGS-SVPLMVAYSREGAARYFDEKDARKCIHNGEDIVWTPIMLTNSRPYYYVDNDAP  302

Query  135  SREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
                  YF+ LR ++L L  G+    EPY PHRF RQFGFYQ
Sbjct  303  QVLKSNYFMSLRFNYLPLTYGNSFIIEPYSPHRFGRQFGFYQ  344



>ref|XP_009594483.1| PREDICTED: uncharacterized protein LOC104090969 [Nicotiana tomentosiformis]
Length=420

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 96/166 (58%), Gaps = 9/166 (5%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA   KI  A PVLASIY GLN IS S    +    FPIHYVY WLA Y +TH+
Sbjct  96   FKMASMMASRRKISFAVPVLASIYHGLNKISSSSQLDEAKVCFPIHYVYGWLAHYLKTHY  155

Query  312  ---KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKG-DVSWLCNSRKDNRDFIFY-D  148
               K PS     P MV  SGEG ARY+ + DARK+I  G D+ W      ++  + +Y D
Sbjct  156  PLAKGPSV----PLMVAYSGEGAARYFDKKDARKRIHNGDDIVWTPTMLTNSCPYYYYVD  211

Query  147  NRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            N      +  YF+ L  ++L LR  +    +PY PHRF RQFGFYQ
Sbjct  212  NEAPQELESNYFMSLPFNYLPLRYDNSFIIDPYSPHRFGRQFGFYQ  257



>ref|XP_007207754.1| hypothetical protein PRUPE_ppa026862mg [Prunus persica]
 gb|EMJ08953.1| hypothetical protein PRUPE_ppa026862mg [Prunus persica]
Length=652

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 89/168 (53%), Gaps = 14/168 (8%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN IS +  PG      P HYVY WL  Y+ THF
Sbjct  251  FKVASRMAHGVSFSLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFDTHF  310

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFY------  151
             T S   + P M   SG   A+++ +  AR  +F+      C   K NR    +      
Sbjct  311  -TSSSERSIPIMARFSGRLSAKFFEDSTAR-ALFR-----TCGKVKMNRLAKVFSECKQL  363

Query  150  -DNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             D    S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF + Q
Sbjct  364  TDEDHISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHRFSRQFCYVQ  411



>ref|XP_007217848.1| hypothetical protein PRUPE_ppa024192mg [Prunus persica]
 gb|EMJ19047.1| hypothetical protein PRUPE_ppa024192mg [Prunus persica]
Length=797

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 89/164 (54%), Gaps = 6/164 (4%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN IS +  PG      P HYVY WL  Y+ THF
Sbjct  251  FKVASRMAHGVSFSLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFDTHF  310

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR---KKIFKGDVSWLCNSRKDNRDFIFYDNR  142
             T S   + P M   SG   A+++ +  AR   +   K  +S L     + +     D+ 
Sbjct  311  -TSSSERSIPIMARFSGRLSAKFFEDSTARALFRTCGKVKMSRLAKVFSECKQLTNEDHI  369

Query  141  RGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
              S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF + Q
Sbjct  370  --SKEDFEYLICLRSGFISLRQENYRVIQPYSPHRFSRQFCYVQ  411



>ref|XP_007204932.1| hypothetical protein PRUPE_ppa016960mg, partial [Prunus persica]
 gb|EMJ06131.1| hypothetical protein PRUPE_ppa016960mg, partial [Prunus persica]
Length=339

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 87/163 (53%), Gaps = 4/163 (2%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA      LA PVLASIY GLN IS +  PG      P HYVY WL  Y+ THF
Sbjct  162  FKVASRMAHDVSFSLAVPVLASIYKGLNDISSADDPGNCTIILPFHYVYGWLGEYFDTHF  221

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFK--GDVSWLCNSRKDNRDFIFYDNRR  139
             T S   + P M   SG    +++ +  AR  +F+  G V     +R  +      D   
Sbjct  222  -TSSPEKSIPIMARFSGRLSVKFFEDSTAR-ALFRTCGKVKMSRLARVFSECKQLTDEDH  279

Query  138  GSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF + Q
Sbjct  280  ISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHRFSRQFCYVQ  322



>ref|XP_007212530.1| hypothetical protein PRUPE_ppa019343mg [Prunus persica]
 gb|EMJ13729.1| hypothetical protein PRUPE_ppa019343mg [Prunus persica]
Length=475

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN IS +  PG      P HYVY WL  Y+ T+F
Sbjct  165  FKVASRMAHGVSFGLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFNTYF  224

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR---KKIFKGDVSWLCNSRKDNRDFIFYDNR  142
             T S   + P M   SG   A ++    A+   +   K ++S L     + +     D  
Sbjct  225  -TSSSEKSIPIMARFSGRLSANFFEHSTAQALLRTCGKVEMSRLATVFSECKQLT--DKD  281

Query  141  RGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
              S+EDFEY ICLR  F+ LR+ +    +PY PH+FSRQF + Q
Sbjct  282  HISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHQFSRQFCYVQ  325



>ref|XP_007199214.1| hypothetical protein PRUPE_ppa021857mg [Prunus persica]
 gb|EMJ00413.1| hypothetical protein PRUPE_ppa021857mg [Prunus persica]
Length=504

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  +A G    LA PVLASIY GLN IS ++ PG      P HYVY WL  Y+ THF
Sbjct  162  FKVASRIAHGVSFSLAVPVLASIYKGLNDISSTNDPGNCTIVLPFHYVYGWLGEYFDTHF  221

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFK--GDVSWLCNSRKDNRDFIFYDNRR  139
             + S     P M   SG   A+++ +  AR  +F+  G V     +R  +      D   
Sbjct  222  TSSSEKFI-PIMARFSGRLSAKFFEDSTAR-ALFRTCGKVKMSRLARVFSECKQLTDEDH  279

Query  138  GSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             S+EDFEY ICLR  F+ LR+ +    +PY PH+FS QF + Q
Sbjct  280  ISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHQFSGQFCYVQ  322



>ref|XP_007201656.1| hypothetical protein PRUPE_ppa022059mg, partial [Prunus persica]
 gb|EMJ02855.1| hypothetical protein PRUPE_ppa022059mg, partial [Prunus persica]
Length=487

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 85/160 (53%), Gaps = 6/160 (4%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA  VLASIY G N+IS +  PG      P HYVY WL  Y+ THF
Sbjct  329  FKVASRMAHGVSFGLAVLVLASIYKGPNNISSADDPGNCKTALPFHYVYGWLGEYFDTHF  388

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIF---KGDVSWLCNSRKDNRDFIFYDNR  142
             T S   + P M   SG   A+++ +  AR       K ++S L     + +     D  
Sbjct  389  -TLSSKKSIPIMARFSGRLSAKFFEDSTARALFLTCGKVEMSHLARVFLECKQLT--DED  445

Query  141  RGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQF  22
              S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF
Sbjct  446  HISKEDFEYLICLRSGFISLRQENYRVIQPYRPHRFSRQF  485



>ref|XP_007210252.1| hypothetical protein PRUPE_ppa014925mg [Prunus persica]
 gb|EMJ11451.1| hypothetical protein PRUPE_ppa014925mg [Prunus persica]
Length=657

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA      LA PVLA+IY GLN IS    PG      P HYVY WL  Y+ THF
Sbjct  275  FKVASRMAHSVSFSLAVPVLANIYKGLNDISSVDDPGNCTTVLPFHYVYGWLGEYFDTHF  334

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR---KKIFKGDVSWLCNSRKDNRDFIFYDNR  142
             T S   + P +   SG   A+++ +  AR   +   K  +S L     + +     D  
Sbjct  335  -TSSSEKSIPIIARFSGRLLAKFFEDSTARALFRTCGKVKMSRLAKVFLECKQLT--DED  391

Query  141  RGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
              S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF + Q
Sbjct  392  HISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHRFSRQFCYVQ  435



>ref|XP_007203322.1| hypothetical protein PRUPE_ppa020000mg, partial [Prunus persica]
 gb|EMJ04521.1| hypothetical protein PRUPE_ppa020000mg, partial [Prunus persica]
Length=320

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK A  MA G    LA PVLASIY GLN IS +   G      P HYVY WL  Y+ T+F
Sbjct  139  FKFASRMAHGVSFSLAVPVLASIYKGLNDISSADDSGNCTTVLPFHYVYRWLGEYFDTYF  198

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFK--GDVSWLCNSRKDNRDFIFYDNRR  139
             T S   + P M   SG   A++Y    AR  +F+  G V     +R  +      D   
Sbjct  199  -TSSSEKSLPIMARFSGRLSAKFYDNSTAR-ALFRTCGKVKMSRLARVFSECKQLTDEDH  256

Query  138  GSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             S+EDFEY ICLR  F+ L++ +    + Y PHRFSRQF + Q
Sbjct  257  ISKEDFEYLICLRSGFVSLQQENYRVIQSYSPHRFSRQFCYVQ  299



>ref|XP_009790290.1| PREDICTED: uncharacterized protein LOC104237764 [Nicotiana sylvestris]
Length=601

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  474  MAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHFKTPSFT  295
            MA G K  LA PVLASIY GL  IS S+        FPIHYVY W+  Y++TH +  + T
Sbjct  1    MAHGVKFSLAVPVLASIYRGLREISTSNDLIASDVIFPIHYVYGWMGEYFETHHRV-NHT  59

Query  294  LANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCN-SRKDNRDFIFYDNRRGSREDFE  118
              +  +   SGE  A+Y+   DAR+   + D   L + +    ++  F DN + S    E
Sbjct  60   HRSLPLCKISGEKMAKYFNLSDARRLFQRDDARQLHHLALLRGKELHFTDNGKLSDSFSE  119

Query  117  YFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            +FI LR S+L LR  +    E Y P+RFSRQFGF+Q
Sbjct  120  FFISLRSSYLTLRHDATFIVESYSPYRFSRQFGFFQ  155



>gb|ADN34118.1| hypothetical protein [Cucumis melo subsp. melo]
Length=701

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (55%), Gaps = 3/163 (2%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGD-PFPIHYVYSWLATYYQTH  316
            F+ A +MA G    LA  VLA+IY GL  I+++ +P +  D  FP+HYV+ WLA Y+ TH
Sbjct  81   FRAASLMAAGTIYSLAVLVLANIYHGLGLITKASNPIRCMDFHFPMHYVHGWLAHYFGTH  140

Query  315  FKTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGD-VSWLCNSRKDNRDFIFYDNRR  139
            +  P+  +  PKM   SGEGG+ Y+ E +AR+ I  G  + W  N +  ++     D   
Sbjct  141  YPLPT-EVRGPKMTNFSGEGGSIYFGEYEARELIHNGARIQWHANLQNRSKHERMVDTHD  199

Query  138  GSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             S     YF+ +R  +L  R  +      Y P+R  RQFGFYQ
Sbjct  200  SSFLQMSYFVSMRSCYLSSRCENTWIITSYSPYRLGRQFGFYQ  242



>ref|XP_007207920.1| hypothetical protein PRUPE_ppa018940mg, partial [Prunus persica]
 gb|EMJ09119.1| hypothetical protein PRUPE_ppa018940mg, partial [Prunus persica]
Length=458

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 79/161 (49%), Gaps = 28/161 (17%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK A  MA G    LA PVLASIY GLN IS ++ PG      P HYVY WL  Y+ THF
Sbjct  180  FKFASRMAHGVSFSLAVPVLASIYKGLNDISSANDPGNYTTVLPFHYVYGWLGEYFDTHF  239

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFYDNRRGS  133
                 T ++ K +       A+ ++E               C    D  D I       S
Sbjct  240  -----TSSSEKSIPIMASRLAKVFSE---------------CKQLTDE-DHI-------S  271

Query  132  REDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            +EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF   Q
Sbjct  272  KEDFEYLICLRSGFVSLRQENYRVIQPYSPHRFSRQFCSVQ  312



>ref|XP_007212521.1| hypothetical protein PRUPE_ppa017902mg, partial [Prunus persica]
 gb|EMJ13720.1| hypothetical protein PRUPE_ppa017902mg, partial [Prunus persica]
Length=507

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 84/164 (51%), Gaps = 6/164 (4%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY+ LN+IS +  P       P HYVY WL  Y  THF
Sbjct  192  FKVASQMAYGVSFGLAVPVLASIYTRLNNISSADDPENCTTVLPFHYVYGWLGEYLDTHF  251

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR---KKIFKGDVSWLCNSRKDNRDFIFYDNR  142
             T S   + P M   SG   A+++ +  AR   +   K  +S L     + +     D  
Sbjct  252  -TSSSEKSIPIMARFSGRLSAKFFEDSTARALFRTCGKLKMSRLARVFSECKQLT--DED  308

Query  141  RGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
              S+EDF Y ICLR  F+ LR+ +    +PY PH FS QF + Q
Sbjct  309  YISKEDFTYLICLRSGFVSLRQENYRVIQPYSPHWFSTQFCYVQ  352



>ref|XP_006377155.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa]
 gb|ERP54952.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa]
Length=625

 Score = 93.6 bits (231),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 85/168 (51%), Gaps = 15/168 (9%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A +MA G +  LA PVLASI+ GL  +  + S      PFPIH++ SWLA  + TH 
Sbjct  239  FKVASLMAAGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTHQ  298

Query  312  KTPSFTLANPKMVTNSGEGGARYYTE-------MDARKKIFKGDVSWLCNSRKDNRDFIF  154
             T S T     M   +G G A+++ +        D ++ IF   +          +  + 
Sbjct  299  TTISLTKL-VGMTKYAGVGLAKHFNKSQAHALFRDPKRVIFPALLPL-------AKVGVL  350

Query  153  YDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            YD+   S  + +YF+C+R  +L LR       E Y P RFSRQFGF Q
Sbjct  351  YDDGNLSILESDYFMCIRSGYLTLRYDDTFIIESYCPDRFSRQFGFCQ  398


 Score = 31.6 bits (70),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  601  PFLELGISRRFEKEAYLAAFLSC  533
            PF EL +    + E YLAAFLSC
Sbjct  197  PFKELNVPSHIQDEVYLAAFLSC  219



>ref|XP_007224673.1| hypothetical protein PRUPE_ppa025899mg [Prunus persica]
 gb|EMJ25872.1| hypothetical protein PRUPE_ppa025899mg [Prunus persica]
Length=440

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 86/172 (50%), Gaps = 15/172 (9%)
 Frame = -2

Query  486  IACMMAK----GDKICLAAP-------VLASIYSGLNSISESHSPGQIGDPFPIHYVYSW  340
            +AC + K     D + L  P        +A IY GLN IS +   G      P +YVY W
Sbjct  192  LACWLCKFVFSKDDVTLIRPGVFKVASRMARIYKGLNDISSADDLGNCTTVLPFNYVYGW  251

Query  339  LATYYQTHFKTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFK--GDVSWLCNSRKDNR  166
            L  Y+ THF T S   + P M   SG   A+++ +  AR  +F+  G V   C ++  + 
Sbjct  252  LGEYFDTHF-TSSSEKSIPIMARFSGRLSAKFFEDSTARA-LFRTCGKVKMSCLAKVFSE  309

Query  165  DFIFYDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
                 D    S+EDFEY ICLR  F+ LR+ +    +PY PHRFSRQF + Q
Sbjct  310  CKQLTDEDHISKEDFEYLICLRSGFVSLRQENYRVIQPYSPHRFSRQFCYVQ  361



>ref|XP_007225062.1| hypothetical protein PRUPE_ppa025425mg, partial [Prunus persica]
 gb|EMJ26261.1| hypothetical protein PRUPE_ppa025425mg, partial [Prunus persica]
Length=548

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = -2

Query  447  AAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHFKTPSFTLANPKMVTN  268
            A PVLASIY GLN IS ++  G      P HYVY WL  Y+ THF T S   + P M   
Sbjct  168  AIPVLASIYKGLNDISSANDLGNCATILPFHYVYGWLGEYFDTHF-TSSSEKSTPIMTRF  226

Query  267  SGEGGARYYTEMDARKKIFK--GDVSWLCNSRKDNRDFIFYDNRRGSREDFEYFICLRPS  94
             G   A+++ +  A + +F+  G V     +R  +      D    S+EDF + ICLR  
Sbjct  227  LGRLSAKFFEDSTA-QALFRTCGKVEMSHLARVFSECKRLTDEDHISKEDFAHLICLRLR  285

Query  93   FLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            ++ LR  +    +PY PHRFSRQF + Q
Sbjct  286  YVSLREENYRVIQPYSPHRFSRQFYYVQ  313



>ref|XP_011002234.1| PREDICTED: uncharacterized protein LOC105109284 [Populus euphratica]
Length=997

 Score = 89.0 bits (219),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 82/168 (49%), Gaps = 15/168 (9%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA G +  LA PVLASI+ GL  +  + S      PFPIH++ SWLA  + TH 
Sbjct  333  FKVASMMAVGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTH-  391

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEM-------DARKKIFKGDVSWLCNSRKDNRDFIF  154
            +T         M   +G G A+++ E        D ++ IF   +          +  + 
Sbjct  392  QTAISPAKLVGMTKYAGVGLAKHFNESQANALFRDPKRVIFPALLPLA-------KVVVL  444

Query  153  YDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             D+   S    +YF+C+R  +L LR       E Y P RFSRQFGF Q
Sbjct  445  CDDGNLSVLKSDYFMCIRSGYLTLRYDDTFIIESYCPDRFSRQFGFCQ  492


 Score = 31.6 bits (70),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  601  PFLELGISRRFEKEAYLAAFLSC  533
            PF EL +    + E YLAAFLSC
Sbjct  291  PFKELNVPSHIQDEVYLAAFLSC  313



>ref|XP_006373173.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa]
 gb|ERP50970.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa]
Length=946

 Score = 87.8 bits (216),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 82/168 (49%), Gaps = 15/168 (9%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA G +  LA PVLASI+ GL  +  + S      PFPIH++ SWLA  + TH 
Sbjct  310  FKVASMMAVGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTH-  368

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEM-------DARKKIFKGDVSWLCNSRKDNRDFIF  154
            +T         M   +G G A+++ E        D ++ IF   +          +  + 
Sbjct  369  QTAISPAKLVGMTKYAGMGLAKHFNESQANALFRDPKRVIFPALLPL-------AKVVVL  421

Query  153  YDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             D+   S    +YF+C+R  +L LR       E Y P RFSRQFGF Q
Sbjct  422  CDDGNLSVLKSDYFMCIRYGYLTLRYDDTFIIESYCPDRFSRQFGFCQ  469


 Score = 32.0 bits (71),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  601  PFLELGISRRFEKEAYLAAFLSC  533
            PF EL +    + E YLAAFLSC
Sbjct  268  PFKELNVPSHMQDEVYLAAFLSC  290



>ref|XP_007208747.1| hypothetical protein PRUPE_ppa015409mg [Prunus persica]
 gb|EMJ09946.1| hypothetical protein PRUPE_ppa015409mg [Prunus persica]
Length=518

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 78/151 (52%), Gaps = 8/151 (5%)
 Frame = -2

Query  450  LAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHFKTPSFTLANPKMVT  271
            L+ PVLASIY GLN IS +  PG      P HYVY WL  Y+ THF T S   + P M  
Sbjct  215  LSVPVLASIYKGLNDISSADDPGNCTTILPFHYVYGWLGEYFGTHF-TSSSEKSIPIMAR  273

Query  270  NSGEGGARYYTEMDARKKIF----KGDVSWLCNSRKDNRDFIFYDNRRGSREDFEYFICL  103
              G   A ++ E      +F    K ++S L     + +     D    S+EDFE+ ICL
Sbjct  274  FLGRLSANFF-EYSTAGALFRTCGKVEMSLLAIVFFECKQLT--DEDHISKEDFEHLICL  330

Query  102  RPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            R   + L++ +    +PY PHRFSRQF + Q
Sbjct  331  RSGVVSLQQENYRVVQPYSPHRFSRQFCYVQ  361



>ref|XP_006376080.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa]
 gb|ERP53877.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa]
Length=334

 Score = 82.4 bits (202),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 81/171 (47%), Gaps = 21/171 (12%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A MMA G +  LA PVL SI+ GL  +  + S       FPIH++ SWLA  + TH 
Sbjct  94   FKVASMMAVGRQFSLAIPVLTSIFKGLKEVQFALSVTARDIHFPIHFLSSWLAEKFGTH-  152

Query  312  KTPSFTLANPKMVTNS---GEGGARYYTEM-------DARKKIFKGDVSWLCNSRKDNRD  163
                  ++  K+V  +   G G  +++ E        D ++ IF   +          + 
Sbjct  153  ---QIAISPAKLVGMTKYAGVGLTKHFNESQANALFRDPKRVIFPALLPL-------AKV  202

Query  162  FIFYDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             I  D+   S    +YF+C+R  +L LR       E Y P RFSRQFGF Q
Sbjct  203  VILCDDGNLSVLKSDYFMCIRSGYLTLRYNDTFIIESYCPDRFSRQFGFCQ  253


 Score = 31.2 bits (69),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  601  PFLELGISRRFEKEAYLAAFLSC  533
            PF EL +    + E YLAAFLSC
Sbjct  52   PFKELNVPFHIQDEVYLAAFLSC  74



>emb|CAN74865.1| hypothetical protein VITISV_043090 [Vitis vinifera]
Length=693

 Score = 76.6 bits (187),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA+G+   L  PVLA++Y+GLN I+ S         FPIH++Y WL  Y+ T+F
Sbjct  202  FKVASKMAQGETFSLVVPVLANMYNGLNEIACSSKLETNASIFPIHFLYGWLGEYFDTYF  261

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFY-DNRRG  136
             +PS+     +M   + E  A+ + ++ A+  I       L +    +++ + + DN   
Sbjct  262  ISPSWNHPT-RMTYYADEFSAKCFDDLQAQALIMSCKGIKLDHLALLHKERVHWTDNESI  320

Query  135  SREDFEYFICLRPSFLVLRRG  73
            S     Y I LR S+L LR+G
Sbjct  321  SVTKASYLISLRSSYLSLRQG  341


 Score = 28.9 bits (63),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  598  FLELGISRRFEKEAYLAAFLSC  533
            F  LG+++   KE YLAAFL+C
Sbjct  161  FDNLGVAKEDVKETYLAAFLAC  182



>ref|XP_008374278.1| PREDICTED: uncharacterized protein LOC103437571 [Malus domestica]
Length=751

 Score = 77.4 bits (189),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 70/153 (46%), Gaps = 14/153 (9%)
 Frame = -2

Query  435  LASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHFKTPSFTLANPKMVTNSGEG  256
            L++IY GL  +S+  S        P HYVY WL  Y+ THF + +   + P  V   G  
Sbjct  270  LSNIYDGLRVVSDLASTEDRDAVLPYHYVYGWLGEYFGTHFXSSTLDKSGP-FVVKLGPL  328

Query  255  GARYYTEMDAR-------KKIFKG----DVSWLCNSRKDNRDFIFYDNRRGSREDFEYFI  109
              +Y   + A+       + +F+      +  L       RD +  D+      D  Y I
Sbjct  329  MMKYSGVLSAKSLDDQQVQTLFRSCEGLRMDRLARVGSVQRDIM--DDSHLHFSDLSYLI  386

Query  108  CLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             LR  ++ LR+  +C  +PY PHR SRQFGF Q
Sbjct  387  SLRSGYVSLRQEDRCIIQPYSPHRLSRQFGFVQ  419


 Score = 26.6 bits (57),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 5/30 (17%)
 Frame = -1

Query  607  RTP-----FLELGISRRFEKEAYLAAFLSC  533
            RTP     F +L ++    +E+YLAAFL+C
Sbjct  239  RTPNELRAFEDLDVALEHLEESYLAAFLAC  268



>gb|KDP33400.1| hypothetical protein JCGZ_12856 [Jatropha curcas]
Length=469

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 6/118 (5%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FKIA ++A G+   LA P+LASIY GL  IS + +  +   P P HYVY+WLA  + TH 
Sbjct  168  FKIASIIASGEIFSLAIPILASIYRGLQVISTATTLNRCEVPLPFHYVYAWLANMHFTH-  226

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFYDNRR  139
                    + KM + SG+  A+YY E +   K+F    ++L  SR   +DF   DN R
Sbjct  227  ----DVEEDAKMTSYSGQRIAKYYNETEV-TKLFVERKAYLGPSRIMEKDFFLEDNGR  279



>ref|XP_009615588.1| PREDICTED: uncharacterized protein LOC104108294 [Nicotiana tomentosiformis]
Length=546

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = -2

Query  294  LANPKMVTNSGEGGARYYTEMDARKKIFKGD-VSWLCNSRKDNRDFIFYDNRRGSREDFE  118
            LA P M   SGEG  RY+   DARK+I  G+ V+W      +++ + + D+      +  
Sbjct  117  LATPLMAIYSGEGTTRYFGNEDARKRILGGESVAWTSTMPSNSQPYYYRDDGNEQESESN  176

Query  117  YFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQA  7
            YF+ +  ++L LR GS    EPY PHRFSRQF FYQ 
Sbjct  177  YFMSICSNYLPLRNGSTFIMEPYSPHRFSRQFSFYQV  213



>ref|XP_007213486.1| hypothetical protein PRUPE_ppa022696mg, partial [Prunus persica]
 gb|EMJ14685.1| hypothetical protein PRUPE_ppa022696mg, partial [Prunus persica]
Length=374

 Score = 75.5 bits (184),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN+IS +  PG      P HYVY WL  Y+ THF
Sbjct  163  FKVASRMAHGVSFGLAVPVLASIYKGLNNISSADDPGNCTTVLPFHYVYGWLGEYFDTHF  222

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR  223
             T S   + P +   SG+   +++ +  AR
Sbjct  223  -TSSSEKSIPIIARFSGKLSVKFFEDSTAR  251


 Score = 25.4 bits (54),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  598  FLELGISRRFEKEAYLAAFLSC  533
            F +LGI+    + +YLAAFL+C
Sbjct  122  FEDLGITDEDMERSYLAAFLAC  143



>ref|XP_011470543.1| PREDICTED: uncharacterized protein LOC105353249 [Fragaria vesca 
subsp. vesca]
Length=890

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MAKG +  L  PVLA+IY GLN IS S+ P       P HYVY+WLA Y+ THF
Sbjct  282  FKVASNMAKGCQYSLVVPVLANIYQGLNEISASNDPRNCSAALPFHYVYAWLAEYFDTHF  341

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR  223
                     P M+  SG   A+++ +  AR
Sbjct  342  FNSLPEDLRPFMIHYSGAFAAKHFEDTQAR  371



>ref|XP_007212994.1| hypothetical protein PRUPE_ppa022760mg, partial [Prunus persica]
 gb|EMJ14193.1| hypothetical protein PRUPE_ppa022760mg, partial [Prunus persica]
Length=233

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN IS +  PG      P HYVY WL  Y+ THF
Sbjct  162  FKVANRMAHGVSFGLAIPVLASIYKGLNDISSADDPGNWTTILPFHYVYGWLGEYFDTHF  221

Query  312  KTPS  301
             + S
Sbjct  222  TSSS  225



>ref|XP_007207873.1| hypothetical protein PRUPE_ppa021382mg, partial [Prunus persica]
 gb|EMJ09072.1| hypothetical protein PRUPE_ppa021382mg, partial [Prunus persica]
Length=394

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G    LA PVLASIY GLN IS +  P       P HYVY WL  Y+ THF
Sbjct  290  FKVASRMAYGVSFSLAVPVLASIYKGLNDISSADDPRNCTTVLPCHYVYGWLGEYFDTHF  349

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDAR  223
             T S   + P M   SG     ++ +  AR
Sbjct  350  -TSSSEKSIPIMARFSGRLSVTFFEDSTAR  378



>ref|XP_008342753.1| PREDICTED: uncharacterized protein LOC103405520 [Malus domestica]
Length=1161

 Score = 66.2 bits (160),  Expect(2) = 7e-11, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK++  MA G+   LA PVLA+IY GL  +S+  S        P HYVY WL  Y+ THF
Sbjct  276  FKVSSKMAAGESFSLAIPVLANIYDGLRVVSDLASTEDRDAVLPYHYVYGWLGEYFGTHF  335

Query  312  KTPSFTLANPKMV  274
             + +   + P +V
Sbjct  336  SSSTLDKSGPSVV  348


 Score = 27.3 bits (59),  Expect(2) = 7e-11, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 5/30 (17%)
 Frame = -1

Query  607  RTP-----FLELGISRRFEKEAYLAAFLSC  533
            RTP     F +LG+     +E+YLAAFL+C
Sbjct  227  RTPNELRAFEDLGVVLEHLEESYLAAFLAC  256



>ref|XP_009343023.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103934981 
[Pyrus x bretschneideri]
Length=3189

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G+   LA PVLA+IY+GL+ +S S +        P HYVY WL  Y+ THF
Sbjct  198  FKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTHF  257

Query  312  KTPSFTLANPKMVTNSG  262
             + +   + P M   SG
Sbjct  258  FSSTLNKSGPLMTKYSG  274


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  MA G+   LA PVLA+IY+GL+ +S S +        P HYVY WL  Y+ THF
Sbjct  890  FKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTHF  949

Query  312  KTPSFTLANPKMVTNSG  262
             + +   + P M   SG
Sbjct  950  FSSTLNKSGPLMTKYSG  966


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  492   FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
             FK+A  MA G+   LA PVLA+IY+GL+ +S S +        P HYVY WL  Y+ THF
Sbjct  2070  FKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTHF  2129

Query  312   KTPSFTLANPKMVTNSG  262
              + +   + P M   SG
Sbjct  2130  FSSTLNKSGPLMTKYSG  2146


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  492   FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
             FK+A  MA G+   LA PVLA+IY+GL+ +S S +        P HYVY WL  Y+ THF
Sbjct  2762  FKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTHF  2821

Query  312   KTPSFTLANPKMVTNSG  262
              + +   + P M   SG
Sbjct  2822  FSSTLNKSGPLMTKYSG  2838



>gb|KDP36670.1| hypothetical protein JCGZ_07888 [Jatropha curcas]
Length=347

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 50/90 (56%), Gaps = 4/90 (4%)
 Frame = -2

Query  279  MVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFYDNRRGSREDFEYFICLR  100
            M + SG+  A+YY E +  K  F G  S  C  +KD   F+  DN + S    E+FI LR
Sbjct  1    MTSYSGQRMAKYYNETEVTK-TFYGKESLFCIMKKD---FLLEDNGKLSLYQVEHFINLR  56

Query  99   PSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
             SFL LR  +Q   + Y PHRFS Q G+YQ
Sbjct  57   SSFLTLRYKNQYIIQSYSPHRFSGQLGYYQ  86



>gb|KDP35489.1| hypothetical protein JCGZ_10936 [Jatropha curcas]
Length=157

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 66/152 (43%), Gaps = 31/152 (20%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A M+  G+   LA  +LASIY  L +IS + +  +                      
Sbjct  37   FKVASMITSGEIFSLAILILASIYRDLRAISTTTTLKR----------------------  74

Query  312  KTPSFTLANPKMVTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFIFYDNRRGS  133
                    + KM + SG+  A+YY E +  K +F    ++L  S    +DF   DN + S
Sbjct  75   --------DAKMTSYSGQRMAKYYNETEVMK-LFMEMKAYLGPSHIMKKDFFLKDNGKLS  125

Query  132  REDFEYFICLRPSFLVLRRGSQCKAEPYMPHR  37
                E+ I LR SFL L   +Q   E Y PHR
Sbjct  126  SHQVEHLINLRSSFLTLHYKNQYIIESYNPHR  157



>ref|XP_009378244.1| PREDICTED: uncharacterized protein LOC103966764 [Pyrus x bretschneideri]
Length=300

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQTHF  313
            FK+A  M  G+   LA PVLA+IY+GL+ +S S S        P HYVY WL  Y+  HF
Sbjct  204  FKVASKMVTGESFSLAIPVLANIYNGLSIVSNSASTEDHAVVLPYHYVYDWLVEYFGNHF  263

Query  312  KTPSFTLANPKMVTN  268
             + +   + P   T+
Sbjct  264  SSSTLDKSGPSSSTS  278



>ref|XP_009374098.1| PREDICTED: uncharacterized protein LOC103963041 [Pyrus x bretschneideri]
Length=392

 Score = 47.8 bits (112),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVY  346
            FK+A  MA G+   LA PVLA+IY+GL+ +S S +        P HYVY
Sbjct  343  FKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVY  391


 Score = 28.1 bits (61),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  598  FLELGISRRFEKEAYLAAFLSC  533
            F +LGI+    +E+YLAAFL+C
Sbjct  302  FEDLGIAPEHVEESYLAAFLAC  323



>ref|XP_008383917.1| PREDICTED: uncharacterized protein LOC103446564 [Malus domestica]
Length=643

 Score = 47.4 bits (111),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYS  343
            FK+A  MA G+   LA PVLA IY+GL+ +S+  S        P HYVY+
Sbjct  343  FKVASKMAAGESFSLAIPVLAXIYNGLSMVSDXASTEDRAAVLPYHYVYA  392


 Score = 28.1 bits (61),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  598  FLELGISRRFEKEAYLAAFLSC  533
            F +LGI+     E+YLAAFL+C
Sbjct  302  FEDLGIAPEHVXESYLAAFLAC  323



>ref|XP_007224870.1| hypothetical protein PRUPE_ppa022702mg, partial [Prunus persica]
 gb|EMJ26069.1| hypothetical protein PRUPE_ppa022702mg, partial [Prunus persica]
Length=418

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  DNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
            D    S+EDFEY ICLR  F+ LR+      +PY PHRFSRQF + Q
Sbjct  315  DEDHISKEDFEYLICLRSGFVSLRQEHYRVIQPYSPHRFSRQFCYVQ  361



>ref|XP_002535994.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26390.1| conserved hypothetical protein, partial [Ricinus communis]
Length=110

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  486  IACMMAKGDKICLAAPVLASIYSGLNSISESH-SPGQIGDPFPIHYVYSWLATYY  325
            +A  + +G ++ +A  VLASIY GL ++++    PGQ    FP+HY Y+WL  Y+
Sbjct  1    MAGFLVQGKRVAIAPAVLASIYYGLGAVAQDKLGPGQCNAEFPVHYFYAWLDQYF  55



>ref|XP_002538435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF23949.1| conserved hypothetical protein [Ricinus communis]
Length=112

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  486  IACMMAKGDKICLAAPVLASIYSGLNSISESH-SPGQIGDPFPIHYVYSWLATYY  325
            +A  + +G ++ +A  VLASIY GL ++++    PGQ    FP+HY Y+WL  Y+
Sbjct  1    MAGFLVQGKRVAIAPAVLASIYYGLGAVAQDKLGPGQCNAEFPVHYFYAWLDQYF  55



>gb|KGN58004.1| hypothetical protein Csa_3G426900 [Cucumis sativus]
Length=775

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (44%), Gaps = 32/183 (17%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISE----SHSPGQIGDPFPIHYVYSWLATYY  325
            F IA  +  G K+ LA  VLA +Y  L+ + E    + + G+I    P   V  W   ++
Sbjct  294  FPIAAHLVGGTKMALAPAVLAGLYKNLSLLKEKALSASNYGEITVIAPFRLVLLWAFEHF  353

Query  324  QTHFKTPSFTLANPKMVTNSGEGGARYYT---EMDA-------------RKKIFKGDVS-  196
                  P     +P ++ +     AR+Y    +MD              + + +  D++ 
Sbjct  354  ------PQLVRTSPNVLKSGEPRAARWYKFICQMDKSFVDPVFLSGQYFQWRPYAADITN  407

Query  195  WLCNSRKDNRDFIFYDNRRGSREDFE-YFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFG  19
            W  +S     D +  D+ + S ++ + Y IC+   +LV   G  C+ E YMPHR + QFG
Sbjct  408  WNHSSYYRAEDHLEIDSGKNSDQNLQCYLICMTMCYLV---GLDCR-ESYMPHRVAMQFG  463

Query  18   FYQ  10
              Q
Sbjct  464  IDQ  466



>gb|ABB55315.1| dna-directed rna polymerase ii - related [Asparagus officinalis]
Length=702

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  135  SREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQAY  4
            SR  F + I +RP +L+ R+G +C  EPY P+RFSRQFG+ Q Y
Sbjct  71   SRGVFWWLISIRPGYLIFRQGRKCFIEPYQPYRFSRQFGYDQLY  114



>gb|KDP39095.1| hypothetical protein JCGZ_00852 [Jatropha curcas]
Length=614

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 75/183 (41%), Gaps = 33/183 (18%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISES-HSPGQIGDPF------PIHYVYSWLA  334
            F IA  +AKG+ + L   VLASIY  L  +  +  +  + GD        P H V  W  
Sbjct  229  FPIAIHLAKGELVALGPAVLASIYRDLGLLKATILAATEFGDALGVTLWSPFHLVQLWAW  288

Query  333  TYYQTHFKTPSFT-LANPKMVTNSGEGGAR---YYTEMDARKKIF----------KGDVS  196
              +      P+ +    P+        G +   +   +D+  + F          K    
Sbjct  289  ERFAEFQPKPNVSGNGKPRSALWDEVNGTKVVNFRLALDSAAEAFCWRPYATGPHKSHFL  348

Query  195  WLCNSRKDNRDFIFYDNRRGSREDFEYF-ICLRPSFLVLRRGSQCKAEPYMPHRFSRQFG  19
              C  +++ +D        GS +D   F ICLR S LV   G  C  E Y+PHR +RQFG
Sbjct  349  KFCKEKEEWQDL-------GSNQDLLSFAICLRVSELV---GLDC-IEQYLPHRVARQFG  397

Query  18   FYQ  10
            F Q
Sbjct  398  FDQ  400



>gb|ABD63174.1| hypothetical protein 20.t00026 [Asparagus officinalis]
Length=903

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  123  FEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQAY  4
            F + + +RP +L+ R+G  C  EPY P+RF+RQFG+ Q Y
Sbjct  110  FHWLLSIRPGYLIFRQGVNCFVEPYQPYRFARQFGYDQLY  149



>gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officinalis]
Length=1322

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 78/180 (43%), Gaps = 19/180 (11%)
 Frame = -2

Query  483  ACMMAKGDKICLAAPVLASIYSGLNSIS------ESHSPGQIGD---PFPIHYVYSWLAT  331
            A  +A   ++ L   ++A+I+ GL  IS      +   P QI       P  Y+ +W   
Sbjct  543  AVQLAYKKELSLLPVMVANIHRGLRQISGAFTRRDDDKPTQIPTIKVELPYIYLMAWFVL  602

Query  330  YYQTHFKTP-SFTLANPKM-VTNSGEGGARYYTEMDARKKIFKGDVSWLCNSRKDNRDFI  157
            +       P +   + P + +  +GE   R + ++  + ++ K      C  +  +R   
Sbjct  603  HRSDVMSVPNAIDQSVPFLQLLENGEWEGRGFPDIRRQLQVHKCWAFSTCFPQFSSRYGE  662

Query  156  FYDNRRGSRE--------DFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQAYA  1
               +    RE         F + + +RP +L  R G+QC  EPY+P RF+RQFG+ Q Y 
Sbjct  663  CLIDEEKPREYRTYLDMGCFNWLVNIRPGYLTFRVGNQCFIEPYLPCRFARQFGYDQLYV  722



>ref|XP_010324434.1| PREDICTED: uncharacterized protein LOC101267626 [Solanum lycopersicum]
Length=981

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 80/185 (43%), Gaps = 37/185 (20%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISES--HSPGQIGDPFPIHYVYSWLATYYQT  319
            F +A  +A+G ++ LA  VLASIY  L S+ ++   + G+  D   IH +  W   ++  
Sbjct  222  FSLAVNLARGMRLALAPAVLASIYRDLGSLRKAMIETGGRNRDINEIHKLNLWSPLFFVQ  281

Query  318  HFKTPSFTLANPKMVTN----SGEGGARYY-----------TEMDARKKIF-KGDVSWLC  187
             +         P+   N    SG    R++           T +DA  +IF  G   WL 
Sbjct  282  VWAWERMVSLQPECPRNYNIVSGVRIGRWHNAKQTGETNLRTTIDASGEIFCGGHTPWLW  341

Query  186  NSR---KDNRDFIFYDNRRGSREDFEYFI-CLRPSFLVLRRGSQCKAEPYMPHRFSRQFG  19
                    N D           +D E F+ CLR S LV   G  C+ EPY P+R + QFG
Sbjct  342  KWTIVGGQNLD-----------QDMESFVRCLRVSELV---GLDCQ-EPYRPNRVAMQFG  386

Query  18   FYQAY  4
            + Q +
Sbjct  387  YDQDF  391



>ref|XP_009764875.1| PREDICTED: uncharacterized protein LOC104216514 [Nicotiana sylvestris]
Length=533

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 75/179 (42%), Gaps = 22/179 (12%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDP------FPIHYVYSWLAT  331
            F +A  +A+G ++CLA  VLASIY  L S+  +    + GD        P   V  W+  
Sbjct  240  FPLAIRLARGVQVCLAPAVLASIYRDLRSLKNAILEMKDGDSPRVKIQAPFLLVQLWVWE  299

Query  330  YYQTHFKTPSFTLANPKMVTNSGEGGARY-YTEMDARKKIFKGDVSWLCNSRKDNRDFI-  157
             + T    P+        ++  G     +   E+    ++   D  W   + KD   F+ 
Sbjct  300  RFPTLQPRPNAIRRGEPRISRWGSTSRGFSVQEIQLAIRVAAPDFLWRPYA-KDLDGFVP  358

Query  156  --FYDNRRG--------SREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGFYQ  10
              FY             S + +   +C+RPS LV  +G +   E Y PHR + QFG+ Q
Sbjct  359  PAFYSEEEELELIGQNVSGKAWLLVLCIRPSVLVGLKGLR---ENYFPHRVAMQFGYDQ  414



>gb|KDP38611.1| hypothetical protein JCGZ_05318 [Jatropha curcas]
Length=523

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  492  FKIACMMAKGDKICLAAPVLASIYSGLNSISESHSPGQIGDPFPIHYVYSWLATYYQT  319
            FK+A M+A G+   LA P+LA+IY GL +IS + +  +   P P HYVY+ +    ++
Sbjct  268  FKVASMIAFGEIFSLAIPILANIYRGLRAISTATTLKRCEVPLPFHYVYACIQVLVES  325



>ref|XP_008365248.1| PREDICTED: uncharacterized protein LOC103428893 [Malus domestica]
Length=705

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 25/47 (53%), Gaps = 0/47 (0%)
 Frame = -2

Query  156  FYDNRRGSREDFEYFICLRPSFLVLRRGSQCKAEPYMPHRFSRQFGF  16
              DN      D  Y I  R  F  LR+  +C  +PY PHRFSRQFGF
Sbjct  363  IVDNSHLRSSDLSYLISXRSGFXSLRQEDRCIVQPYSPHRFSRQFGF  409



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090