BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP004A07 639 bp,

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599207.1|  PREDICTED: BTB/POZ and MATH domain-containin...    396   1e-134   Nicotiana tomentosiformis
ref|XP_009799864.1|  PREDICTED: BTB/POZ and MATH domain-containin...    393   2e-133   Nicotiana sylvestris
ref|XP_011082543.1|  PREDICTED: BTB/POZ and MATH domain-containin...    384   8e-130   Sesamum indicum [beniseed]
ref|XP_010326625.1|  PREDICTED: BTB/POZ and MATH domain-containin...    382   3e-129   Solanum lycopersicum
ref|XP_011079801.1|  PREDICTED: BTB/POZ and MATH domain-containin...    382   4e-129   Sesamum indicum [beniseed]
ref|XP_006358428.1|  PREDICTED: BTB/POZ and MATH domain-containin...    380   2e-128   Solanum tuberosum [potatoes]
ref|XP_010652109.1|  PREDICTED: BTB/POZ and MATH domain-containin...    379   2e-128   Vitis vinifera
ref|XP_006444138.1|  hypothetical protein CICLE_v10020406mg             376   4e-127   Citrus clementina
gb|KDP21503.1|  hypothetical protein JCGZ_21974                         376   7e-127   Jatropha curcas
gb|KDO68823.1|  hypothetical protein CISIN_1g015430mg                   375   8e-127   Citrus sinensis [Valencia orange]
gb|EYU46623.1|  hypothetical protein MIMGU_mgv1a007354mg                375   2e-126   Erythranthe guttata [common monkey flower]
emb|CDP03595.1|  unnamed protein product                                375   2e-126   Coffea canephora [robusta coffee]
ref|XP_006604419.1|  PREDICTED: BTB/POZ and MATH domain-containin...    372   4e-125   Glycine max [soybeans]
ref|XP_007050686.1|  BTB-POZ and MATH domain 2                          373   1e-124   Theobroma cacao [chocolate]
gb|KJB22576.1|  hypothetical protein B456_004G055100                    367   3e-124   Gossypium raimondii
ref|XP_010090357.1|  BTB/POZ and MATH domain-containing protein 2       369   4e-124   Morus notabilis
ref|XP_002524811.1|  Speckle-type POZ protein, putative                 372   6e-124   
gb|KJB22575.1|  hypothetical protein B456_004G055100                    367   2e-123   Gossypium raimondii
ref|XP_004493645.1|  PREDICTED: BTB/POZ and MATH domain-containin...    369   5e-123   
ref|XP_008458543.1|  PREDICTED: BTB/POZ and MATH domain-containin...    366   6e-123   Cucumis melo [Oriental melon]
ref|XP_007162393.1|  hypothetical protein PHAVU_001G148400g             365   1e-122   Phaseolus vulgaris [French bean]
ref|XP_008808252.1|  PREDICTED: BTB/POZ and MATH domain-containin...    362   3e-122   Phoenix dactylifera
gb|KEH23724.1|  BTB/POZ/MATH-domain protein                             363   5e-122   Medicago truncatula
ref|XP_010905245.1|  PREDICTED: BTB/POZ and MATH domain-containin...    361   1e-121   Elaeis guineensis
ref|XP_010278817.1|  PREDICTED: BTB/POZ and MATH domain-containin...    362   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_008808250.1|  PREDICTED: BTB/POZ and MATH domain-containin...    362   3e-121   Phoenix dactylifera
ref|XP_010255860.1|  PREDICTED: BTB/POZ and MATH domain-containin...    359   9e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010905244.1|  PREDICTED: BTB/POZ and MATH domain-containin...    360   9e-121   Elaeis guineensis
ref|XP_004290680.1|  PREDICTED: BTB/POZ and MATH domain-containin...    359   3e-120   Fragaria vesca subsp. vesca
gb|KJB25908.1|  hypothetical protein B456_004G215300                    357   5e-120   Gossypium raimondii
ref|XP_010255859.1|  PREDICTED: BTB/POZ and MATH domain-containin...    358   5e-120   Nelumbo nucifera [Indian lotus]
gb|KJB25907.1|  hypothetical protein B456_004G215300                    356   8e-120   Gossypium raimondii
ref|XP_007201051.1|  hypothetical protein PRUPE_ppa006488mg             358   1e-119   Prunus persica
ref|XP_002279548.1|  PREDICTED: BTB/POZ and MATH domain-containin...    357   1e-119   Vitis vinifera
ref|XP_011006874.1|  PREDICTED: BTB/POZ and MATH domain-containin...    357   2e-119   Populus euphratica
gb|KHN18899.1|  BTB/POZ and MATH domain-containing protein 2            356   2e-119   Glycine soja [wild soybean]
gb|KHG07672.1|  BTB/POZ and MATH domain-containing 2 -like protein      357   2e-119   Gossypium arboreum [tree cotton]
gb|KJB25905.1|  hypothetical protein B456_004G215300                    356   3e-119   Gossypium raimondii
ref|XP_011009015.1|  PREDICTED: BTB/POZ and MATH domain-containin...    356   4e-119   Populus euphratica
gb|KDP40087.1|  hypothetical protein JCGZ_02085                         355   8e-119   Jatropha curcas
ref|XP_002315535.1|  speckle-type POZ family protein                    355   1e-118   Populus trichocarpa [western balsam poplar]
gb|KJB28232.1|  hypothetical protein B456_005G035700                    355   2e-118   Gossypium raimondii
ref|XP_003590693.1|  Speckle-type POZ protein                           355   2e-118   Medicago truncatula
gb|EPS58860.1|  hypothetical protein M569_15950                         354   2e-118   Genlisea aurea
gb|KJB42045.1|  hypothetical protein B456_007G134100                    354   3e-118   Gossypium raimondii
ref|XP_002516797.1|  Speckle-type POZ protein, putative                 354   3e-118   Ricinus communis
gb|AFK40364.1|  unknown                                                 353   6e-118   Medicago truncatula
ref|XP_004495233.1|  PREDICTED: BTB/POZ and MATH domain-containin...    353   1e-117   Cicer arietinum [garbanzo]
gb|KHG23128.1|  BTB/POZ and MATH domain-containing protein 2            352   1e-117   Gossypium arboreum [tree cotton]
ref|XP_006380054.1|  hypothetical protein POPTR_0008s20510g             352   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_008438731.1|  PREDICTED: BTB/POZ and MATH domain-containin...    350   1e-116   Cucumis melo [Oriental melon]
gb|KHG23818.1|  BTB/POZ and MATH domain-containing 2 -like protein      350   1e-116   Gossypium arboreum [tree cotton]
ref|XP_006850808.1|  hypothetical protein AMTR_s00025p00114450          350   1e-116   Amborella trichopoda
ref|XP_006419782.1|  hypothetical protein CICLE_v10005094mg             349   3e-116   Citrus clementina
ref|XP_006588617.1|  PREDICTED: BTB/POZ and MATH domain-containin...    349   4e-116   Glycine max [soybeans]
ref|XP_006489244.1|  PREDICTED: BTB/POZ and MATH domain-containin...    348   7e-116   Citrus sinensis [Valencia orange]
ref|XP_010038130.1|  PREDICTED: BTB/POZ and MATH domain-containin...    347   1e-115   Eucalyptus grandis [rose gum]
ref|XP_004153182.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    347   3e-115   
gb|KHG05413.1|  BTB/POZ and MATH domain-containing 2 -like protein      345   9e-115   Gossypium arboreum [tree cotton]
ref|XP_010103451.1|  BTB/POZ and MATH domain-containing protein 2       345   1e-114   Morus notabilis
ref|XP_008368872.1|  PREDICTED: BTB/POZ and MATH domain-containin...    344   2e-114   Malus domestica [apple tree]
ref|XP_009787612.1|  PREDICTED: BTB/POZ and MATH domain-containin...    344   2e-114   Nicotiana sylvestris
ref|XP_004134158.1|  PREDICTED: BTB/POZ and MATH domain-containin...    342   1e-113   Cucumis sativus [cucumbers]
ref|XP_009404705.1|  PREDICTED: BTB/POZ and MATH domain-containin...    342   1e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008355456.1|  PREDICTED: BTB/POZ and MATH domain-containin...    342   1e-113   Malus domestica [apple tree]
ref|XP_008235067.1|  PREDICTED: BTB/POZ and MATH domain-containin...    340   2e-113   
ref|XP_010545078.1|  PREDICTED: BTB/POZ and MATH domain-containin...    346   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_004229460.1|  PREDICTED: BTB/POZ and MATH domain-containin...    341   3e-113   Solanum lycopersicum
ref|XP_010551778.1|  PREDICTED: BTB/POZ and MATH domain-containin...    340   1e-112   Tarenaya hassleriana [spider flower]
ref|XP_007034571.1|  BTB-POZ and MATH domain 2                          340   1e-112   Theobroma cacao [chocolate]
ref|XP_009621647.1|  PREDICTED: BTB/POZ and MATH domain-containin...    339   1e-112   Nicotiana tomentosiformis
ref|XP_007144604.1|  hypothetical protein PHAVU_007G169300g             340   1e-112   Phaseolus vulgaris [French bean]
ref|XP_009347696.1|  PREDICTED: BTB/POZ and MATH domain-containin...    339   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_004296996.1|  PREDICTED: BTB/POZ and MATH domain-containin...    338   5e-112   Fragaria vesca subsp. vesca
ref|XP_009356739.1|  PREDICTED: BTB/POZ and MATH domain-containin...    338   8e-112   Pyrus x bretschneideri [bai li]
ref|XP_006339418.1|  PREDICTED: BTB/POZ and MATH domain-containin...    337   1e-111   Solanum tuberosum [potatoes]
ref|XP_009405868.1|  PREDICTED: BTB/POZ and MATH domain-containin...    335   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405866.1|  PREDICTED: BTB/POZ and MATH domain-containin...    336   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010695310.1|  PREDICTED: BTB/POZ and MATH domain-containin...    334   2e-110   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007222747.1|  hypothetical protein PRUPE_ppa006500mg             333   3e-110   Prunus persica
ref|XP_008223027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    333   4e-110   Prunus mume [ume]
ref|XP_006407971.1|  hypothetical protein EUTSA_v10020850mg             332   1e-109   Eutrema salsugineum
emb|CDY08064.1|  BnaC03g34590D                                          330   5e-109   Brassica napus [oilseed rape]
ref|XP_009134877.1|  PREDICTED: BTB/POZ and MATH domain-containin...    330   8e-109   Brassica rapa
ref|XP_004495232.1|  PREDICTED: BTB/POZ and MATH domain-containin...    331   2e-108   Cicer arietinum [garbanzo]
ref|XP_009356740.1|  PREDICTED: BTB/POZ and MATH domain-containin...    329   2e-108   Pyrus x bretschneideri [bai li]
gb|KFK38092.1|  hypothetical protein AALP_AA3G068300                    327   7e-108   Arabis alpina [alpine rockcress]
ref|XP_010524787.1|  PREDICTED: BTB/POZ and MATH domain-containin...    326   3e-107   Tarenaya hassleriana [spider flower]
ref|XP_010524788.1|  PREDICTED: BTB/POZ and MATH domain-containin...    326   3e-107   Tarenaya hassleriana [spider flower]
ref|XP_009339952.1|  PREDICTED: BTB/POZ and MATH domain-containin...    322   2e-106   Pyrus x bretschneideri [bai li]
ref|XP_006297810.1|  hypothetical protein CARUB_v10013845mg             323   6e-106   Capsella rubella
emb|CDY24708.1|  BnaA05g31070D                                          322   6e-106   Brassica napus [oilseed rape]
ref|XP_008340895.1|  PREDICTED: BTB/POZ and MATH domain-containin...    322   1e-105   Malus domestica [apple tree]
dbj|BAJ97789.1|  predicted protein                                      322   1e-105   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009129652.1|  PREDICTED: BTB/POZ and MATH domain-containin...    322   1e-105   Brassica rapa
ref|XP_003562549.1|  PREDICTED: BTB/POZ and MATH domain-containin...    322   3e-105   Brachypodium distachyon [annual false brome]
ref|XP_008390810.1|  PREDICTED: BTB/POZ and MATH domain-containin...    320   6e-105   Malus domestica [apple tree]
ref|XP_010695312.1|  PREDICTED: BTB/POZ and MATH domain-containin...    320   6e-105   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDY05245.1|  BnaC05g45580D                                          319   1e-104   Brassica napus [oilseed rape]
ref|XP_009124937.1|  PREDICTED: BTB/POZ and MATH domain-containin...    319   1e-104   Brassica rapa
ref|XP_010551779.1|  PREDICTED: BTB/POZ and MATH domain-containin...    320   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_002884563.1|  ATBPM2                                             319   2e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_004958540.1|  PREDICTED: BTB/POZ and MATH domain-containin...    319   2e-104   Setaria italica
ref|XP_009352133.1|  PREDICTED: BTB/POZ and MATH domain-containin...    318   3e-104   Pyrus x bretschneideri [bai li]
ref|NP_566275.1|  BTB/POZ and M2 domain-containing protein              317   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463303.1|  hypothetical protein SORBIDRAFT_02g041470          317   1e-103   Sorghum bicolor [broomcorn]
gb|ACG38997.1|  speckle-type POZ protein                                316   3e-103   Zea mays [maize]
ref|NP_001130519.1|  speckle-type POZ protein                           316   3e-103   Zea mays [maize]
ref|NP_001140355.1|  hypothetical protein                               313   4e-102   Zea mays [maize]
ref|NP_001060495.1|  Os07g0655300                                       313   9e-102   
gb|EEC82594.1|  hypothetical protein OsI_27153                          312   2e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_009120926.1|  PREDICTED: BTB/POZ and MATH domain-containin...    310   5e-101   Brassica rapa
ref|XP_010436693.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    309   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006400454.1|  hypothetical protein EUTSA_v10013699mg             308   3e-100   Eutrema salsugineum
ref|XP_008353276.1|  PREDICTED: BTB/POZ and MATH domain-containin...    303   5e-100   
ref|XP_006658050.1|  PREDICTED: BTB/POZ and MATH domain-containin...    301   2e-99    
gb|KFK26137.1|  hypothetical protein AALP_AA8G208400                    303   2e-98    Arabis alpina [alpine rockcress]
emb|CDY66705.1|  BnaAnng22770D                                          303   3e-98    Brassica napus [oilseed rape]
gb|EMT06101.1|  Speckle-type POZ protein-like protein                   303   3e-98    Aegilops tauschii
ref|XP_002871853.1|  BTB-POZ and math domain 1                          303   3e-98    Arabidopsis lyrata subsp. lyrata
ref|NP_197401.2|  BTB-POZ and math domain-containing protein            301   9e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDP00137.1|  unnamed protein product                                299   1e-97    Coffea canephora [robusta coffee]
ref|XP_006287870.1|  hypothetical protein CARUB_v10001097mg             300   6e-97    Capsella rubella
ref|XP_009131717.1|  PREDICTED: BTB/POZ and MATH domain-containin...    299   8e-97    Brassica rapa
ref|XP_010454160.1|  PREDICTED: BTB/POZ and MATH domain-containin...    299   1e-96    Camelina sativa [gold-of-pleasure]
emb|CDY18844.1|  BnaAnng03090D                                          299   2e-96    Brassica napus [oilseed rape]
ref|XP_002961582.1|  hypothetical protein SELMODRAFT_270271             298   3e-96    Selaginella moellendorffii
ref|XP_010420683.1|  PREDICTED: BTB/POZ and MATH domain-containin...    294   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010496737.1|  PREDICTED: BTB/POZ and MATH domain-containin...    293   2e-94    Camelina sativa [gold-of-pleasure]
emb|CDX92567.1|  BnaA10g16060D                                          293   4e-94    Brassica napus [oilseed rape]
emb|CBI31621.3|  unnamed protein product                                289   1e-93    Vitis vinifera
ref|XP_009120927.1|  PREDICTED: BTB/POZ and MATH domain-containin...    290   6e-93    Brassica rapa
emb|CDX70860.1|  BnaC03g09440D                                          290   7e-93    Brassica napus [oilseed rape]
ref|XP_010658525.1|  PREDICTED: BTB/POZ and MATH domain-containin...    286   8e-93    Vitis vinifera
ref|XP_002282536.1|  PREDICTED: BTB/POZ and MATH domain-containin...    288   2e-92    Vitis vinifera
emb|CDY13941.1|  BnaC09g38850D                                          287   1e-91    Brassica napus [oilseed rape]
ref|XP_009409035.1|  PREDICTED: BTB/POZ and MATH domain-containin...    282   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009797730.1|  PREDICTED: BTB/POZ and MATH domain-containin...    282   6e-91    Nicotiana sylvestris
ref|XP_009621951.1|  PREDICTED: BTB/POZ and MATH domain-containin...    282   7e-91    Nicotiana tomentosiformis
ref|XP_002311186.2|  hypothetical protein POPTR_0008s06000g             284   7e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009797729.1|  PREDICTED: BTB/POZ and MATH domain-containin...    284   7e-91    Nicotiana sylvestris
ref|XP_009621950.1|  PREDICTED: BTB/POZ and MATH domain-containin...    281   1e-90    Nicotiana tomentosiformis
ref|NP_001190334.1|  BTB-POZ and math domain-containing protein         284   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009621947.1|  PREDICTED: BTB/POZ and MATH domain-containin...    283   2e-90    Nicotiana tomentosiformis
ref|XP_009409034.1|  PREDICTED: BTB/POZ and MATH domain-containin...    283   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034402.1|  PREDICTED: BTB/POZ and MATH domain-containin...    282   3e-90    Populus euphratica
ref|XP_010256806.1|  PREDICTED: BTB/POZ and MATH domain-containin...    280   4e-90    Nelumbo nucifera [Indian lotus]
ref|XP_010256807.1|  PREDICTED: BTB/POZ and MATH domain-containin...    280   6e-90    Nelumbo nucifera [Indian lotus]
ref|XP_007009288.1|  BTB/POZ/MATH-domains containing protein isof...    278   1e-89    Theobroma cacao [chocolate]
ref|XP_009131718.1|  PREDICTED: BTB/POZ and MATH domain-containin...    281   1e-89    Brassica rapa
ref|XP_010256804.1|  PREDICTED: BTB/POZ and MATH domain-containin...    281   2e-89    Nelumbo nucifera [Indian lotus]
ref|XP_011002614.1|  PREDICTED: BTB/POZ and MATH domain-containin...    280   3e-89    Populus euphratica
gb|AEZ00903.1|  putative protein binding                                276   4e-89    Elaeis guineensis
ref|XP_002976951.1|  hypothetical protein SELMODRAFT_443336             280   4e-89    Selaginella moellendorffii
ref|XP_001783005.1|  predicted protein                                  279   6e-89    Physcomitrella patens
ref|XP_007009287.1|  BTB/POZ/MATH-domains containing protein isof...    279   7e-89    Theobroma cacao [chocolate]
ref|XP_001772248.1|  predicted protein                                  278   1e-88    Physcomitrella patens
ref|XP_002316266.1|  hypothetical protein POPTR_0010s20670g             278   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_001776409.1|  predicted protein                                  277   2e-88    Physcomitrella patens
ref|XP_008785535.1|  PREDICTED: BTB/POZ and MATH domain-containin...    278   3e-88    Phoenix dactylifera
gb|KJB67619.1|  hypothetical protein B456_010G200500                    275   6e-88    Gossypium raimondii
gb|KJB67618.1|  hypothetical protein B456_010G200500                    275   6e-88    Gossypium raimondii
ref|XP_002970063.1|  hypothetical protein SELMODRAFT_267336             276   7e-88    Selaginella moellendorffii
ref|XP_002524218.1|  Speckle-type POZ protein, putative                 276   8e-88    Ricinus communis
ref|XP_010923233.1|  PREDICTED: BTB/POZ and MATH domain-containin...    276   9e-88    Elaeis guineensis
ref|XP_006657384.1|  PREDICTED: BTB/POZ and MATH domain-containin...    275   1e-87    Oryza brachyantha
gb|EMT28091.1|  Speckle-type POZ protein-like protein A                 273   2e-87    Aegilops tauschii
gb|KJB67617.1|  hypothetical protein B456_010G200500                    275   3e-87    Gossypium raimondii
ref|XP_010937554.1|  PREDICTED: BTB/POZ and MATH domain-containin...    273   3e-87    Elaeis guineensis
gb|KHG28259.1|  BTB/POZ and MATH domain-containing 3 -like protein      275   3e-87    Gossypium arboreum [tree cotton]
ref|XP_010937555.1|  PREDICTED: BTB/POZ and MATH domain-containin...    273   3e-87    Elaeis guineensis
ref|XP_006846362.1|  hypothetical protein AMTR_s00012p00261580          274   3e-87    
dbj|BAJ94248.1|  predicted protein                                      274   4e-87    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010420684.1|  PREDICTED: BTB/POZ and MATH domain-containin...    275   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010937553.1|  PREDICTED: BTB/POZ and MATH domain-containin...    273   1e-86    Elaeis guineensis
ref|XP_010496738.1|  PREDICTED: BTB/POZ and MATH domain-containin...    274   2e-86    Camelina sativa [gold-of-pleasure]
gb|EAZ02463.1|  hypothetical protein OsI_24569                          269   4e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001058677.1|  Os07g0101400                                       270   1e-85    
gb|KJB74035.1|  hypothetical protein B456_011G268500                    270   1e-85    Gossypium raimondii
ref|XP_003557713.1|  PREDICTED: BTB/POZ and MATH domain-containin...    268   6e-85    Brachypodium distachyon [annual false brome]
gb|KDP44889.1|  hypothetical protein JCGZ_01389                         269   6e-85    Jatropha curcas
gb|EYU19945.1|  hypothetical protein MIMGU_mgv1a007421mg                264   5e-84    Erythranthe guttata [common monkey flower]
gb|EYU19944.1|  hypothetical protein MIMGU_mgv1a007421mg                266   1e-83    Erythranthe guttata [common monkey flower]
ref|XP_006435615.1|  hypothetical protein CICLE_v10031714mg             263   1e-83    Citrus clementina
ref|XP_010517338.1|  PREDICTED: BTB/POZ and MATH domain-containin...    263   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_006435614.1|  hypothetical protein CICLE_v10031714mg             265   2e-83    Citrus clementina
ref|XP_010517337.1|  PREDICTED: BTB/POZ and MATH domain-containin...    264   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010067446.1|  PREDICTED: BTB/POZ and MATH domain-containin...    264   5e-83    Eucalyptus grandis [rose gum]
ref|XP_010508976.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   6e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009785862.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   7e-83    Nicotiana sylvestris
ref|XP_006294342.1|  hypothetical protein CARUB_v10023357mg             263   1e-82    Capsella rubella
ref|XP_002879815.1|  hypothetical protein ARALYDRAFT_903228             263   1e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_010691290.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   1e-82    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009785861.1|  PREDICTED: BTB/POZ and MATH domain-containin...    262   2e-82    Nicotiana sylvestris
ref|XP_006355692.1|  PREDICTED: BTB/POZ and MATH domain-containin...    260   2e-82    Solanum tuberosum [potatoes]
ref|XP_010508974.1|  PREDICTED: BTB/POZ and MATH domain-containin...    262   2e-82    Camelina sativa [gold-of-pleasure]
emb|CDY02591.1|  BnaC02g08440D                                          262   2e-82    Brassica napus [oilseed rape]
ref|XP_009601989.1|  PREDICTED: BTB/POZ and MATH domain-containin...    259   3e-82    Nicotiana tomentosiformis
ref|XP_010321433.1|  PREDICTED: BTB/POZ and MATH domain-containin...    259   3e-82    Solanum lycopersicum
gb|KJB74039.1|  hypothetical protein B456_011G268500                    261   4e-82    Gossypium raimondii
ref|XP_009601988.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   5e-82    Nicotiana tomentosiformis
ref|XP_006355691.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   5e-82    Solanum tuberosum [potatoes]
gb|KHG23447.1|  BTB/POZ and MATH domain-containing 3 -like protein      261   6e-82    Gossypium arboreum [tree cotton]
ref|XP_004239913.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   9e-82    Solanum lycopersicum
ref|XP_010691281.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   1e-81    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010691271.1|  PREDICTED: BTB/POZ and MATH domain-containin...    261   1e-81    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001031516.1|  BTB/POZ and MATH domain-containing protein         258   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141835.1|  PREDICTED: BTB/POZ and MATH domain-containin...    259   3e-81    Brassica rapa
gb|AAM66127.1|  unknown                                                 259   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_030522.1|  BTB/POZ and MATH domain-containing protein            259   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803125.1|  PREDICTED: BTB/POZ and MATH domain-containin...    256   6e-81    Phoenix dactylifera
ref|XP_010108399.1|  BTB/POZ and MATH domain-containing protein 3       257   3e-80    Morus notabilis
ref|XP_008803124.1|  PREDICTED: BTB/POZ and MATH domain-containin...    257   3e-80    Phoenix dactylifera
emb|CDX93238.1|  BnaC04g46580D                                          256   3e-80    Brassica napus [oilseed rape]
gb|EMS62743.1|  BTB/POZ and MATH domain-containing protein 3            254   5e-80    Triticum urartu
ref|XP_006411210.1|  hypothetical protein EUTSA_v10017774mg             255   7e-80    Eutrema salsugineum
gb|KDO69176.1|  hypothetical protein CISIN_1g015560mg                   255   8e-80    Citrus sinensis [Valencia orange]
emb|CDY07031.1|  BnaA04g22840D                                          254   1e-79    Brassica napus [oilseed rape]
ref|XP_010554622.1|  PREDICTED: BTB/POZ and MATH domain-containin...    254   3e-79    Tarenaya hassleriana [spider flower]
ref|XP_007218050.1|  hypothetical protein PRUPE_ppa006151mg             254   3e-79    Prunus persica
ref|XP_008233485.1|  PREDICTED: BTB/POZ and MATH domain-containin...    254   3e-79    Prunus mume [ume]
ref|XP_004307466.1|  PREDICTED: BTB/POZ and MATH domain-containin...    252   4e-78    Fragaria vesca subsp. vesca
ref|XP_002461292.1|  hypothetical protein SORBIDRAFT_02g000320          251   5e-78    Sorghum bicolor [broomcorn]
ref|XP_007163464.1|  hypothetical protein PHAVU_001G236400g             251   7e-78    Phaseolus vulgaris [French bean]
ref|XP_007163465.1|  hypothetical protein PHAVU_001G236400g             250   2e-77    Phaseolus vulgaris [French bean]
ref|XP_004987280.1|  PREDICTED: BTB/POZ and MATH domain-containin...    248   2e-77    Setaria italica
ref|XP_004987279.1|  PREDICTED: BTB/POZ and MATH domain-containin...    248   4e-77    Setaria italica
ref|XP_006601981.1|  PREDICTED: BTB/POZ and MATH domain-containin...    246   5e-77    
ref|XP_010918009.1|  PREDICTED: BTB/POZ and MATH domain-containin...    246   5e-77    Elaeis guineensis
ref|XP_004503177.1|  PREDICTED: BTB/POZ and MATH domain-containin...    248   8e-77    Cicer arietinum [garbanzo]
gb|AFJ68127.1|  BTB protein                                             246   2e-76    Musa acuminata AAA Group [Cavendish banana]
ref|NP_001142069.1|  uncharacterized protein LOC100274226               246   2e-76    Zea mays [maize]
ref|XP_003552772.1|  PREDICTED: BTB/POZ and MATH domain-containin...    247   2e-76    Glycine max [soybeans]
ref|XP_008789447.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   3e-76    Phoenix dactylifera
ref|XP_010918008.1|  PREDICTED: BTB/POZ and MATH domain-containin...    246   5e-76    Elaeis guineensis
ref|XP_008372036.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   8e-76    Malus domestica [apple tree]
ref|XP_006591356.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   1e-75    Glycine max [soybeans]
ref|XP_003538428.1|  PREDICTED: BTB/POZ and MATH domain-containin...    245   1e-75    Glycine max [soybeans]
emb|CDY61778.1|  BnaC03g72570D                                          245   1e-75    Brassica napus [oilseed rape]
ref|XP_009400061.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789435.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   2e-75    Phoenix dactylifera
ref|XP_008372026.1|  PREDICTED: BTB/POZ and MATH domain-containin...    244   3e-75    Malus domestica [apple tree]
emb|CDY07638.1|  BnaA03g18730D                                          243   3e-75    Brassica napus [oilseed rape]
ref|XP_009351416.1|  PREDICTED: BTB/POZ and MATH domain-containin...    241   1e-74    Pyrus x bretschneideri [bai li]
ref|XP_009343897.1|  PREDICTED: BTB/POZ and MATH domain-containin...    241   1e-74    Pyrus x bretschneideri [bai li]
ref|XP_009133382.1|  PREDICTED: BTB/POZ and MATH domain-containin...    240   2e-74    Brassica rapa
ref|XP_008811723.1|  PREDICTED: BTB/POZ and MATH domain-containin...    240   2e-74    Phoenix dactylifera
ref|XP_007015537.1|  BTB/POZ and MATH domain-containing protein 4...    240   2e-74    Theobroma cacao [chocolate]
ref|XP_009133381.1|  PREDICTED: BTB/POZ and MATH domain-containin...    241   4e-74    Brassica rapa
ref|XP_009351410.1|  PREDICTED: BTB/POZ and MATH domain-containin...    241   4e-74    Pyrus x bretschneideri [bai li]
ref|XP_009353081.1|  PREDICTED: BTB/POZ and MATH domain-containin...    240   5e-74    Pyrus x bretschneideri [bai li]
gb|KDP42915.1|  hypothetical protein JCGZ_23857                         240   5e-74    Jatropha curcas
ref|XP_010921384.1|  PREDICTED: BTB/POZ and MATH domain-containin...    239   6e-74    Elaeis guineensis
ref|XP_009343889.1|  PREDICTED: BTB/POZ and MATH domain-containin...    241   6e-74    Pyrus x bretschneideri [bai li]
ref|XP_008811722.1|  PREDICTED: BTB/POZ and MATH domain-containin...    240   9e-74    Phoenix dactylifera
gb|KCW47782.1|  hypothetical protein EUGRSUZ_K01525                     238   1e-73    Eucalyptus grandis [rose gum]
ref|XP_007015538.1|  BTB/POZ and MATH domain-containing protein 4...    239   1e-73    Theobroma cacao [chocolate]
tpg|DAA42640.1|  TPA: Speckle-type POZ protein                          235   2e-73    Zea mays [maize]
ref|XP_007015536.1|  BTB/POZ and MATH domain-containing protein 4...    239   2e-73    Theobroma cacao [chocolate]
ref|XP_009353080.1|  PREDICTED: BTB/POZ and MATH domain-containin...    239   2e-73    Pyrus x bretschneideri [bai li]
ref|XP_010921383.1|  PREDICTED: BTB/POZ and MATH domain-containin...    238   3e-73    Elaeis guineensis
ref|XP_009366506.1|  PREDICTED: BTB/POZ and MATH domain-containin...    239   3e-73    Pyrus x bretschneideri [bai li]
ref|XP_011076789.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    238   4e-73    Sesamum indicum [beniseed]
ref|XP_004228476.1|  PREDICTED: BTB/POZ and MATH domain-containin...    238   5e-73    Solanum lycopersicum
ref|XP_009343027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    239   5e-73    Pyrus x bretschneideri [bai li]
ref|XP_010067445.1|  PREDICTED: BTB/POZ and MATH domain-containin...    236   7e-73    Eucalyptus grandis [rose gum]
ref|XP_010036255.1|  PREDICTED: BTB/POZ and MATH domain-containin...    238   9e-73    Eucalyptus grandis [rose gum]
gb|KDO47648.1|  hypothetical protein CISIN_1g015782mg                   235   1e-72    Citrus sinensis [Valencia orange]
ref|XP_009396476.1|  PREDICTED: BTB/POZ and MATH domain-containin...    237   1e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008391713.1|  PREDICTED: BTB/POZ and MATH domain-containin...    237   2e-72    Malus domestica [apple tree]
ref|XP_006470186.1|  PREDICTED: BTB/POZ and MATH domain-containin...    236   3e-72    Citrus sinensis [Valencia orange]
ref|XP_006362728.1|  PREDICTED: BTB/POZ and MATH domain-containin...    236   3e-72    Solanum tuberosum [potatoes]
gb|KJB74038.1|  hypothetical protein B456_011G268500                    235   4e-72    Gossypium raimondii
ref|XP_007029996.1|  BTB-POZ and MATH domain 4 isoform 2                234   4e-72    Theobroma cacao [chocolate]
ref|XP_002313624.2|  hypothetical protein POPTR_0009s15830g             235   6e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009606600.1|  PREDICTED: BTB/POZ and MATH domain-containin...    235   6e-72    Nicotiana tomentosiformis
ref|XP_006446682.1|  hypothetical protein CICLE_v10015761mg             233   7e-72    Citrus clementina
gb|KDO47647.1|  hypothetical protein CISIN_1g015782mg                   235   8e-72    Citrus sinensis [Valencia orange]
ref|XP_008386876.1|  PREDICTED: BTB/POZ and MATH domain-containin...    235   1e-71    Malus domestica [apple tree]
ref|XP_006826332.1|  hypothetical protein AMTR_s00004p00105320          234   2e-71    
gb|EYU46143.1|  hypothetical protein MIMGU_mgv1a007584mg                234   2e-71    
ref|XP_007029995.1|  BTB-POZ and MATH domain 4 isoform 1                234   4e-71    
gb|KDP39652.1|  hypothetical protein JCGZ_02672                         233   4e-71    
ref|XP_009411295.1|  PREDICTED: BTB/POZ and MATH domain-containin...    233   5e-71    
ref|XP_002277148.1|  PREDICTED: BTB/POZ and MATH domain-containin...    233   6e-71    
ref|XP_009411294.1|  PREDICTED: BTB/POZ and MATH domain-containin...    232   7e-71    
emb|CBI24397.3|  unnamed protein product                                233   7e-71    
ref|XP_003632235.1|  PREDICTED: BTB/POZ and MATH domain-containin...    233   1e-70    
ref|XP_011043816.1|  PREDICTED: BTB/POZ and MATH domain-containin...    232   1e-70    
ref|XP_008442028.1|  PREDICTED: BTB/POZ and MATH domain-containin...    231   1e-70    
ref|XP_011016310.1|  PREDICTED: BTB/POZ and MATH domain-containin...    232   1e-70    
gb|KCW50987.1|  hypothetical protein EUGRSUZ_J00615                     231   2e-70    
gb|ACM67640.1|  BTB-POZ and MATH domain protein                         231   3e-70    
ref|XP_008681390.1|  PREDICTED: speckle-type POZ protein isoform X1     230   3e-70    
ref|XP_008451035.1|  PREDICTED: BTB/POZ and MATH domain-containin...    231   3e-70    
ref|XP_002525692.1|  BTB and MATH domain-containing protein, puta...    229   8e-70    
ref|XP_011006172.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   8e-70    
ref|XP_006384724.1|  hypothetical protein POPTR_0004s20530g             229   8e-70    
ref|XP_006371199.1|  hypothetical protein POPTR_0019s05580g             230   8e-70    
ref|XP_006651896.1|  PREDICTED: BTB/POZ and MATH domain-containin...    230   9e-70    
emb|CDP09732.1|  unnamed protein product                                228   9e-70    
gb|KJB83640.1|  hypothetical protein B456_013G256300                    229   9e-70    
ref|XP_002463757.1|  hypothetical protein SORBIDRAFT_01g005590          230   1e-69    
ref|XP_009771203.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   1e-69    
ref|XP_011090255.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   1e-69    
ref|XP_008442027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    230   1e-69    
ref|XP_011001713.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    229   2e-69    
gb|KEH28340.1|  BTB/POZ/MATH-domain protein                             227   2e-69    
gb|KJB44499.1|  hypothetical protein B456_007G255900                    227   2e-69    
gb|KGN66383.1|  hypothetical protein Csa_1G600230                       229   2e-69    
gb|KEH28339.1|  BTB/POZ/MATH-domain protein                             227   2e-69    
ref|XP_004251235.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   2e-69    
ref|NP_001140637.1|  speckle-type POZ protein                           229   3e-69    
gb|ACG37150.1|  speckle-type POZ protein                                229   3e-69    
ref|XP_004981480.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   3e-69    
ref|XP_010266709.1|  PREDICTED: BTB/POZ and MATH domain-containin...    226   3e-69    
ref|XP_010031623.1|  PREDICTED: BTB/POZ and MATH domain-containin...    231   3e-69    
ref|XP_009762142.1|  PREDICTED: BTB/POZ and MATH domain-containin...    228   4e-69    
ref|XP_006340346.1|  PREDICTED: BTB/POZ and MATH domain-containin...    228   6e-69    
ref|XP_004149104.1|  PREDICTED: BTB/POZ and MATH domain-containin...    228   7e-69    
ref|XP_010266708.1|  PREDICTED: BTB/POZ and MATH domain-containin...    227   1e-68    
ref|XP_003617061.1|  Speckle-type POZ protein                           226   1e-68    
gb|KHM99118.1|  BTB/POZ and MATH domain-containing protein 4            225   1e-68    
gb|KHG25171.1|  BTB/POZ and MATH domain-containing 4 -like protein      228   2e-68    
gb|ABK24368.1|  unknown                                                 226   2e-68    
ref|XP_009628011.1|  PREDICTED: BTB/POZ and MATH domain-containin...    226   3e-68    
gb|KJB44498.1|  hypothetical protein B456_007G255900                    226   3e-68    
ref|XP_003545187.1|  PREDICTED: BTB/POZ and MATH domain-containin...    225   3e-68    
ref|XP_010520490.1|  PREDICTED: BTB/POZ and MATH domain-containin...    226   3e-68    
ref|NP_001051524.1|  Os03g0792500                                       226   4e-68    
ref|XP_010685504.1|  PREDICTED: BTB/POZ and MATH domain-containin...    225   4e-68    
dbj|BAJ93826.1|  predicted protein                                      226   4e-68    
ref|XP_004164626.1|  PREDICTED: BTB/POZ and MATH domain-containin...    220   5e-68    
ref|XP_010093790.1|  BTB/POZ and MATH domain-containing protein 4       225   5e-68    
ref|XP_003518460.1|  PREDICTED: BTB/POZ and MATH domain-containin...    225   5e-68    
gb|EEE66420.1|  hypothetical protein OsJ_22770                          224   5e-68    
ref|XP_010653194.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    223   9e-68    
emb|CBI31240.3|  unnamed protein product                                223   1e-67    
ref|XP_004491160.1|  PREDICTED: BTB/POZ and MATH domain-containin...    224   1e-67    
ref|XP_010493218.1|  PREDICTED: BTB/POZ and MATH domain-containin...    224   1e-67    
ref|XP_006479174.1|  PREDICTED: BTB/POZ and MATH domain-containin...    223   1e-67    
dbj|BAJ90220.1|  predicted protein                                      224   2e-67    
ref|XP_004491159.1|  PREDICTED: BTB/POZ and MATH domain-containin...    224   2e-67    
gb|KDO66065.1|  hypothetical protein CISIN_1g013880mg                   222   3e-67    
ref|XP_011043823.1|  PREDICTED: BTB/POZ and MATH domain-containin...    223   4e-67    
ref|XP_010454419.1|  PREDICTED: BTB/POZ and MATH domain-containin...    223   4e-67    
ref|XP_011016311.1|  PREDICTED: BTB/POZ and MATH domain-containin...    223   4e-67    
gb|KDO66066.1|  hypothetical protein CISIN_1g013880mg                   221   5e-67    
gb|KFK37801.1|  speckle-type poz protein                                223   7e-67    
tpg|DAA51839.1|  TPA: hypothetical protein ZEAMMB73_694112              221   8e-67    
gb|EAZ28871.1|  hypothetical protein OsJ_12909                          222   9e-67    
ref|XP_006400672.1|  hypothetical protein EUTSA_v10013671mg             222   1e-66    
gb|EAY92144.1|  hypothetical protein OsI_13855                          222   1e-66    
gb|AAO37987.1|  expressed protein                                       222   1e-66    
ref|XP_006287859.1|  hypothetical protein CARUB_v10001086mg             221   1e-66    
ref|XP_010549705.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   1e-66    
gb|KHG12366.1|  BTB/POZ and MATH domain-containing 4 -like protein      221   1e-66    
gb|KFK26316.1|  hypothetical protein AALP_AA8G231700                    221   2e-66    
ref|XP_003557844.2|  PREDICTED: probable zinc metalloprotease EGY...    229   2e-66    
ref|XP_006408271.1|  hypothetical protein EUTSA_v10020746mg             222   2e-66    
ref|XP_002884409.1|  hypothetical protein ARALYDRAFT_896389             221   2e-66    
emb|CDY09093.1|  BnaA02g05190D                                          219   3e-66    
ref|XP_010485725.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   3e-66    
ref|XP_006842152.1|  hypothetical protein AMTR_s00078p00129860          217   3e-66    
ref|XP_009126498.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   3e-66    
gb|AAM60841.1|  unknown                                                 221   3e-66    
ref|XP_006479173.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   3e-66    
ref|XP_006443499.1|  hypothetical protein CICLE_v10020215mg             221   3e-66    
ref|XP_010524999.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   4e-66    
emb|CDY29955.1|  BnaC01g40530D                                          221   4e-66    
ref|XP_002871964.1|  BTB-POZ and math domain 5                          220   5e-66    
ref|NP_001141107.1|  uncharacterized protein LOC100273191               221   5e-66    
ref|NP_566212.2|  BTB/POZ and M4 domain-containing protein              221   5e-66    
gb|KDO66064.1|  hypothetical protein CISIN_1g013880mg                   221   5e-66    
ref|XP_010535766.1|  PREDICTED: BTB/POZ and MATH domain-containin...    220   5e-66    
ref|NP_189956.2|  BTB-POZ and math domain-containing protein            220   7e-66    
ref|XP_008667501.1|  PREDICTED: uncharacterized protein LOC100273...    220   8e-66    
ref|XP_006297705.1|  hypothetical protein CARUB_v10013733mg             220   8e-66    
emb|CAB83071.1|  putative protein                                       219   9e-66    
ref|XP_011080496.1|  PREDICTED: BTB/POZ and MATH domain-containin...    219   9e-66    
ref|XP_010113211.1|  BTB/POZ and MATH domain-containing protein 4       218   1e-65    
ref|XP_009131834.1|  PREDICTED: BTB/POZ and MATH domain-containin...    219   1e-65    
emb|CDX70957.1|  BnaC03g10410D                                          219   2e-65    
emb|CDX88828.1|  BnaA03g08210D                                          219   2e-65    
ref|XP_004288385.1|  PREDICTED: BTB/POZ and MATH domain-containin...    219   2e-65    
gb|KHN38451.1|  BTB/POZ and MATH domain-containing protein 4            214   3e-65    
ref|NP_001058976.1|  Os07g0167200                                       218   6e-65    
ref|XP_006443497.1|  hypothetical protein CICLE_v10020215mg             216   6e-65    
ref|XP_010463833.1|  PREDICTED: BTB/POZ and MATH domain-containin...    218   8e-65    
gb|EPS71913.1|  hypothetical protein M569_02844                         217   9e-65    
gb|AFD04128.1|  speckle-type POZ                                        217   9e-65    
ref|XP_003554047.1|  PREDICTED: BTB/POZ and MATH domain-containin...    217   1e-64    
ref|XP_010513722.1|  PREDICTED: BTB/POZ and MATH domain-containin...    217   1e-64    
gb|KHN34655.1|  BTB/POZ and MATH domain-containing protein 4            216   1e-64    
gb|KJB25906.1|  hypothetical protein B456_004G215300                    212   2e-64    
ref|XP_007202130.1|  hypothetical protein PRUPE_ppa006091mg             216   2e-64    
gb|EMS49890.1|  BTB/POZ and MATH domain-containing protein 4            218   3e-64    
gb|KJB74037.1|  hypothetical protein B456_011G268500                    214   4e-64    
ref|XP_008244139.1|  PREDICTED: BTB/POZ and MATH domain-containin...    216   4e-64    
ref|XP_003590694.1|  Speckle-type POZ protein                           210   5e-64    
ref|XP_006380052.1|  hypothetical protein POPTR_0008s20510g             211   6e-64    
ref|XP_002875616.1|  BTB-POZ and math domain 6                          214   7e-64    
gb|ABR16952.1|  unknown                                                 213   1e-63    
ref|XP_010425835.1|  PREDICTED: BTB/POZ and MATH domain-containin...    212   2e-63    
ref|XP_003548681.2|  PREDICTED: BTB/POZ and MATH domain-containin...    216   2e-63    
ref|XP_007161865.1|  hypothetical protein PHAVU_001G104500g             213   3e-63    
ref|XP_011016309.1|  PREDICTED: BTB/POZ and MATH domain-containin...    213   4e-63    
ref|XP_011043808.1|  PREDICTED: BTB/POZ and MATH domain-containin...    213   4e-63    
gb|EMT28882.1|  Speckle-type POZ protein                                217   4e-63    
ref|XP_006657481.1|  PREDICTED: BTB/POZ and MATH domain-containin...    213   5e-63    
ref|XP_004144146.1|  PREDICTED: BTB/POZ and MATH domain-containin...    210   6e-63    
ref|XP_004955562.1|  PREDICTED: BTB/POZ and MATH domain-containin...    212   1e-62    
ref|XP_006293225.1|  hypothetical protein CARUB_v10019549mg             211   1e-62    
gb|KEH23545.1|  BTB/POZ/MATH-domain protein                             209   2e-62    
ref|XP_006380053.1|  hypothetical protein POPTR_0008s20510g             208   3e-62    
ref|XP_003624698.1|  Speckle-type POZ protein                           208   3e-61    
ref|XP_004493213.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   3e-61    
gb|AAM61175.1|  unknown                                                 207   3e-61    
ref|XP_004980764.1|  PREDICTED: BTB/POZ and MATH domain-containin...    206   4e-61    
ref|NP_197600.1|  BTB-POZ and math domain 5                             207   4e-61    
ref|XP_003557540.2|  PREDICTED: BTB/POZ and MATH domain-containin...    211   4e-61    
gb|AAK68819.1|  Unknown protein                                         207   7e-61    
ref|XP_010240454.1|  PREDICTED: BTB/POZ and MATH domain-containin...    204   2e-60    
ref|XP_010503047.1|  PREDICTED: BTB/POZ and MATH domain-containin...    206   2e-60    
gb|EMT11969.1|  Speckle-type POZ protein-like protein                   200   6e-60    
ref|XP_002533853.1|  Speckle-type POZ protein, putative                 204   6e-60    
ref|XP_004159364.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   7e-60    
ref|XP_004980762.1|  PREDICTED: BTB/POZ and MATH domain-containin...    202   1e-59    
gb|KHN47485.1|  BTB/POZ and MATH domain-containing protein 4            202   1e-59    
emb|CDM80495.1|  unnamed protein product                                202   1e-59    
ref|XP_008651507.1|  PREDICTED: LOC100284563 isoform X1                 202   2e-59    
ref|XP_006369190.1|  hypothetical protein POPTR_0001s18490g             199   2e-59    
gb|EMT18305.1|  Speckle-type POZ protein                                202   2e-59    
dbj|BAJ95673.1|  predicted protein                                      201   2e-59    
gb|AFK49068.1|  unknown                                                 196   3e-59    
ref|XP_010485726.1|  PREDICTED: BTB/POZ and MATH domain-containin...    203   3e-59    
ref|XP_006604032.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   4e-59    
ref|XP_002449869.1|  hypothetical protein SORBIDRAFT_05g024660          200   6e-59    
ref|NP_001150930.1|  LOC100284563                                       202   7e-59    
ref|XP_003555034.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   1e-58    
emb|CDM80485.1|  unnamed protein product                                200   1e-58    
ref|XP_009102074.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    202   1e-58    
gb|EAY78546.1|  hypothetical protein OsI_33645                          199   2e-58    
gb|EMT06826.1|  Speckle-type POZ protein-like protein                   199   2e-58    
gb|EMT17722.1|  Speckle-type POZ protein                                207   2e-58    
emb|CAE04740.1|  OSJNBb0060E08.3                                        199   2e-58    
gb|EMS62115.1|  BTB/POZ and MATH domain-containing protein 2            198   3e-58    
gb|AAP53877.1|  BTB/POZ domain containing protein, expressed            197   4e-58    
ref|NP_001053940.1|  Os04g0625600                                       199   4e-58    
emb|CAH66829.1|  OSIGBa0148A10.6                                        198   6e-58    
gb|EMT27243.1|  Speckle-type POZ protein-like protein A                 197   7e-58    
ref|XP_002444102.1|  hypothetical protein SORBIDRAFT_07g007740          197   8e-58    
emb|CDY67137.1|  BnaAnng23640D                                          197   8e-58    
emb|CDM80952.1|  unnamed protein product                                197   1e-57    
gb|EAY95630.1|  hypothetical protein OsI_17487                          196   1e-57    
ref|NP_001064650.2|  Os10g0427800                                       196   2e-57    
ref|XP_010237561.1|  PREDICTED: BTB/POZ and MATH domain-containin...    196   3e-57    
gb|AAP53868.1|  BTB/POZ domain containing protein, expressed            196   3e-57    
gb|EAZ15535.1|  hypothetical protein OsJ_30940                          195   3e-57    
ref|XP_002447415.1|  hypothetical protein SORBIDRAFT_06g000720          196   4e-57    
gb|EAY78601.1|  hypothetical protein OsI_33697                          199   5e-57    
ref|XP_004974997.1|  PREDICTED: BTB/POZ and MATH domain-containin...    195   5e-57    
ref|NP_001064654.1|  Os10g0428500                                       195   5e-57    
gb|EMT07865.1|  Speckle-type POZ protein-like protein                   195   7e-57    
ref|XP_004986612.1|  PREDICTED: BTB/POZ and MATH domain-containin...    193   1e-56    
gb|AAP53874.1|  BTB/POZ domain containing protein                       194   1e-56    
emb|CDM80508.1|  unnamed protein product                                194   1e-56    
ref|XP_003571569.2|  PREDICTED: BTB/POZ and MATH domain-containin...    195   1e-56    
ref|XP_006652854.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   2e-56    
gb|EEC73000.1|  hypothetical protein OsI_06919                          194   2e-56    
gb|EMS61974.1|  BTB/POZ and MATH domain-containing protein 1            194   2e-56    
ref|XP_010239065.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    193   3e-56    
ref|XP_004986610.1|  PREDICTED: BTB/POZ and MATH domain-containin...    193   3e-56    
ref|XP_006604020.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   3e-56    
ref|NP_001064649.1|  Os10g0427600                                       193   3e-56    
ref|XP_002464613.1|  hypothetical protein SORBIDRAFT_01g021850          193   4e-56    
ref|NP_001064643.1|  Os10g0426500                                       193   4e-56    
ref|XP_003571556.1|  PREDICTED: BTB/POZ and MATH domain-containin...    193   4e-56    
gb|EAY78583.1|  hypothetical protein OsI_33680                          193   5e-56    
ref|XP_003562191.2|  PREDICTED: BTB/POZ and MATH domain-containin...    194   5e-56    
ref|XP_002447132.1|  hypothetical protein SORBIDRAFT_06g029170          193   6e-56    
dbj|BAJ92438.1|  predicted protein                                      193   6e-56    
gb|EAY73895.1|  hypothetical protein OsI_01779                          192   6e-56    
emb|CDM85206.1|  unnamed protein product                                192   7e-56    
ref|XP_006604027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    192   9e-56    
ref|XP_006604026.1|  PREDICTED: BTB/POZ and MATH domain-containin...    192   1e-55    
gb|EEE68262.1|  hypothetical protein OsJ_26480                          189   1e-55    
dbj|BAD16239.1|  putative speckle-type POZ protein                      194   1e-55    
gb|EAY73896.1|  hypothetical protein OsI_01780                          191   2e-55    
ref|NP_001058318.1|  Os06g0668400                                       191   2e-55    
gb|EMT14908.1|  Speckle-type POZ protein-like protein                   190   2e-55    
gb|EMT25479.1|  Speckle-type POZ protein-like protein                   191   2e-55    
ref|NP_001061288.1|  Os08g0227400                                       189   2e-55    
gb|EMT01654.1|  hypothetical protein F775_43945                         189   2e-55    
emb|CDJ26339.1|  unnamed protein product                                189   2e-55    
ref|NP_001068302.2|  Os11g0622600                                       191   3e-55    
ref|XP_003575822.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   3e-55    
gb|EMT09134.1|  Speckle-type POZ protein-like protein B                 196   3e-55    
ref|XP_003560433.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   3e-55    
dbj|BAJ95573.1|  predicted protein                                      190   3e-55    



>ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=411

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCLQ+HCCVGVVRSRTEGPKTYAIS+PPS+IGL
Sbjct  137  LKYRGSMWGYKRFFKRTALETSDYLKDDCLQVHCCVGVVRSRTEGPKTYAISLPPSNIGL  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GE FAAHKLVL+ARSPVFRAQL+GPMKDQN   I VEDMEA
Sbjct  197  HFGQLLESGKGTDVNFEVDGEIFAAHKLVLAARSPVFRAQLYGPMKDQNTEHIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HFIY DVLPDMEELTG+NS WASTLM+QHLLAA+DRYGLDRLRLLCEANLCE+
Sbjct  257  PVFKALIHFIYWDVLPDMEELTGLNSKWASTLMSQHLLAAADRYGLDRLRLLCEANLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  317  VAINTVATTLALAEQHHCFQLKSVCL  342



>ref|XP_009799864.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=411

 Score =   393 bits (1009),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCLQ+HCCVGVVRSRTEGPKTYAI +PPS+IGL
Sbjct  137  LKYRGSMWGYKRFFKRTALETSDYLKDDCLQVHCCVGVVRSRTEGPKTYAIPLPPSNIGL  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GE FAAHKLVL+ARSPVFRAQL+GPMKDQN   I +EDMEA
Sbjct  197  HFGQLLESGKGTDVNFEVDGEIFAAHKLVLAARSPVFRAQLYGPMKDQNTEHIKIEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HFIY DVLPDMEELTG+NS WASTLM+QH+LAA+DRYGLDRLRLLCEANLCE+
Sbjct  257  PVFKALIHFIYWDVLPDMEELTGLNSKWASTLMSQHMLAAADRYGLDRLRLLCEANLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INT+ATTLALAEQHHCFQLKSVCL
Sbjct  317  VAINTIATTLALAEQHHCFQLKSVCL  342



>ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score =   384 bits (985),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 193/206 (94%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCLQ+HCCVGVV+S TEGPK Y+I +PPSDIG 
Sbjct  136  LKYRGSMWGYKRFFKRTALEASDYLKDDCLQVHCCVGVVKSHTEGPKIYSIPLPPSDIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGKGTDVNFEV+GETF+AHKLVL+ARSPVFRAQL+GPMKDQN   I +EDMEA
Sbjct  196  HFGKLLESGKGTDVNFEVDGETFSAHKLVLAARSPVFRAQLYGPMKDQNTECIKIEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+NS WASTLM+QHLLAA+DRYGLDRLRLLCE+NLCED
Sbjct  256  PVFKALLHFIYWDTLPDMEELTGLNSKWASTLMSQHLLAAADRYGLDRLRLLCESNLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHCFQLK+VCL
Sbjct  316  IAINTVATTLALAEQHHCFQLKAVCL  341



>ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=412

 Score =   382 bits (981),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LESSDYLKDDCLQ+HCCVGVVRS TEGPKTY+I + PSDIGL
Sbjct  138  LKYRGSMWGYKRFFKRTALESSDYLKDDCLQVHCCVGVVRSHTEGPKTYSIPLSPSDIGL  197

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGK TDVNF+VNGE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  198  HFGQLLESGKDTDVNFDVNGEVFAAHKLVLAARSPVFRAQLFGPMKDQNTEHIKVEDMEA  257

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y DVLPDMEELTG+N+ WASTLM+QHLLAA+D YGLDRLRLLCEANLCE+
Sbjct  258  PVFKALLHFMYWDVLPDMEELTGLNTKWASTLMSQHLLAAADCYGLDRLRLLCEANLCEE  317

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  318  VAINTVATTLALAEQHHCFQLKSVCL  343



>ref|XP_011079801.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score =   382 bits (980),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCLQ+HCCVGVVRS TEGPK Y+I +PPSDIG 
Sbjct  136  LKYRGSMWGYKRFFKRTALEASDYLKDDCLQVHCCVGVVRSHTEGPKIYSIPLPPSDIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV+GETF  HKLVL+ARSPVFRAQL+GPMKDQN   I VEDMEA
Sbjct  196  HFGQLLESGKGTDVTFEVDGETFNGHKLVLAARSPVFRAQLYGPMKDQNSECIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+NS WASTLM+QHLLAA+DRYGLDRLRLLCEANLCED
Sbjct  256  PVFKALLHFMYWDALPDLEELTGLNSKWASTLMSQHLLAAADRYGLDRLRLLCEANLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  316  VAINTVATTLALAEQHHCFQLKSVCL  341



>ref|XP_006358428.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum tuberosum]
Length=411

 Score =   380 bits (976),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LESSDYLKDDCLQ+HCCVGVVRS TEGPKTY+I + PSDIGL
Sbjct  137  LKYRGSMWGYKRFFKRTALESSDYLKDDCLQVHCCVGVVRSHTEGPKTYSIPLSPSDIGL  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGK TDVNF+VNGE FAAHKL+L+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  197  HFGQLLESGKDTDVNFDVNGEVFAAHKLILAARSPVFRAQLFGPMKDQNTEHIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKAL+HF+Y DVLPDMEELTG+N+ WASTLM+QHLLAA+D YGLDRLRLLCEANLCE+
Sbjct  257  PIFKALIHFMYWDVLPDMEELTGLNTKWASTLMSQHLLAAADCYGLDRLRLLCEANLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  317  VAINTVATTLALAEQHHCFQLKSVCL  342



>ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Vitis vinifera]
 emb|CBI32329.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL +HC VG+VRS TEGPK Y+I+VPP +IG 
Sbjct  128  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVHCSVGLVRSHTEGPKIYSIAVPPCNIGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GETF+AHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  188  HFGQLLESGKGTDVNFEVDGETFSAHKLVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+NS WASTLMAQHLLAA+DRYGLDRLRLLCE+NLCED
Sbjct  248  PVFKALLHFIYWDSLPDMEELTGLNSKWASTLMAQHLLAAADRYGLDRLRLLCESNLCED  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  308  VAINTVATTLALAEQHHCFQLKAVCL  333



>ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 gb|KDO68822.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis]
Length=407

 Score =   376 bits (966),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDYLK DCL +HC VGVV+S TEGPK Y+I++PPS+IG 
Sbjct  133  LKYRGSMWGYKRFFKRTLLEQSDYLKGDCLSVHCSVGVVKSHTEGPKIYSIAIPPSNIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGK TDVNFEVNGETFAAHKLVL+ARSPVFRAQL+GPMKDQN   I VEDMEA
Sbjct  193  HFGQLLESGKRTDVNFEVNGETFAAHKLVLAARSPVFRAQLYGPMKDQNTQCIKVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTGM+S WASTLM+QHLLAA+DRYGL+RLRLLCEANLCED
Sbjct  253  PVFKALLHFIYWDSLPDMEELTGMSSKWASTLMSQHLLAAADRYGLERLRLLCEANLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  313  VAINTVATTLALAEQHHCFQLKSVCL  338



>gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas]
Length=407

 Score =   376 bits (965),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LESSDYLKDDCLQ+HC VGVV+S TEGPKTY+I+VPPS+IG 
Sbjct  133  LKYRGSMWGYKRFFKRTLLESSDYLKDDCLQVHCSVGVVKSCTEGPKTYSIAVPPSNIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLE+GKGTDVNFEV+GE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  193  HFGQLLENGKGTDVNFEVDGEVFAAHKLVLAARSPVFRAQLFGPMKDQNTQLIKVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS WASTLM QHLLAA+DRY LDRLRLLCEANLCED
Sbjct  253  PVFKALLHFIYWDSLPDLEELTGLNSKWASTLMCQHLLAAADRYALDRLRLLCEANLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLK+VCL
Sbjct  313  VAINTVATTLALAEQHHCVQLKAVCL  338



>gb|KDO68823.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis]
Length=399

 Score =   375 bits (964),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDYLK DCL +HC VGVV+S TEGPK Y+I++PPS+IG 
Sbjct  133  LKYRGSMWGYKRFFKRTLLEQSDYLKGDCLSVHCSVGVVKSHTEGPKIYSIAIPPSNIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGK TDVNFEVNGETFAAHKLVL+ARSPVFRAQL+GPMKDQN   I VEDMEA
Sbjct  193  HFGQLLESGKRTDVNFEVNGETFAAHKLVLAARSPVFRAQLYGPMKDQNTQCIKVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTGM+S WASTLM+QHLLAA+DRYGL+RLRLLCEANLCED
Sbjct  253  PVFKALLHFIYWDSLPDMEELTGMSSKWASTLMSQHLLAAADRYGLERLRLLCEANLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  313  VAINTVATTLALAEQHHCFQLKSVCL  338



>gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata]
Length=410

 Score =   375 bits (962),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCLQ+HCCVGVV+S TEGPK Y+I +PPSDIG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLQVHCCVGVVKSHTEGPKIYSIPLPPSDIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKG+DVNF+VNGE F+AHKLVL+ARSPVFRAQL+GPMKDQN   IN+EDME 
Sbjct  196  HFGQLLESGKGSDVNFDVNGENFSAHKLVLAARSPVFRAQLYGPMKDQNTQCINIEDMEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTGMN  WA+T+M+QHLLAA+DRYGLDRLRLLCEA LCED
Sbjct  256  PVFKALLHFMYWDTLPDLEELTGMNLPWAATMMSQHLLAAADRYGLDRLRLLCEAKLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHCFQLKSVCL
Sbjct  316  VAINTVANTLALAEQHHCFQLKSVCL  341



>emb|CDP03595.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   375 bits (962),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLK+DCLQ+HCCVGVVRS+TEGPK Y+I +PPSDIG 
Sbjct  135  LKYRGSMWGYKRFFKRTALETSDYLKNDCLQVHCCVGVVRSQTEGPKIYSIPLPPSDIGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLE GKGTDVNFEVNGE F+AHKLVL+ARSPVFRAQLFGPMKD +   I VEDMEA
Sbjct  195  HFGQLLECGKGTDVNFEVNGEKFSAHKLVLAARSPVFRAQLFGPMKDHDTQCIRVEDMEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+NS  A++LMAQHLLAA+DRYGLDRLRL+CEANLCED
Sbjct  255  PVFKALLHFIYWDCLPDMEELTGLNSKGATSLMAQHLLAAADRYGLDRLRLICEANLCED  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLKSVCL
Sbjct  315  VAINTVATTLALAEQHHCFQLKSVCL  340



>ref|XP_006604419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
Length=410

 Score =   372 bits (954),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVVRS TEGPK Y I++PPS IG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVRSHTEGPKIYTIAIPPSSIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FGQLLESGKG+DVNFEVNG+ FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  196  KFGQLLESGKGSDVNFEVNGDIFAAHKLVLAARSPVFRAQLFGPMKDQNTQRIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS WASTLMAQHLLAA+DRYGL+RLRL+CEA+LCED
Sbjct  256  PVFKALLHFIYWDSLPDMQELTGLNSKWASTLMAQHLLAAADRYGLERLRLMCEASLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  316  VAINTVATTLALAEQHHCFQLKAVCL  341



>ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
 gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
Length=493

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDYLKD+CL +HC VGVV+S TEGPK Y+I+VPPS+IG 
Sbjct  132  LKYRGSMWGYKRFFKRTLLEQSDYLKDNCLSVHCSVGVVKSHTEGPKVYSIAVPPSNIGH  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESGKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  192  HFGQLLESGKGTDVSFEVDGEVFPAHKLVLAARSPVFRAQLFGPMKDQNTRKIKVEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS WASTLM+QHLLAA+DRYGLDRLRLLCEANLCED
Sbjct  252  PVFKALLHFIYWDCLPDMQELTGLNSKWASTLMSQHLLAAADRYGLDRLRLLCEANLCED  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  312  VAINTVATTLALAEQHHCFQLKAVCL  337



>gb|KJB22576.1| hypothetical protein B456_004G055100 [Gossypium raimondii]
Length=357

 Score =   367 bits (943),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDY KDDCL +HC VGVV+S TEGPK Y+I+VPPS+I  
Sbjct  132  LKYRGSMWGYKRFFKRTLLEQSDYHKDDCLSVHCSVGVVKSHTEGPKIYSIAVPPSNISH  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG+LLESGKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKDQN   I +EDMEA
Sbjct  192  HFGKLLESGKGTDVSFEVDGEVFHAHKLVLAARSPVFRAQLFGPMKDQNTKQIKIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS WAS LM+QHLLAA+DRYGLDRLRL+CEANLCED
Sbjct  252  PVFKALLHFIYWDSLPDMQELTGLNSKWASALMSQHLLAAADRYGLDRLRLICEANLCED  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQHHCFQLK+VCL
Sbjct  312  VTINTVATTLALAEQHHCFQLKAVCL  337



>ref|XP_010090357.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB39327.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=404

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+SRTEGPKTY+I++PPS+IG 
Sbjct  135  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCIVGVVKSRTEGPKTYSIAIPPSNIGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV GE F+AHKLVL ARSPVFRAQLFGPMKDQN   I +EDMEA
Sbjct  195  HFGQLLESGKGTDVTFEVYGEHFSAHKLVLGARSPVFRAQLFGPMKDQNTECIKIEDMEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS WASTLMAQHLLAA+DRYGL+RLRLLCE++LCE 
Sbjct  255  PVFKALLHFIYWDSLPDVEELTGLNSKWASTLMAQHLLAAADRYGLERLRLLCESSLCEH  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  315  VAINTVATTLALAEQHHCFQLKAVCL  340



>ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=500

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF KRT+LESSDYLKDDCLQ+HC VGVV+S TEG KTY+I+V PS+IG 
Sbjct  139  LKYRGSMWGYKRFLKRTLLESSDYLKDDCLQVHCSVGVVKSHTEGSKTYSIAVLPSNIGQ  198

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV+FEV+GE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  199  HFGQLLESGKGTDVSFEVDGEVFAAHKLVLAARSPVFRAQLFGPMKDQNTQLIKVEDMEA  258

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS WASTLM+QHLLAA+DRYGLDRLRLLCEANLCE+
Sbjct  259  PVFKALLHFIYWDSLPDLEELTGLNSKWASTLMSQHLLAAADRYGLDRLRLLCEANLCEE  318

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLAL+EQHHCFQLK+VCL
Sbjct  319  VAINTVATTLALSEQHHCFQLKAVCL  344



>gb|KJB22575.1| hypothetical protein B456_004G055100 [Gossypium raimondii]
Length=406

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDY KDDCL +HC VGVV+S TEGPK Y+I+VPPS+I  
Sbjct  132  LKYRGSMWGYKRFFKRTLLEQSDYHKDDCLSVHCSVGVVKSHTEGPKIYSIAVPPSNISH  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG+LLESGKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKDQN   I +EDMEA
Sbjct  192  HFGKLLESGKGTDVSFEVDGEVFHAHKLVLAARSPVFRAQLFGPMKDQNTKQIKIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS WAS LM+QHLLAA+DRYGLDRLRL+CEANLCED
Sbjct  252  PVFKALLHFIYWDSLPDMQELTGLNSKWASALMSQHLLAAADRYGLDRLRLICEANLCED  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQHHCFQLK+VCL
Sbjct  312  VTINTVATTLALAEQHHCFQLKAVCL  337



>ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cicer arietinum]
Length=497

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVVRSRTEGPK Y+I++PPSDIG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVRSRTEGPKIYSIAIPPSDIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FGQLLESGKG+DV+FEVNGE F AHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  196  KFGQLLESGKGSDVSFEVNGEIFTAHKLVLAARSPVFRAQLFGPMKDQNTRCIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTGMNS WA+TLMAQHLLAA+DRY L+RLRL+CE +LCED
Sbjct  256  PVFKALLHFMYWDSLPDMQELTGMNSKWATTLMAQHLLAAADRYALERLRLICEVSLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  316  VAINTVATTLALAEQHHCFQLKAVCL  341



>ref|XP_008458543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis melo]
 gb|KGN46162.1| hypothetical protein Csa_6G061240 [Cucumis sativus]
Length=411

 Score =   366 bits (940),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKR+FKRTVLE+SD+LKDDCL+IHC VGVV+S TEGPK Y+I+ PPSDIG 
Sbjct  135  LKYRGSMWGYKRYFKRTVLETSDFLKDDCLEIHCVVGVVKSHTEGPKIYSITPPPSDIGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDVNFEV+GETF+AHKLVL+ARSPVFRAQLFGP+KDQN   I VEDMEA
Sbjct  195  HFGKLLESGKLTDVNFEVDGETFSAHKLVLAARSPVFRAQLFGPLKDQNTECIKVEDMEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+E+ G+NS WASTLM+QHLLAA+DRY LDRL+LLCEA LCED
Sbjct  255  PVFKALLHFIYWDALPDMQEIVGLNSKWASTLMSQHLLAAADRYALDRLKLLCEAKLCED  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  315  VAINTVATTLALAEQHHCFQLKAVCL  340



>ref|XP_007162393.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
 gb|ESW34387.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
Length=411

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVVRSRTEGPK Y I++PPS IG 
Sbjct  137  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVRSRTEGPKIYTIAIPPSSIGQ  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FGQLLE+ KG+DVNFEV+GE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  197  QFGQLLENRKGSDVNFEVDGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM ELTG+NS WASTLMAQHLLAA+DRYGL+RLRL CEA+LCED
Sbjct  257  PVFKALLHFIYWDSLPDMHELTGLNSKWASTLMAQHLLAAADRYGLERLRLKCEASLCED  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  317  VAINTVATTLALAEQHHCFQLKAVCL  342



>ref|XP_008808252.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Phoenix dactylifera]
Length=359

 Score =   362 bits (930),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL + C VGVVRSRTEGPK Y I VPPS+I  
Sbjct  141  LKYRGSMWGYKRFFKRTSLEASDYLKDDCLSVSCSVGVVRSRTEGPKIYTIPVPPSNIAQ  200

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV+GE F+AHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDMEA
Sbjct  201  HFGQLLESGKGTDVAFEVDGEIFSAHKLVLAARSPVFRAQLFGPMKDRNMQCIKVEDMEA  260

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPDMEELTG+N+ WASTLMAQHLLAA+DRY L+RL+ LCE  LCED
Sbjct  261  PIFKALLHFIYWDSLPDMEELTGLNTKWASTLMAQHLLAAADRYALERLKSLCEVKLCED  320

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  321  VAINTVATTLALAEQHHCFQLKAVCL  346



>gb|KEH23724.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=410

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVVRSRTEGPK Y+I++PPS+IG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVRSRTEGPKIYSIAIPPSNIGH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQN-MSINVEDMEA  359
             FGQLLE+GKG+DV+FEV+GE F AHKLVL+ARSPVFRAQLFGPM+DQ+  SI VEDMEA
Sbjct  196  QFGQLLENGKGSDVSFEVDGEVFTAHKLVLAARSPVFRAQLFGPMRDQSTQSIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTGMN+ WA+TLMAQHLLAA+DRY L+RLRL+CEA+LCED
Sbjct  256  PVFKALLHFMYWDSLPDMQELTGMNTKWATTLMAQHLLAAADRYALERLRLICEASLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  316  VAINTVATTLALAEQHHCFQLKAVCL  341



>ref|XP_010905245.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Elaeis guineensis]
Length=359

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL + C VGVVRSRTEGPK Y I VPPS+I  
Sbjct  141  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVSCSVGVVRSRTEGPKIYTIPVPPSNIAQ  200

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV+GE FAAHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDMEA
Sbjct  201  HFGQLLESGKGTDVAFEVDGEIFAAHKLVLAARSPVFRAQLFGPMKDRNMQCIKVEDMEA  260

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHFIY D LPDMEELTG+N+ WASTLMAQHLLAA+DRY L+RL+ LCE  LCED
Sbjct  261  TVFKALLHFIYWDSLPDMEELTGLNTKWASTLMAQHLLAAADRYALERLKSLCEVKLCED  320

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  321  VAINTVATTLALAEQHHCFQLKAVCL  346



>ref|XP_010278817.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Nelumbo nucifera]
Length=407

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL +HC VGVVRS TEGPK Y+I VP S+IG 
Sbjct  133  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVHCSVGVVRSHTEGPKIYSIPVPSSNIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG LLESG+GTDVNFEV+GE F+AHKLVL+ARSPVFRAQLFGPMKD+N   I VEDMEA
Sbjct  193  HFGHLLESGRGTDVNFEVDGEIFSAHKLVLAARSPVFRAQLFGPMKDRNTECIKVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P FKALLHFIY D +PDM+E TG+NS WASTLM QHLLAA+DRYGL+RLRLLCEA LCED
Sbjct  253  PAFKALLHFIYWDDIPDMQEFTGLNSKWASTLMGQHLLAAADRYGLERLRLLCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  313  VAINTVATTLALAEQHHCFQLKAVCL  338



>ref|XP_008808250.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=414

 Score =   362 bits (929),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL + C VGVVRSRTEGPK Y I VPPS+I  
Sbjct  141  LKYRGSMWGYKRFFKRTSLEASDYLKDDCLSVSCSVGVVRSRTEGPKIYTIPVPPSNIAQ  200

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV+GE F+AHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDMEA
Sbjct  201  HFGQLLESGKGTDVAFEVDGEIFSAHKLVLAARSPVFRAQLFGPMKDRNMQCIKVEDMEA  260

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPDMEELTG+N+ WASTLMAQHLLAA+DRY L+RL+ LCE  LCED
Sbjct  261  PIFKALLHFIYWDSLPDMEELTGLNTKWASTLMAQHLLAAADRYALERLKSLCEVKLCED  320

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  321  VAINTVATTLALAEQHHCFQLKAVCL  346



>ref|XP_010255860.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X2 [Nelumbo nucifera]
Length=363

 Score =   359 bits (921),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL +HC VGVV S TEGPK Y I+VP S+IG 
Sbjct  131  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVHCSVGVVGSHTEGPKFYLITVPTSNIGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GE FAAHKLVL+ARSPVFRAQLFGPMKD+N   I V+DMEA
Sbjct  191  HFGQLLESGKGTDVNFEVDGEIFAAHKLVLAARSPVFRAQLFGPMKDRNTECIKVQDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS  ASTLM QH+LAA+DRYGL+RLRLLCEA LCED
Sbjct  251  PVFKALLHFIYWDDLPDMQELTGLNSKGASTLMGQHMLAAADRYGLERLRLLCEAKLCED  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  311  VAINTVATTLALAEQHHCFQLKAVCL  336



>ref|XP_010905244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Elaeis guineensis]
Length=414

 Score =   360 bits (925),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL + C VGVVRSRTEGPK Y I VPPS+I  
Sbjct  141  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVSCSVGVVRSRTEGPKIYTIPVPPSNIAQ  200

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDV FEV+GE FAAHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDMEA
Sbjct  201  HFGQLLESGKGTDVAFEVDGEIFAAHKLVLAARSPVFRAQLFGPMKDRNMQCIKVEDMEA  260

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHFIY D LPDMEELTG+N+ WASTLMAQHLLAA+DRY L+RL+ LCE  LCED
Sbjct  261  TVFKALLHFIYWDSLPDMEELTGLNTKWASTLMAQHLLAAADRYALERLKSLCEVKLCED  320

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  321  VAINTVATTLALAEQHHCFQLKAVCL  346



>ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Fragaria vesca subsp. vesca]
Length=411

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKD+CL ++C VGVV+S TEGPK Y+I+VP S++G 
Sbjct  137  LKYRGSMWGYKRFFKRTSLETSDYLKDNCLSVNCMVGVVKSHTEGPKIYSIAVPRSNMGQ  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +FGQLLESGKGTDVNFEV+GETFAAHKLVL+ARSPVFRAQLFGPMKDQN   INVED+EA
Sbjct  197  YFGQLLESGKGTDVNFEVDGETFAAHKLVLAARSPVFRAQLFGPMKDQNSQCINVEDIEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+NS  ASTLMAQHLLAA+DRYGL+RLRLLCE NLC+D
Sbjct  257  PVFKALLHFMYWDSLPDIEELTGINSHGASTLMAQHLLAAADRYGLERLRLLCEQNLCKD  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  317  VAINTVATTLALAEQHHCFQLKAVCL  342



>gb|KJB25908.1| hypothetical protein B456_004G215300 [Gossypium raimondii]
Length=361

 Score =   357 bits (915),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE SDYLK+DCL +HC VGVV+S TEGPK Y+I+VPPS IG 
Sbjct  87   LKYRGSMWGYKRFFRRTLLEQSDYLKNDCLSVHCSVGVVKSHTEGPKFYSIAVPPSRIGH  146

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLL++GKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMK+QN   I VED+EA
Sbjct  147  HFGQLLKTGKGTDVSFEVDGEVFYAHKLVLAARSPVFRAQLFGPMKEQNTKQIKVEDIEA  206

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTG++S W +TLM+QHLLAA+DRYGL+RLRLLCE+NLCED
Sbjct  207  PVFKALLHFMYWDSLPDMQELTGLDSKWVTTLMSQHLLAAADRYGLERLRLLCESNLCED  266

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  267  VAINTVATTLALAEQHHCFQLKAVCL  292



>ref|XP_010255859.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   358 bits (919),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL +HC VGVV S TEGPK Y I+VP S+IG 
Sbjct  131  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVHCSVGVVGSHTEGPKFYLITVPTSNIGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GE FAAHKLVL+ARSPVFRAQLFGPMKD+N   I V+DMEA
Sbjct  191  HFGQLLESGKGTDVNFEVDGEIFAAHKLVLAARSPVFRAQLFGPMKDRNTECIKVQDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS  ASTLM QH+LAA+DRYGL+RLRLLCEA LCED
Sbjct  251  PVFKALLHFIYWDDLPDMQELTGLNSKGASTLMGQHMLAAADRYGLERLRLLCEAKLCED  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  311  VAINTVATTLALAEQHHCFQLKAVCL  336



>gb|KJB25907.1| hypothetical protein B456_004G215300 [Gossypium raimondii]
Length=353

 Score =   356 bits (914),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE SDYLK+DCL +HC VGVV+S TEGPK Y+I+VPPS IG 
Sbjct  131  LKYRGSMWGYKRFFRRTLLEQSDYLKNDCLSVHCSVGVVKSHTEGPKFYSIAVPPSRIGH  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLL++GKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMK+QN   I VED+EA
Sbjct  191  HFGQLLKTGKGTDVSFEVDGEVFYAHKLVLAARSPVFRAQLFGPMKEQNTKQIKVEDIEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTG++S W +TLM+QHLLAA+DRYGL+RLRLLCE+NLCED
Sbjct  251  PVFKALLHFMYWDSLPDMQELTGLDSKWVTTLMSQHLLAAADRYGLERLRLLCESNLCED  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  311  VAINTVATTLALAEQHHCFQLKAVCL  336



>ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica]
 gb|EMJ02250.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica]
Length=409

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y+I VPPS +G 
Sbjct  135  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTEGPKIYSIPVPPSSMGH  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKGTDVNFE++GE FAAHKLVL+ARSPVFRAQLFGPMKDQN   INVED+EA
Sbjct  195  QFGRLLESGKGTDVNFEIDGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTRCINVEDIEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS  +STLMAQHLLAA+DRYGLDRLRLLCEANLC+D
Sbjct  255  PVFKALLHFIYWDSLPDIEELTGINSNGSSTLMAQHLLAAADRYGLDRLRLLCEANLCKD  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
              INTVATTLALAEQHHCFQLK VCL
Sbjct  315  FAINTVATTLALAEQHHCFQLKVVCL  340



>ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 [Vitis 
vinifera]
 emb|CBI26169.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLK+DCL I C VGVV+S TEGPK Y I+V PS+IG 
Sbjct  132  LKYRGSMWGYKRFFKRTALETSDYLKNDCLLIRCSVGVVKSYTEGPKIYTIAVMPSNIGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESGKGTDVNFEV+GE F+AHKLVL+ARSPVFRAQLFGPMKD N   I +EDMEA
Sbjct  192  HFGQLLESGKGTDVNFEVDGEIFSAHKLVLAARSPVFRAQLFGPMKDCNTQLIKIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF Y D LPDM+EL GMNS WAST+MAQHLLAA+DRYGLDRLRLLCE  LCED
Sbjct  252  PVFKALLHFTYWDALPDMQELVGMNSKWASTMMAQHLLAAADRYGLDRLRLLCEDKLCED  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  312  VAINTVATTLALAEQHHCFQLKAVCL  337



>ref|XP_011006874.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Populus euphratica]
Length=410

 Score =   357 bits (917),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R  LE+SDYLKDD L + CCVGVV+S TEGPKTY ISVPPS+IG 
Sbjct  137  LKYRGSMWGYKRFYRRNQLETSDYLKDDTLLVRCCVGVVKSHTEGPKTYTISVPPSNIGQ  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LL+SGKGTDVNFEV+GETFA+HK+VL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  197  HFGKLLDSGKGTDVNFEVDGETFASHKIVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HF+Y D LPD+EEL G+NS W STLMAQHLLAA+DRY L+RLRLLCEA LCED
Sbjct  257  PVFKALIHFMYWDALPDIEELVGLNSKWVSTLMAQHLLAAADRYALERLRLLCEARLCED  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQH C QLKSVCL
Sbjct  317  VAINTVATTLALAEQHQCIQLKSVCL  342



>gb|KHN18899.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=381

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I +PPS++G 
Sbjct  107  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVKSHTEGPKIYKIPIPPSNMGQ  166

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG+DV+FEVNGE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  167  QFGKLLESGKGSDVSFEVNGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTHCIKVEDMEA  226

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM+ELTG++S WA+TLMAQHLLAA+DRYGL+RLRL+CEA+LC+D
Sbjct  227  PVFKALLHVIYWDSLPDMQELTGLSSKWATTLMAQHLLAAADRYGLERLRLMCEASLCDD  286

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  287  VAINTVATTLALAEQHHCFQLKAVCL  312



>gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=405

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRFFKRT+LE SDYLKDDCL +HC VGVV+S TEGPK Y+I+V PS+I  
Sbjct  132  LKYRGSM-GYKRFFKRTLLEQSDYLKDDCLSVHCSVGVVKSHTEGPKIYSIAVTPSNISR  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGKGTDV+FEV+GE   AHKLVL+ARSPVFRAQLFGPMKDQN   I +EDMEA
Sbjct  191  HFGKLLESGKGTDVSFEVDGEVIHAHKLVLAARSPVFRAQLFGPMKDQNTKQIKIEDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+NS WAS LM+QHLLAA+DRYGLDRLRLLCEANLCED
Sbjct  251  PVFKALLHFIYWDSLPDMQELTGLNSKWASALMSQHLLAAADRYGLDRLRLLCEANLCED  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQHHCFQLK+VCL
Sbjct  311  VTINTVATTLALAEQHHCFQLKAVCL  336



>gb|KJB25905.1| hypothetical protein B456_004G215300 [Gossypium raimondii]
Length=405

 Score =   356 bits (914),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE SDYLK+DCL +HC VGVV+S TEGPK Y+I+VPPS IG 
Sbjct  131  LKYRGSMWGYKRFFRRTLLEQSDYLKNDCLSVHCSVGVVKSHTEGPKFYSIAVPPSRIGH  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLL++GKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMK+QN   I VED+EA
Sbjct  191  HFGQLLKTGKGTDVSFEVDGEVFYAHKLVLAARSPVFRAQLFGPMKEQNTKQIKVEDIEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTG++S W +TLM+QHLLAA+DRYGL+RLRLLCE+NLCED
Sbjct  251  PVFKALLHFMYWDSLPDMQELTGLDSKWVTTLMSQHLLAAADRYGLERLRLLCESNLCED  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  311  VAINTVATTLALAEQHHCFQLKAVCL  336



>ref|XP_011009015.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Populus euphratica]
Length=409

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KRT LE+SD+LKDD L I CCVGVV+S TEGPKTY I+VPPS+IG 
Sbjct  136  LKYRGSMWGYKRFYKRTQLETSDFLKDDTLLIRCCVGVVKSHTEGPKTYTIAVPPSNIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LL+SGKGTDVNFEV+GE  A+HK+VL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  196  HFGKLLDSGKGTDVNFEVDGEICASHKIVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HFIY D LPDMEEL G+NS WASTLMAQHLLAA+DRY L+RLRLLCEA LCED
Sbjct  256  PVFKALIHFIYWDALPDMEELVGLNSKWASTLMAQHLLAAADRYALERLRLLCEAKLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQH C QLKSVCL
Sbjct  316  VAINTVATTLALAEQHQCIQLKSVCL  341



>gb|KDP40087.1| hypothetical protein JCGZ_02085 [Jatropha curcas]
Length=412

 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDD L I CCVGVV+S TEGP+TY I+VPPSDIG 
Sbjct  139  LKYRGSMWGYKRFFKRTQLETSDYLKDDTLVIRCCVGVVKSHTEGPRTYTIAVPPSDIGQ  198

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+ LESG+G DVNFEV+GE F+AHKLVL+ARSPVFRAQLFGPMKDQ+   I VEDMEA
Sbjct  199  HFGKFLESGRGADVNFEVDGEIFSAHKLVLAARSPVFRAQLFGPMKDQSTQCIKVEDMEA  258

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPD+EEL G++S WASTLMAQHLLAASDRY LDRLRLLCE  LCED
Sbjct  259  PIFKALLHFIYWDALPDVEELVGLHSKWASTLMAQHLLAASDRYALDRLRLLCETRLCED  318

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQH C QLK+VCL
Sbjct  319  IAINTVATTLALAEQHQCLQLKAVCL  344



>ref|XP_002315535.1| speckle-type POZ family protein [Populus trichocarpa]
 gb|EEF01706.1| speckle-type POZ family protein [Populus trichocarpa]
Length=410

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R  LE+SDYLKDD L + CCVGVV+S TEGPKTY ISVPPS+IG 
Sbjct  137  LKYRGSMWGYKRFYRRNQLETSDYLKDDTLLVRCCVGVVKSHTEGPKTYTISVPPSNIGQ  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LL+SG GTDVNFEV+GETFA+HK+VL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  197  HFGKLLDSGTGTDVNFEVDGETFASHKIVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HF+Y D LPD+EEL G+NS W STLMAQHLLAA+DRY L+RLRLLCEA LCED
Sbjct  257  PVFKALIHFMYWDALPDIEELVGLNSKWVSTLMAQHLLAAADRYALERLRLLCEARLCED  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQH C QLKSVCL
Sbjct  317  VAINTVATTLALAEQHQCIQLKSVCL  342



>gb|KJB28232.1| hypothetical protein B456_005G035700 [Gossypium raimondii]
Length=408

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE+SDYLKDDCL I CCVGVV+S TEGPK Y+I+VPPSDIG 
Sbjct  133  LKYRGSMWGYKRFFKRTLLETSDYLKDDCLSIRCCVGVVKSHTEGPKIYSITVPPSDIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQN-MSINVEDMEA  359
            HFG+LLESGKG DV FEV+GE F AHKLVL+ARSPVFRAQLFGP+KDQN  SI VEDMEA
Sbjct  193  HFGKLLESGKGADVKFEVDGEIFDAHKLVLAARSPVFRAQLFGPLKDQNTQSIRVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEEL G  S WASTL+AQHLLAA+DRY L+R+RLLCEA LCE 
Sbjct  253  PVFKALLHFIYWDALPDMEELMGSTSKWASTLVAQHLLAAADRYALERMRLLCEAKLCEG  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQH+C  LK VCL
Sbjct  313  VTINTVATTLALAEQHNCLHLKGVCL  338



>ref|XP_003590693.1| Speckle-type POZ protein [Medicago truncatula]
 gb|AES60944.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=418

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKD+CL ++C VGVVRS TEGPKT++I + PS IG 
Sbjct  140  LKYRGSMWGYKRFFKRTSLETSDYLKDNCLSVNCSVGVVRSHTEGPKTFSIPISPSTIGH  199

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGK +DVNFEVNGE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EA
Sbjct  200  QFGKLLESGKSSDVNFEVNGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTQCIKVEDIEA  259

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM+ELTG+NS WA+TLMAQHLLAA+DRY LDRLRL+CEA+LCED
Sbjct  260  PVFKALLHVIYWDSLPDMQELTGINSKWATTLMAQHLLAAADRYALDRLRLMCEASLCED  319

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  320  VAINTVATTLALAEQHHCFQLKAVCL  345



>gb|EPS58860.1| hypothetical protein M569_15950 [Genlisea aurea]
Length=404

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LK RGSMWGYKRFFKR+ LE SDYLKDDCLQ+HC VGVV+S TEGPK Y I +PPSDIG 
Sbjct  130  LKCRGSMWGYKRFFKRSTLEGSDYLKDDCLQVHCSVGVVKSHTEGPKVYTIPIPPSDIGQ  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLL +G+G D+ FEV+GETFAAHKLV++ARSPVFRAQL+GPMKD++   I VEDMEA
Sbjct  190  HFGQLLGTGEGADITFEVDGETFAAHKLVIAARSPVFRAQLYGPMKDRDTQHIKVEDMEA  249

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY DVLPDM ELTG+NS WASTLM QHLLAA+DRY LDRLRLLCEA LCE 
Sbjct  250  PVFKALLHFIYWDVLPDMVELTGLNSKWASTLMTQHLLAAADRYCLDRLRLLCEATLCEQ  309

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  310  VAINTVATTLALAEQHHCFQLKAVCL  335



>gb|KJB42045.1| hypothetical protein B456_007G134100 [Gossypium raimondii]
Length=403

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR +LE SDYLKDDCL +HC VGVV S TEGPK ++I+VPPS+IG 
Sbjct  129  LKYRGSMWGYKRFFKRMLLEQSDYLKDDCLSVHCSVGVVMSHTEGPKIFSIAVPPSNIGH  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESGK TDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKD N   I VEDMEA
Sbjct  189  HFGQLLESGKQTDVSFEVDGEFFPAHKLVLAARSPVFRAQLFGPMKDHNTKQIEVEDMEA  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+ S WA TLM+QHLLAA+DRYGLDRLRL+CEANLCE 
Sbjct  249  PVFKALLHFIYWDSLPDMEELTGLTSKWAFTLMSQHLLAAADRYGLDRLRLMCEANLCEV  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCF+LK+VCL
Sbjct  309  VAINTVATTLALAEQHHCFRLKAVCL  334



>ref|XP_002516797.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF45411.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=403

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDD L I CCVGVV+S+TEGPKTY I+V PSDIG 
Sbjct  130  LKYRGSMWGYKRFFKRTQLETSDYLKDDTLVIRCCVGVVKSQTEGPKTYTIAVLPSDIGQ  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGKG DVNFEV+GE F+AHKLVL+ RSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  190  HFGKLLESGKGADVNFEVDGEVFSAHKLVLATRSPVFRAQLFGPMKDQNTQCIKVEDMEA  249

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EEL G+NS WASTL+AQHLLAA+DRY L+RLRL+CEA LCED
Sbjct  250  PVFKALLHFIYWDALPDVEELVGLNSKWASTLIAQHLLAAADRYALERLRLVCEAKLCED  309

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQH C QLK+VCL
Sbjct  310  IAINTVATTLALAEQHQCLQLKAVCL  335



>gb|AFK40364.1| unknown [Medicago truncatula]
Length=418

 Score =   353 bits (907),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKD+CL ++C VGVVRS TEGPKT++I + PS IG 
Sbjct  140  LKYRGSMWGYKRFFKRTSLETSDYLKDNCLSVNCSVGVVRSHTEGPKTFSIPISPSTIGH  199

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGK +DVNFEVNGE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EA
Sbjct  200  QFGKLLESGKSSDVNFEVNGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTQCIKVEDIEA  259

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM ELTG+NS WA+TLMAQHLLAA+DRY LDRLRL+CEA+LCED
Sbjct  260  PVFKALLHVIYWDSLPDMPELTGINSKWATTLMAQHLLAAADRYALDRLRLMCEASLCED  319

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  320  VAINTVATTLALAEQHHCFQLKAVCL  345



>ref|XP_004495233.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Cicer arietinum]
Length=410

 Score =   353 bits (905),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPKTY+I++ PS IG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVKSHTEGPKTYSIAISPSSIGH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE GKG+DV+FEVNGE FAAHKLVL+ARS VFRAQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLEGGKGSDVSFEVNGEIFAAHKLVLAARSAVFRAQLFGPMKDQNTQCIKVEDIEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM+ELTG++S WA+TLM+QHLLAA+DRYGLDRLRL+CEA+LCED
Sbjct  256  PVFKALLHVIYWDSLPDMQELTGLSSKWATTLMSQHLLAAADRYGLDRLRLMCEASLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCF+LK+VCL
Sbjct  316  VAINTVATTLALAEQHHCFRLKAVCL  341



>gb|KHG23128.1| BTB/POZ and MATH domain-containing protein 2 [Gossypium arboreum]
Length=408

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE+SDYLKDDCL I CCVGVV+S TEGPK Y+I+ PPSDIG 
Sbjct  133  LKYRGSMWGYKRFFKRTLLETSDYLKDDCLSIRCCVGVVKSHTEGPKIYSITAPPSDIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQN-MSINVEDMEA  359
            HFG+LLESGKG DV FEV+GE F AHKL+L+ARSPVFRAQLFGP+KDQN  SI VEDMEA
Sbjct  193  HFGKLLESGKGADVKFEVDGEIFDAHKLILAARSPVFRAQLFGPLKDQNTQSIRVEDMEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEEL G  S WASTL+AQHLLAA+DRY L+R+RLLCEA LCE 
Sbjct  253  PVFKALLHFIYWDALPDMEELMGSTSKWASTLVAQHLLAAADRYALERMRLLCEAKLCEG  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQH+C  LK VCL
Sbjct  313  VTINTVATTLALAEQHNCLHLKGVCL  338



>ref|XP_006380054.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa]
 gb|ERP57851.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa]
Length=409

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KRT LE+SD+LKDD L I CCVGVV+S TEGPKTY I+VPPS+IG 
Sbjct  136  LKYRGSMWGYKRFYKRTQLETSDFLKDDTLLIRCCVGVVKSHTEGPKTYTIAVPPSNIGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LL+SGK TDVNFEV+GE  A+HK+VL+ARSPVFRAQLFGPMKDQN   I VEDMEA
Sbjct  196  HFGKLLDSGKRTDVNFEVDGEICASHKIVLAARSPVFRAQLFGPMKDQNTQCIKVEDMEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKAL+HFIY D LPDMEEL G+NS WASTLMAQHLLAA+DRY L+RLRLLCEA LCED
Sbjct  256  PVFKALIHFIYWDALPDMEELVGLNSKWASTLMAQHLLAAADRYALERLRLLCEARLCED  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQH C QLKSVCL
Sbjct  316  VAINTVATTLALAEQHQCIQLKSVCL  341



>ref|XP_008438731.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Cucumis 
melo]
Length=408

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKR+FKRT+LESSDYLKDDCL I C VGVV+S+TEGPK Y+I+ PPS+IG 
Sbjct  133  LKYRGSMWGYKRYFKRTLLESSDYLKDDCLSIKCVVGVVKSQTEGPKIYSITPPPSNIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK  DVNFEVNGE FAAHKLV++ARSPVFRAQLFGP+KD++   I VED+EA
Sbjct  193  HFGKLLESGKCADVNFEVNGEIFAAHKLVIAARSPVFRAQLFGPLKDKDTRLIKVEDIEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM EL G NS WASTLMAQHLLAA+DRY LDRL+LLCEA LCED
Sbjct  253  PVFKALLHFMYWDNLPDMLELVGANSKWASTLMAQHLLAAADRYALDRLKLLCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHCFQLK+ CL
Sbjct  313  IAINTVATTLALAEQHHCFQLKAACL  338



>gb|KHG23818.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=402

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRFFKRT+LE SDYLKDDCL +HC VGVV S TEGPK ++I+VPPS+IG 
Sbjct  129  LKYRGSM-GYKRFFKRTLLEQSDYLKDDCLSVHCSVGVVMSHTEGPKIFSIAVPPSNIGH  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESGK TDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKD N   I VEDMEA
Sbjct  188  HFGQLLESGKQTDVSFEVDGEFFPAHKLVLAARSPVFRAQLFGPMKDHNTKQIEVEDMEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+ S WASTLM+QHLLAA+DRYGLDRLRL+CEANLCE 
Sbjct  248  PVFKALLHFIYWDSLPDMEELTGLTSKWASTLMSQHLLAAADRYGLDRLRLMCEANLCEV  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCF+LK+VCL
Sbjct  308  VAINTVATTLALAEQHHCFRLKAVCL  333



>ref|XP_006850808.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
 gb|ERN12389.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
Length=408

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL +HC VGVVRS TEGPK Y I VPPS+IG 
Sbjct  135  LKYRGSMWGYKRFFKRTSLEASDYLKDDCLSVHCSVGVVRSHTEGPKLYTIPVPPSNIGE  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESG+G DV+FEV+GE F  HKLVL+ARSPVFRAQL GPMKDQN   I V D+EA
Sbjct  195  HFGKLLESGQGADVSFEVDGEIFPTHKLVLAARSPVFRAQLMGPMKDQNTDCIKVTDIEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+ELTG+ S  A+TLMAQHLLAA+DRYG++RLRLLCE  LCED
Sbjct  255  PVFKALLHFIYTDTLPDMQELTGLTSKCATTLMAQHLLAAADRYGMERLRLLCEVKLCED  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLKSVCL
Sbjct  315  ISINTVATTLALAEQHHCFQLKSVCL  340



>ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
 gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
Length=403

 Score =   349 bits (895),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE+SDYLKDDCL + CCVGVV+S TEGPKTY+I VPPSDIG 
Sbjct  128  LKYRGSMWGYKRFFKRTLLETSDYLKDDCLSVSCCVGVVKSYTEGPKTYSIPVPPSDIGK  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE G+ TDVNFEV+GE+FAAHKLVL+ RSPVF+AQLFGP+KDQN   I VEDME 
Sbjct  188  QFGKLLEGGRFTDVNFEVDGESFAAHKLVLATRSPVFKAQLFGPLKDQNTQCIKVEDMEV  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDME+L  ++  WASTLMAQHLLAA+DRY L+RL+LLCEA LCED
Sbjct  248  PVFKALLHFIYWDALPDMEDLVDLSPKWASTLMAQHLLAAADRYALERLKLLCEAKLCED  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLK+VCL
Sbjct  308  VAINTVATTLALAEQHHCSQLKAVCL  333



>ref|XP_006588617.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
 gb|KHN03775.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=413

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I +P S++G 
Sbjct  139  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVKSHTEGPKIYKIPIPSSNMGQ  198

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGK +DV+FEVNGE FAAHKLVL+ARSPVFRAQLFGPMK+QN   I VEDMEA
Sbjct  199  QFGKLLESGKDSDVSFEVNGEIFAAHKLVLAARSPVFRAQLFGPMKNQNTHCIKVEDMEA  258

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM+ELTG++S WA+TLMAQHLLAA+DRYGL+RLRL+CE +LCED
Sbjct  259  PVFKALLHVIYWDSLPDMQELTGLSSKWATTLMAQHLLAAADRYGLERLRLMCETSLCED  318

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  319  VAINTVATTLALAEQHHCFQLKAVCL  344



>ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|KDO74864.1| hypothetical protein CISIN_1g015649mg [Citrus sinensis]
Length=403

 Score =   348 bits (892),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE+SDYLKDDCL + CCVGVV+S TEGPKTY+I VPPSDIG 
Sbjct  128  LKYRGSMWGYKRFFKRTLLETSDYLKDDCLSVSCCVGVVKSYTEGPKTYSIPVPPSDIGK  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE G+ TDVNFEV+GE FAAHKLVL+ RSPVF+AQLFGP+KDQN   I VEDME 
Sbjct  188  QFGKLLEGGRFTDVNFEVDGERFAAHKLVLATRSPVFKAQLFGPLKDQNTQCIKVEDMEV  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDME+L  ++  WASTLMAQHLLAA+DRY L+RL+LLCEA LCED
Sbjct  248  PVFKALLHFIYWDALPDMEDLVDLSPKWASTLMAQHLLAAADRYALERLKLLCEAKLCED  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLK+VCL
Sbjct  308  VAINTVATTLALAEQHHCSQLKAVCL  333



>ref|XP_010038130.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Eucalyptus grandis]
 gb|KCW49942.1| hypothetical protein EUGRSUZ_K03404 [Eucalyptus grandis]
Length=407

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LE+S+YLKDD L +HC VGVVRS TEGPK ++I VPPS IG 
Sbjct  133  LKYRGSMWGYKRFFKRSLLETSEYLKDDTLSVHCIVGVVRSHTEGPKIFSIPVPPSSIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
              G+LLESGKG DV+FEV+GE + AHKLVL+ARSPVFRAQL+GPMKDQN   I VEDME 
Sbjct  193  DLGKLLESGKGADVSFEVDGEVYPAHKLVLAARSPVFRAQLYGPMKDQNTKQIRVEDMEP  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHFIY D LPD++ELTG+++ WASTLM+QHLLAA+DRYGLDRLRLLCEANLC+D
Sbjct  253  SVFKALLHFIYFDSLPDLQELTGLDTKWASTLMSQHLLAAADRYGLDRLRLLCEANLCQD  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  313  VAINTVATTLALAEQHHCFQLKAVCL  338



>ref|XP_004153182.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 2-like [Cucumis sativus]
Length=416

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 184/211 (87%), Gaps = 6/211 (3%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKR+FKRTVLE+SD+LKDDCL+IHC VGVV+S TEGPK Y+I+ PPSDIG 
Sbjct  135  LKYRGSMWGYKRYFKRTVLETSDFLKDDCLEIHCVVGVVKSHTEGPKIYSITPPPSDIGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDVNFEV+GETF+AHKLVL+ARSPVFRAQLFGP+KDQN   I VEDM  
Sbjct  195  HFGKLLESGKLTDVNFEVDGETFSAHKLVLAARSPVFRAQLFGPLKDQNTECIKVEDMGG  254

Query  360  P-----VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEA  524
                   + ALLHFIY D LPDM+E+ G+NS WASTLM+QHLLAA+DRY LDRL+LLCEA
Sbjct  255  GGGRGVFYXALLHFIYWDALPDMQEIVGLNSKWASTLMSQHLLAAADRYALDRLKLLCEA  314

Query  525  NLCEDVTINTVATTLALAEQHHCFQLKSVCL  617
             LCEDV INTVATTLALAEQHHCFQLK+VCL
Sbjct  315  KLCEDVAINTVATTLALAEQHHCFQLKAVCL  345



>gb|KHG05413.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   345 bits (885),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRFF+RT+LE SDYLK+DCL +HC VGVV S TEGPK Y+I+VPPS IG 
Sbjct  131  LKYRGSM-GYKRFFRRTLLEQSDYLKNDCLSVHCSVGVVTSHTEGPKFYSIAVPPSRIGH  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLL+ GKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMK+QN   I VED+EA
Sbjct  190  HFGQLLKIGKGTDVSFEVDGEVFYAHKLVLAARSPVFRAQLFGPMKEQNTKQIKVEDIEA  249

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM+ELTG++S W +TLM+QHLLAA+DRYGL+RLRLLCE+NLCED
Sbjct  250  PVFKALLHFMYWDSLPDMQELTGLDSKWVTTLMSQHLLAAADRYGLERLRLLCESNLCED  309

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINT ATTLALAEQHHCFQLK+VCL
Sbjct  310  VTINTAATTLALAEQHHCFQLKAVCL  335



>ref|XP_010103451.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB95854.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=412

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+VLE+SDYLKDDCL I CCVGVVRS TEGPK Y+++VP S+I  
Sbjct  137  LKYRGSMWGYKRFFKRSVLETSDYLKDDCLSIKCCVGVVRSNTEGPKIYSVTVPSSNISN  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG++LESGKG+DV+FEV+GE FAAHKLVL+ARSPVFRAQLFGP+KD+N   I +EDMEA
Sbjct  197  DFGKILESGKGSDVSFEVDGEVFAAHKLVLAARSPVFRAQLFGPLKDKNTRCIKIEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH+IY D LPDM+EL GMNS  AST+MAQHLLAASDRY L+RLRLLCE  L ED
Sbjct  257  PVFKALLHYIYWDSLPDMQELVGMNSKCASTMMAQHLLAASDRYALERLRLLCEGKLSED  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK  CL
Sbjct  317  ISINTVATTLALAEQHHCFQLKDACL  342



>ref|XP_008368872.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S T+GPK Y+I +PPS +  
Sbjct  136  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTQGPKIYSIPIPPSSMXH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE+GKGTDV+FEV+ E F AHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLETGKGTDVSFEVDEEIFCAHKLVLAARSPVFRAQLFGPMKDQNTRCIKVEDIEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+NS  ASTLMAQHLLAA+DRYGLDRLRL+CEANLC+D
Sbjct  256  PVFKALLHFIYWDSLPDMEELTGINSNGASTLMAQHLLAAADRYGLDRLRLMCEANLCQD  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTIN VATTLALAEQHHC QLK VCL
Sbjct  316  VTINNVATTLALAEQHHCSQLKPVCL  341



>ref|XP_009787612.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=407

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE+SDYLKDDCL + C VGVVRS  E PKTY++ VPPSDIG 
Sbjct  133  LKYRGSMWGYKRFFRRTLLETSDYLKDDCLLVQCTVGVVRSYNETPKTYSLPVPPSDIGS  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESG+G D+ FEV GE FAAHKLVL+ARSPVFRAQLFGP+K+ N+ SI VE+++A
Sbjct  193  HFGQLLESGEGADIKFEVEGEVFAAHKLVLAARSPVFRAQLFGPLKEDNVQSIKVEEIQA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD++EL G+++ WA TLMAQHLLAA+D+YGL+RLR LCEA LCED
Sbjct  253  PVFKALLHFIYWDALPDLQELVGLDTKWAVTLMAQHLLAAADQYGLERLRALCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALA+QHHC QLKSVCL
Sbjct  313  VTINTVATTLALADQHHCVQLKSVCL  338



>ref|XP_004134158.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis sativus]
 ref|XP_004165840.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis sativus]
 gb|KGN57032.1| hypothetical protein Csa_3G150120 [Cucumis sativus]
Length=408

 Score =   342 bits (878),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKR+FKRT+LESSDYLKDDCL I C VGVV+S+TEGPK Y+I+ P S IG 
Sbjct  133  LKYRGSMWGYKRYFKRTLLESSDYLKDDCLSIKCVVGVVKSQTEGPKIYSITPPLSSIGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGK  DVNFEV+GE FAAHKLV++ARSPVFRAQLFGP+KD++   I VED+EA
Sbjct  193  QFGKLLESGKCADVNFEVDGEIFAAHKLVIAARSPVFRAQLFGPLKDKDTRCIKVEDIEA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPDM EL G NS WASTLMAQHLLAA+DRY LDRL+LLCEANLCED
Sbjct  253  PVFKALLHFMYWDNLPDMLELVGANSKWASTLMAQHLLAAADRYALDRLKLLCEANLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHCFQLK+ CL
Sbjct  313  IAINTVATTLALAEQHHCFQLKAACL  338



>ref|XP_009404705.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=417

 Score =   342 bits (878),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+S+YLKDDCL ++C VGVVRSRTEGPK Y I+VPP +I  
Sbjct  144  LKYRGSMWGYKRFFRRTALETSEYLKDDCLLVNCSVGVVRSRTEGPKVYTIAVPPPNIAQ  203

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFGQLLESG+GTD++FEV+GE F AHKLVL+ARSPVFRAQLFGPMKD N   I +EDMEA
Sbjct  204  HFGQLLESGRGTDISFEVDGEIFNAHKLVLAARSPVFRAQLFGPMKDSNTHCIKIEDMEA  263

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEE TG+N+  ASTLM+QHLLAA+D Y LDRL+LLCE  LCED
Sbjct  264  PVFKALLHFIYWDSLPDMEEFTGLNAKCASTLMSQHLLAAADCYALDRLKLLCEVKLCED  323

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLKSVCL
Sbjct  324  VAINTVATTLALAEQHHCIQLKSVCL  349



>ref|XP_008355456.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score =   342 bits (877),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S T+GPK Y+I +PPS +  
Sbjct  136  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTQGPKIYSIPIPPSSMXH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE+GKGTDV+FEV+ E F AHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLETGKGTDVSFEVDEEIFCAHKLVLAARSPVFRAQLFGPMKDQNTRCIKVEDIEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDMEELTG+NS  ASTLMAQHLLAA+DRYGLDRLRL+CEANLC+D
Sbjct  256  PVFKALLHFIYWDSLPDMEELTGINSNGASTLMAQHLLAAADRYGLDRLRLMCEANLCQD  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATTLALAEQHHC QLK VCL
Sbjct  316  VXINNVATTLALAEQHHCSQLKPVCL  341



>ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Prunus mume]
Length=357

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 181/204 (89%), Gaps = 1/204 (0%)
 Frame = +3

Query  9    YRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGLHF  188
            + G   GYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y+I VPPS +G  F
Sbjct  85   FLGCCRGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTEGPKIYSIPVPPSSMGHQF  144

Query  189  GQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEAPV  365
            G+LLESGKGTDVNFE++GE FAAHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EAPV
Sbjct  145  GRLLESGKGTDVNFEIDGEIFAAHKLVLAARSPVFRAQLFGPMKDQNTRCIKVEDIEAPV  204

Query  366  FKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVT  545
            FKALLHFIY D LPDMEELTG+NS  +STLMAQHLLAA+DRYGLDRLRLLCEANLC+DV 
Sbjct  205  FKALLHFIYWDSLPDMEELTGINSNGSSTLMAQHLLAAADRYGLDRLRLLCEANLCKDVA  264

Query  546  INTVATTLALAEQHHCFQLKSVCL  617
            INTVATTLALAEQHHCFQLK+VCL
Sbjct  265  INTVATTLALAEQHHCFQLKTVCL  288



>ref|XP_010545078.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Tarenaya hassleriana]
Length=534

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LE+SDYLK DCL +HC VGVVRSR EGP+ Y I +PPSDI  
Sbjct  260  LKYRGSMWGYKRFFKRSLLETSDYLKGDCLMVHCSVGVVRSRVEGPRVYYIEIPPSDICH  319

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKGTDV+FEV+GE FAAHKL+L+ARSPVFRAQLFGPMKD+N   I +ED+EA
Sbjct  320  DFGKLLESGKGTDVSFEVDGELFAAHKLILAARSPVFRAQLFGPMKDRNTHCITIEDIEA  379

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD++EL G+NS WA TLM+QHLLAA+DRYGL+RLRL C ANLC+D
Sbjct  380  PVFKALLHFIYWDSLPDLQELAGLNSKWALTLMSQHLLAAADRYGLERLRLQCMANLCDD  439

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQHHCFQLK+VCL
Sbjct  440  VTINTVATTLALAEQHHCFQLKNVCL  465



>ref|XP_004229460.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=407

 Score =   341 bits (875),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE+SDYLKDDCL I C VGVVRS  E PKT+++ VPPSDIGL
Sbjct  133  LKYRGSMWGYKRFFRRTLLETSDYLKDDCLLIQCTVGVVRSYNETPKTFSLPVPPSDIGL  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESG+G D+ FEV GE FAAHKLVL+ARSPV RAQLFGP+K++N+ SI VE+++A
Sbjct  193  HFGQLLESGEGADIKFEVEGEVFAAHKLVLAARSPVLRAQLFGPLKEENIQSIRVEEIQA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD++EL G+++ WA  LMAQHLLAA+D+YGL+RLR LCEA LCED
Sbjct  253  PVFKALLHFIYWDSLPDLQELVGLDTKWAVALMAQHLLAAADQYGLERLRALCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALA+QHHC QLKSVCL
Sbjct  313  VTINTVATTLALADQHHCVQLKSVCL  338



>ref|XP_010551778.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR +LE+SDYLKDDCL + CCVGVV+S TEGP++Y I V PSD+G 
Sbjct  131  LKYRGSMWGYKRFFKRNLLEASDYLKDDCLLVRCCVGVVKSHTEGPRSYKIHVSPSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGKG DV FEV+GE F+AHK+VL+ARSPVFRAQLFGP+KD+N   I +EDMEA
Sbjct  191  HFGKLLESGKGADVTFEVDGEAFSAHKVVLAARSPVFRAQLFGPLKDRNTQCIRIEDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM+EL G  S WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  251  PIFKVLLHFIYWDELPDMQELMGTESKWASTLVAQHLLAAADRYALERLRAICESKLCEG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+VCL
Sbjct  311  ISINTVATTLALAEQHHCFQLKAVCL  336



>ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
 gb|EOY05497.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
Length=410

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT++E+SDYL+DDCL I CCVGVV+S TEGPK ++I +PPS++G 
Sbjct  135  LKYRGSMWGYKRFFKRTLIETSDYLRDDCLSICCCVGVVKSYTEGPKIFSIVMPPSNLGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LL+SGKG DV FEV+GE F AHKLVL+ARSPVFRAQLFGP+KD+N   I VEDMEA
Sbjct  195  HFGRLLQSGKGADVKFEVDGEIFDAHKLVLAARSPVFRAQLFGPLKDRNTQCIRVEDMEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPDMEEL G  S WASTL+AQHLLAA+DRY ++RLRLLCEA LCE 
Sbjct  255  PIFKALLHFIYWDDLPDMEELVGSTSKWASTLVAQHLLAAADRYAIERLRLLCEAKLCES  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALAEQHHC  LK+VCL
Sbjct  315  VTINTVATTLALAEQHHCLHLKAVCL  340



>ref|XP_009621647.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=407

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT+LE+SDYLKDD L + C VGVVRS  E PKT+++ VPPSDIG+
Sbjct  133  LKYRGSMWGYKRFFRRTLLETSDYLKDDRLLVQCTVGVVRSYNETPKTFSLPVPPSDIGI  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESG+G D+ FEV GE FAAHKLVL+ARSPVFRAQLFGP+K+ N+ SI VE+++A
Sbjct  193  HFGQLLESGEGADIKFEVEGEVFAAHKLVLAARSPVFRAQLFGPLKEDNVQSIKVEEIQA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD++EL G+++ WA TLMAQHLLAA+D+YGL+RLR LCEA LCED
Sbjct  253  PVFKALLHFIYWDSLPDLQELVGLDTKWAVTLMAQHLLAAADQYGLERLRALCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALA+QHHC QLKSVCL
Sbjct  313  VTINTVATTLALADQHHCVQLKSVCL  338



>ref|XP_007144604.1| hypothetical protein PHAVU_007G169300g [Phaseolus vulgaris]
 gb|ESW16598.1| hypothetical protein PHAVU_007G169300g [Phaseolus vulgaris]
Length=411

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I + PS+IG 
Sbjct  137  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVKSHTEGPKIYKIPIMPSNIGQ  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGK +DV+FEVNGE FAAHKLVL+ARSPVFRAQLFGPMKD N   I VEDMEA
Sbjct  197  QFGKLLESGKDSDVSFEVNGEIFAAHKLVLAARSPVFRAQLFGPMKDHNTRCIKVEDMEA  256

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLH IY D LPDM ELTG++S  A+TLMAQHLLAA+DRYGL+R+RL+CE +LCED
Sbjct  257  PVFKALLHVIYWDSLPDMLELTGLSSKGATTLMAQHLLAAADRYGLERVRLMCETSLCED  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHCFQLK+VCL
Sbjct  317  VAINTVATTLALAEQHHCFQLKAVCL  342



>ref|XP_009347696.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=410

 Score =   339 bits (869),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S T+GPK Y+I +PPS +G 
Sbjct  136  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTQGPKIYSIPIPPSSMGH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE+GKGTDV+FEV+ E F AHKLVL+ARSPVFRAQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLETGKGTDVSFEVDEEIFCAHKLVLAARSPVFRAQLFGPMKDQNTRCIKVEDIEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LP +EELTG+NS  ASTLMAQHLLAA+DRYGLDRLR +CEANLC+D
Sbjct  256  PVFKALLHFIYWDSLPGIEELTGINSNGASTLMAQHLLAAADRYGLDRLRFMCEANLCQD  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATTLALAEQHHC QLK VCL
Sbjct  316  VAINNVATTLALAEQHHCSQLKPVCL  341



>ref|XP_004296996.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 [Fragaria 
vesca subsp. vesca]
Length=409

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 186/209 (89%), Gaps = 4/209 (2%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R++LE+SD++KDDCL I C VGVVR+ TEGPKTYAI+VPPS++G 
Sbjct  131  LKYRGSMWGYKRFFRRSLLETSDHIKDDCLIIRCRVGVVRTNTEGPKTYAIAVPPSNMGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFGQLLESGKGTDV+FEV+ E F+AHK+VL+ARSPVFRAQLFGP+KD+N   I VED+EA
Sbjct  191  HFGQLLESGKGTDVSFEVDQEVFSAHKVVLAARSPVFRAQLFGPLKDKNSCCIKVEDIEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWAS---TLMAQHLLAASDRYGLDRLRLLCEANL  530
            PVFK LLHFIY D LPDMEEL G++S WAS   TLMAQHLLAA+DRY L+RL++LCEA L
Sbjct  251  PVFKVLLHFIYWDALPDMEELLGLSSNWASAQTTLMAQHLLAAADRYALERLKVLCEAKL  310

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            CE+V IN VATTLALAEQHHCFQLK+VCL
Sbjct  311  CENVAINNVATTLALAEQHHCFQLKAVCL  339



>ref|XP_009356739.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Pyrus x bretschneideri]
Length=408

 Score =   338 bits (866),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S T+GPK Y+I +PPS +G 
Sbjct  136  LKYRGSMWGYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTQGPKIYSIPIPPSSMGH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE+GKGTD++FEV+ E F+AHKLVL+ARSPVF AQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLETGKGTDISFEVDEEIFSAHKLVLAARSPVFWAQLFGPMKDQNTRCIKVEDIEA  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS   STLMAQHLLAA+DRYGLDRLRL+CEANLC+D
Sbjct  256  PVFKALLHFIYWDSLPDIEELTGINSNGVSTLMAQHLLAAADRYGLDRLRLICEANLCQD  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATT+ALAEQHHC QLK VCL
Sbjct  316  VAINNVATTIALAEQHHCSQLKPVCL  341



>ref|XP_006339418.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006339419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Solanum tuberosum]
Length=407

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R +LE+SDYLKDDCL I C VGVVRS  E PKT+++ VPPSDIGL
Sbjct  133  LKYRGSMWGYKRFFRRALLETSDYLKDDCLLIQCTVGVVRSYNETPKTFSLPVPPSDIGL  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG LLESG+G D+ FEV GE FAAHKLVL+ARSPV RAQLFGP+K++N+ SI VE+++A
Sbjct  193  HFGMLLESGEGADIKFEVEGEVFAAHKLVLAARSPVLRAQLFGPLKEENVQSIRVEEIQA  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD++EL G+++ WA  LMAQHLLAA+D+YGL+RLR LCEA LCED
Sbjct  253  PVFKALLHFIYWDALPDLQELVGLDTKWAVALMAQHLLAAADQYGLERLRALCEAKLCED  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VTINTVATTLALA+QHHC QLKSVCL
Sbjct  313  VTINTVATTLALADQHHCVQLKSVCL  338



>ref|XP_009405868.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=369

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESS YLKDDCL ++C VGVVRS TEGPK Y I+VP S+I  
Sbjct  142  LKYRGSMWGYKRFFRRSALESSAYLKDDCLLVNCSVGVVRSHTEGPKIYTIAVPSSNITQ  201

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +FGQLL+SGKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDME 
Sbjct  202  NFGQLLDSGKGTDVSFEVDGEIFNAHKLVLAARSPVFRAQLFGPMKDRNMHCIKVEDMET  261

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LP +EEL G+N+  ASTLMAQHLLAA+DRY LDRL++LCE  LCED
Sbjct  262  PVFKALLHFIYWDSLPALEELAGLNTKCASTLMAQHLLAAADRYALDRLKILCEVKLCED  321

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLKSVCL
Sbjct  322  VAINTVATTLALAEQHHCSQLKSVCL  347



>ref|XP_009405866.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=416

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESS YLKDDCL ++C VGVVRS TEGPK Y I+VP S+I  
Sbjct  142  LKYRGSMWGYKRFFRRSALESSAYLKDDCLLVNCSVGVVRSHTEGPKIYTIAVPSSNITQ  201

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +FGQLL+SGKGTDV+FEV+GE F AHKLVL+ARSPVFRAQLFGPMKD+NM  I VEDME 
Sbjct  202  NFGQLLDSGKGTDVSFEVDGEIFNAHKLVLAARSPVFRAQLFGPMKDRNMHCIKVEDMET  261

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LP +EEL G+N+  ASTLMAQHLLAA+DRY LDRL++LCE  LCED
Sbjct  262  PVFKALLHFIYWDSLPALEELAGLNTKCASTLMAQHLLAAADRYALDRLKILCEVKLCED  321

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLKSVCL
Sbjct  322  VAINTVATTLALAEQHHCSQLKSVCL  347



>ref|XP_010695310.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Beta vulgaris subsp. vulgaris]
Length=407

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KRT LE SDYLKDDCL I C VGVV++ TEGPK Y I +PPSD+G 
Sbjct  132  LKYRGSMWGYKRFYKRTSLEQSDYLKDDCLLIRCIVGVVKTHTEGPKLYRIPLPPSDMGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FGQLLE+ KGTDVNFEV+GE F AHKLVL+ARSPVFRAQLFGPMK+++   + VED+EA
Sbjct  192  QFGQLLETKKGTDVNFEVDGEVFPAHKLVLAARSPVFRAQLFGPMKEKSTGCLKVEDIEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+EL G+NS  ASTLMAQHLLAA+DRYGL+RL++LCEA LCED
Sbjct  252  PVFKALLHFIYWDDLPDMQELAGLNSKGASTLMAQHLLAAADRYGLERLKVLCEATLCED  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATTLALAEQHHC  LKSVCL
Sbjct  312  VAINNVATTLALAEQHHCSHLKSVCL  337



>ref|XP_007222747.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica]
 gb|EMJ23946.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica]
Length=409

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 183/207 (88%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SD+LKDDCL I C VGVV++ TEGPK Y+I+VPPS+I  
Sbjct  133  LKYRGSMWGYKRFFKRTQLETSDFLKDDCLIIKCRVGVVKTNTEGPKIYSIAVPPSNISQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDV+FEV+ E F+AHK+VL+ARSPVFRAQLFGP+KD++   I VED+E 
Sbjct  193  HFGKLLESGKLTDVSFEVDREVFSAHKVVLAARSPVFRAQLFGPLKDKSTHCIKVEDIEV  252

Query  360  PVFKALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            PVFKALLHFIY D LPDM+EL G +NS WAST+MAQHLLAA+DRYGL+RLRLLCEA LCE
Sbjct  253  PVFKALLHFIYWDALPDMQELVGSLNSNWASTMMAQHLLAAADRYGLERLRLLCEAKLCE  312

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQHHCFQLK+VCL
Sbjct  313  NVAINNVATTLALAEQHHCFQLKAVCL  339



>ref|XP_008223027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Prunus 
mume]
Length=409

 Score =   333 bits (854),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 183/207 (88%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SD+LKDDCL I C VGVV++ TEGPK Y+I+VPPS+I  
Sbjct  133  LKYRGSMWGYKRFFKRTQLETSDFLKDDCLIIRCRVGVVKTNTEGPKIYSIAVPPSNISQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDV+FEV+ E F+AHK+VL+ARSPVFRAQLFGP+KD++   I VED+E 
Sbjct  193  HFGKLLESGKLTDVSFEVDREVFSAHKVVLAARSPVFRAQLFGPLKDKSTHCIKVEDIEV  252

Query  360  PVFKALLHFIYCDVLPDMEELT-GMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            PVFKALLHFIY D LPDM+EL  G+NS WAST+MAQHLLAA+DRYGL+RLRLLCEA LCE
Sbjct  253  PVFKALLHFIYWDALPDMQELVGGLNSNWASTMMAQHLLAAADRYGLERLRLLCEAKLCE  312

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQHHCFQLK+VCL
Sbjct  313  NVAINNVATTLALAEQHHCFQLKAVCL  339



>ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
 gb|ESQ49424.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
Length=406

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+CL + CCVGVV+SRTEGP++Y I VP SD+G 
Sbjct  131  LKYRGSMWGYKRFFKRSLLESSDYLKDNCLLVRCCVGVVKSRTEGPRSYNIPVPVSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLES KG DV F V+GETF AHKLVL+ARSPVFRAQLFGP+K+QN   IN+EDMEA
Sbjct  191  QFGKLLESRKGADVTFHVDGETFPAHKLVLAARSPVFRAQLFGPLKNQNTKYINIEDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM++L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  251  PIFKMLLHFIYWDELPDMQDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  311  ISINTVATTLALAEQHHCFQLKAACL  336



>emb|CDY08064.1| BnaC03g34590D [Brassica napus]
Length=407

 Score =   330 bits (847),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LESSDYLKD+CL + CCVGVV+S TEGP++Y I VP SD+G 
Sbjct  132  LKYRGSMWGYKRFFKRTLLESSDYLKDNCLLVRCCVGVVKSHTEGPRSYNIPVPVSDLGH  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG DV F+V+GETF AH LVL+ARSPVFRAQLFGP+K+QN   I++EDMEA
Sbjct  192  QFGKLLESGKGVDVTFQVDGETFPAHTLVLAARSPVFRAQLFGPLKNQNTKRIDIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDME++ G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  252  PIFKMFLHFIYWDELPDMEDIMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  312  ISINTVATTLALAEQHHCFQLKAACL  337



>ref|XP_009134877.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Brassica 
rapa]
 emb|CDY58342.1| BnaA03g57430D [Brassica napus]
Length=403

 Score =   330 bits (845),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LESSDYLKD+CL + CCVGVV+S TEGP++Y I VP SD+G 
Sbjct  128  LKYRGSMWGYKRFFKRTLLESSDYLKDNCLLVRCCVGVVKSHTEGPRSYNIPVPVSDLGH  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG DV F+V+GETF AH LVL+ARSPVFRAQLFGP+K+QN   I +EDMEA
Sbjct  188  QFGKLLESGKGVDVTFQVDGETFPAHTLVLAARSPVFRAQLFGPLKNQNTKRIEIEDMEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDME++ G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  248  PIFKMFLHFIYWDELPDMEDIMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  308  ISINTVATTLALAEQHHCFQLKAACL  333



>ref|XP_004495232.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Cicer arietinum]
Length=455

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 186/251 (74%), Gaps = 46/251 (18%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPKTY+I++ PS IG 
Sbjct  136  LKYRGSMWGYKRFFKRTALETSDYLKDDCLSVNCSVGVVKSHTEGPKTYSIAISPSSIGH  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE GKG+DV+FEVNGE FAAHKLVL+ARS VFRAQLFGPMKDQN   I VED+EA
Sbjct  196  QFGKLLEGGKGSDVSFEVNGEIFAAHKLVLAARSAVFRAQLFGPMKDQNTQCIKVEDIEA  255

Query  360  PVFK---------------------------------------------ALLHFIYCDVL  404
            PVFK                                             ALLH IY D L
Sbjct  256  PVFKVYINFLCASLLPLVLIYVCNTVVKYVPIILFVSVLIFTLHFMLFRALLHVIYWDSL  315

Query  405  PDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQ  584
            PDM+ELTG++S WA+TLM+QHLLAA+DRYGLDRLRL+CEA+LCEDV INTVATTLALAEQ
Sbjct  316  PDMQELTGLSSKWATTLMSQHLLAAADRYGLDRLRLMCEASLCEDVAINTVATTLALAEQ  375

Query  585  HHCFQLKSVCL  617
            HHCF+LK+VCL
Sbjct  376  HHCFRLKAVCL  386



>ref|XP_009356740.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=407

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRFFKRT LE+SDYLKDDCL ++C VGVV+S T+GPK Y+I +PPS +G 
Sbjct  136  LKYRGSM-GYKRFFKRTSLETSDYLKDDCLSVNCMVGVVKSHTQGPKIYSIPIPPSSMGH  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLE+GKGTD++FEV+ E F+AHKLVL+ARSPVF AQLFGPMKDQN   I VED+EA
Sbjct  195  QFGKLLETGKGTDISFEVDEEIFSAHKLVLAARSPVFWAQLFGPMKDQNTRCIKVEDIEA  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD+EELTG+NS   STLMAQHLLAA+DRYGLDRLRL+CEANLC+D
Sbjct  255  PVFKALLHFIYWDSLPDIEELTGINSNGVSTLMAQHLLAAADRYGLDRLRLICEANLCQD  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATT+ALAEQHHC QLK VCL
Sbjct  315  VAINNVATTIALAEQHHCSQLKPVCL  340



>gb|KFK38092.1| hypothetical protein AALP_AA3G068300 [Arabis alpina]
Length=406

 Score =   327 bits (839),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+CL + CCVGVV+SRTEGP++Y I VP SD+G 
Sbjct  131  LKYRGSMWGYKRFFKRSLLESSDYLKDNCLLVRCCVGVVKSRTEGPRSYNIPVPVSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LL+S +G D+ FEV+GETF AHKLVL+ARSPVFRAQLFGP+K+ N + INVED+EA
Sbjct  191  QFGKLLDSERGADITFEVDGETFPAHKLVLAARSPVFRAQLFGPLKNGNTTCINVEDIEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM++L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  251  PIFKMLLHFIYWDELPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTL LAEQHHCFQLK+ CL
Sbjct  311  ISINTVATTLTLAEQHHCFQLKAACL  336



>ref|XP_010524787.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR +L++SDY+KDDC+ + CCVGVV+SRTEGP +Y I VPPSD+G 
Sbjct  131  LKYRGSMWGYKRFFKRNLLDASDYVKDDCMLVRCCVGVVKSRTEGPMSYTIRVPPSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H G+LLESG G DV FEV GETF+AHKLV +ARSPVFRAQLFGP+KD+N   I ++DMEA
Sbjct  191  HLGKLLESGMGADVTFEVGGETFSAHKLVFAARSPVFRAQLFGPLKDRNTQCIKIDDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDME++ G +++WA+TL+AQHLLAA+DRY LDRLR +CE  L E 
Sbjct  251  PIFKVLLHFIYWDELPDMEKIMGTDALWATTLVAQHLLAAADRYALDRLRAICETKLREG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++IN+V TTLALAEQHHC QLK+VCL
Sbjct  311  LSINSVTTTLALAEQHHCLQLKAVCL  336



>ref|XP_010524788.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 
X2 [Tarenaya hassleriana]
Length=407

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR +L++SDY+KDDC+ + CCVGVV+SRTEGP +Y I VPPSD+G 
Sbjct  131  LKYRGSMWGYKRFFKRNLLDASDYVKDDCMLVRCCVGVVKSRTEGPMSYTIRVPPSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H G+LLESG G DV FEV GETF+AHKLV +ARSPVFRAQLFGP+KD+N   I ++DMEA
Sbjct  191  HLGKLLESGMGADVTFEVGGETFSAHKLVFAARSPVFRAQLFGPLKDRNTQCIKIDDMEA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDME++ G +++WA+TL+AQHLLAA+DRY LDRLR +CE  L E 
Sbjct  251  PIFKVLLHFIYWDELPDMEKIMGTDALWATTLVAQHLLAAADRYALDRLRAICETKLREG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++IN+V TTLALAEQHHC QLK+VCL
Sbjct  311  LSINSVTTTLALAEQHHCLQLKAVCL  336



>ref|XP_009339952.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=343

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KR++LE+SDYLKDDCL I C VGVV++ TEGPKTY I+ PPS+IG 
Sbjct  67   LKYRGSMWGYKRFYKRSLLEASDYLKDDCLIIKCRVGVVKTNTEGPKTYNIAEPPSNIGQ  126

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG+LLESGK TDV+F+V+ E FAAHK+VL+ARS VF+AQLFGP+KD+N  SI VED+EA
Sbjct  127  HFGKLLESGKLTDVSFKVDEEVFAAHKVVLAARSRVFKAQLFGPLKDKNTDSIIVEDIEA  186

Query  360  PVFKALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            PVFKALLHFIY D LPDM+EL G +NS W ST+MAQHLLAA+DRY L+RL+L+CEA LCE
Sbjct  187  PVFKALLHFIYWDSLPDMQELVGPLNSNWVSTMMAQHLLAAADRYALERLKLMCEAKLCE  246

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQH C QL++VCL
Sbjct  247  NVAINNVATTLALAEQHQCEQLRAVCL  273



>ref|XP_006297810.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
 gb|EOA30708.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
Length=407

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+ L + CCVGVV+SRTEGP++Y I VP SD+G 
Sbjct  132  LKYRGSMWGYKRFFKRSLLESSDYLKDNSLLVRCCVGVVKSRTEGPRSYNIPVPVSDLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLES KG D+ F+V+GETF AHKLVL+ARSPVFRAQLFGP++ +N   I +ED+EA
Sbjct  192  QFGKLLESEKGADITFDVDGETFPAHKLVLAARSPVFRAQLFGPLRSENTKCITIEDIEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM++L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  252  PIFKMLLHFIYWDELPDMQDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  312  ISINTVATTLALAEQHHCFQLKAACL  337



>emb|CDY24708.1| BnaA05g31070D [Brassica napus]
Length=403

 Score =   322 bits (826),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDYLKDDCL + CCVGVV+S TEGP++Y I VP SD+G 
Sbjct  128  LKYRGSMWGYKRFFKRTLLEESDYLKDDCLLVRCCVGVVKSSTEGPRSYNIPVPGSDLGY  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG++LESG+G DV   V+GETF AH++VL+ARSPVFRAQLFGP++++N   IN+ED+EA
Sbjct  188  QFGKVLESGRGADVALHVDGETFLAHRVVLAARSPVFRAQLFGPLRNKNTKRINIEDIEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDME+L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  248  PIFKMFLHFIYWDELPDMEDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  308  ISINTVATTLALAEQHHCFQLKAACL  333



>ref|XP_008340895.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KR++LE+SDYLKDDCL I C VGVV++ TEGPKTY I+ PPS+IG 
Sbjct  134  LKYRGSMWGYKRFYKRSLLEASDYLKDDCLIIKCRVGVVKTNTEGPKTYNIAEPPSNIGQ  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG+LLESGK TDV+F+V+ E FAAHK+VL+ARS VF+AQLFGP+KD+N  SI VED+EA
Sbjct  194  HFGKLLESGKLTDVSFKVDEEVFAAHKVVLAARSRVFKAQLFGPLKDKNTDSIIVEDIEA  253

Query  360  PVFKALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            PVFKALLHFIY D LPDM+EL G +NS W STLMAQHLLAA+DRY L+RL+LLCEA LCE
Sbjct  254  PVFKALLHFIYWDSLPDMQELVGPLNSNWVSTLMAQHLLAAADRYALERLKLLCEAKLCE  313

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQH C QL++VCL
Sbjct  314  NVAINNVATTLALAEQHQCEQLRAVCL  340



>dbj|BAJ97789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP SD+  
Sbjct  152  LKYRGSMWGYKRFFKRSGLETSDYLKDDCLLVNCTVGVVQSHTEGPKIYRIPVPQSDMSQ  211

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H G LL SGK TD+ FEV+ E F AHK++L+ARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  212  HIGHLLTSGKRTDIIFEVDEEMFPAHKVILAARSPVFRAQLFGPMKDKNMKCIKIEDMEA  271

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LP++EELTG+N+ W STLMAQHLLAA+DRY L+RL+LL E  LCED
Sbjct  272  PVFKALLHFMYWDELPNIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLSELKLCED  331

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC QLK+VCL
Sbjct  332  VAINTVANTLALAEQHHCHQLKTVCL  357



>ref|XP_009129652.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Brassica 
rapa]
Length=404

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LE SDYLKDDCL + CCVGVV+S TEGP++Y I VP SD+G 
Sbjct  129  LKYRGSMWGYKRFFKRTLLEESDYLKDDCLLVRCCVGVVKSSTEGPRSYNIPVPGSDLGY  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG++LESG+G DV   V+GETF AH++VL+ARSPVFRAQLFGP++++N   IN+ED+EA
Sbjct  189  QFGKVLESGRGADVALLVDGETFLAHRVVLAARSPVFRAQLFGPLRNKNTKRINIEDIEA  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDME+L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  249  PIFKMFLHFIYWDELPDMEDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  309  ISINTVATTLALAEQHHCFQLKAACL  334



>ref|XP_003562549.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Brachypodium distachyon]
Length=443

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP S++  
Sbjct  170  LKYRGSMWGYKRFFKRSGLETSDYLKDDCLLVNCTVGVVQSHTEGPKIYRIPVPQSNMSQ  229

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H G LL SGK TD+ FEV+GE F AHK+VL+ARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  230  HIGHLLTSGKRTDITFEVDGEMFPAHKVVLAARSPVFRAQLFGPMKDKNMKCIKIEDMEA  289

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LL E  LCE 
Sbjct  290  QVFKALLHFMYWDELPDIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLSELKLCEV  349

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  350  VAINTVANTLALAEQHHCYQLKTVCL  375



>ref|XP_008390810.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Malus 
domestica]
Length=410

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KR++LE SDYLKDDCL I C VGVV++ TEGPKTY I+ PPS+IG 
Sbjct  134  LKYRGSMWGYKRFYKRSLLEGSDYLKDDCLIIKCRVGVVKTNTEGPKTYNIAEPPSNIGQ  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDV+F+V+ E FAAHK+VL+ARSPVF+AQLFGP+KD+N   I VED+EA
Sbjct  194  HFGKLLESGKLTDVSFKVDEEVFAAHKVVLAARSPVFKAQLFGPLKDKNTDFIIVEDIEA  253

Query  360  PVFKALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            P FK LLHFIY D LPDM+EL G +NS WAST+MAQHLLAA+DRY L+RL+L+CEA LCE
Sbjct  254  PAFKVLLHFIYWDSLPDMQELVGLLNSSWASTVMAQHLLAAADRYALERLKLMCEAKLCE  313

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQH C QL++VCL
Sbjct  314  NVAINNVATTLALAEQHQCEQLRAVCL  340



>ref|XP_010695312.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Beta vulgaris subsp. vulgaris]
Length=405

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KRT LESSDYLKDDCL I   VGVV+S TEGPK Y I VPPS+IG 
Sbjct  129  LKYRGSMWGYKRFYKRTSLESSDYLKDDCLVISGTVGVVKSHTEGPKQYLIPVPPSNIGK  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FGQLLES   TDV+FEV+GE F AHK++L+ARSPVFRAQLFGPM+++ M  I VED+EA
Sbjct  189  QFGQLLESKDSTDVSFEVDGEVFTAHKVILAARSPVFRAQLFGPMREKKMDCIQVEDIEA  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHFIY D LPDM ELTG+N   ASTLMAQH+LAA+DRYGL+RL+LLCE  LCED
Sbjct  249  SVFKALLHFIYWDELPDMHELTGLNYNGASTLMAQHMLAAADRYGLERLKLLCETKLCED  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V IN VATTLALA+QH C QLK+ CL
Sbjct  309  VAINNVATTLALAQQHQCLQLKAECL  334



>emb|CDY05245.1| BnaC05g45580D [Brassica napus]
Length=396

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT+LESSDYLKD+CL + CCVGVV+S TEGP++Y I VP SD+G 
Sbjct  121  LKYRGSMWGYKRFFKRTLLESSDYLKDNCLLVRCCVGVVKSSTEGPRSYNIPVPVSDLGY  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG DV F V+GE F AH++VL+ARSPVFRAQLFGP++++N   IN+ED+EA
Sbjct  181  QFGKLLESGKGADVTFHVDGERFLAHRVVLAARSPVFRAQLFGPLRNKNTKRINIEDIEA  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDME L G +  WASTL+AQHLLAA+D Y L+RLR +CE+ LCE 
Sbjct  241  PIFKMFLHFIYWDELPDMEYLMGTDLKWASTLVAQHLLAAADCYALERLRTICESKLCEV  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  301  ISINTVATTLALAEQHHCFQLKAACL  326



>ref|XP_009124937.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Brassica rapa]
Length=389

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+CL + CCVG+V+SRTEGP++Y I VP S+ G 
Sbjct  114  LKYRGSMWGYKRFFKRSLLESSDYLKDNCLLVRCCVGLVKSRTEGPRSYNIPVPVSEFGR  173

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG++LESG+G DV F V+GETF AHKLVL+ARSPVFRAQ+FGP+K ++   I++EDMEA
Sbjct  174  QFGKVLESGRGADVTFRVDGETFPAHKLVLAARSPVFRAQIFGPLKSRDTECIDIEDMEA  233

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK  LHFIY D LPDM+++ G +  WA+TL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  234  PIFKMFLHFIYWDELPDMQDVMGTDLKWAATLVAQHLLAAADRYALERLRTICESQLCEG  293

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  294  ISINTVATTLALAEQHHCFQLKAACL  319



>ref|XP_010551779.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Tarenaya hassleriana]
Length=448

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 180/244 (74%), Gaps = 39/244 (16%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR +LE+SDYLKDDCL + CCVGVV+S TEGP++Y I V PSD+G 
Sbjct  131  LKYRGSMWGYKRFFKRNLLEASDYLKDDCLLVRCCVGVVKSHTEGPRSYKIHVSPSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGKG DV FEV+GE F+AHK+VL+ARSPVFRAQLFGP+KD+N   I +EDMEA
Sbjct  191  HFGKLLESGKGADVTFEVDGEAFSAHKVVLAARSPVFRAQLFGPLKDRNTQCIRIEDMEA  250

Query  360  PVF--------------------------------------KALLHFIYCDVLPDMEELT  425
            P+F                                      K LLHFIY D LPDM+EL 
Sbjct  251  PIFKVISLILFLWIFFYSRMFIPGSPPGALFLFTNFTLSRDKVLLHFIYWDELPDMQELM  310

Query  426  GMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLK  605
            G  S WASTL+AQHLLAA+DRY L+RLR +CE+ LCE ++INTVATTLALAEQHHCFQLK
Sbjct  311  GTESKWASTLVAQHLLAAADRYALERLRAICESKLCEGISINTVATTLALAEQHHCFQLK  370

Query  606  SVCL  617
            +VCL
Sbjct  371  AVCL  374



>ref|XP_002884563.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60822.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+ L + CCVGVV+SRTEGP+ Y I VP SD+G 
Sbjct  131  LKYRGSMWGYKRFFKRSLLESSDYLKDNGLLVRCCVGVVKSRTEGPRCYNIPVPVSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG DVNF+V+GETF AHKLVL+ARS V RAQLFGP++ +N   I +ED++A
Sbjct  191  QFGKLLESGKGADVNFKVDGETFPAHKLVLAARSAVLRAQLFGPLRSENTKCIIIEDIQA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM++L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  251  PIFKMLLHFIYWDELPDMQDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  311  ISINTVATTLALAEQHHCFQLKAACL  336



>ref|XP_004958540.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Setaria italica]
Length=425

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VPPS++  
Sbjct  152  LKYRGSMWGYKRFFKRSALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPPSNMAQ  211

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL SGK TD+ FEV+GE F AHK+VLSARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  212  HIGQLLTSGKRTDITFEVDGEMFPAHKVVLSARSPVFRAQLFGPMKDKNMKCIKIEDMEA  271

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  272  PVFKALLHFMYWDELPDIEELTGVNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  331

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  332  VAINTVANTLALAEQHHCYQLKTVCL  357



>ref|XP_009352133.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=410

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KR++LE SDYLKDDCL I C VGVV++ TEGPKTY I+ PPS+IG 
Sbjct  134  LKYRGSMWGYKRFYKRSLLEGSDYLKDDCLIIKCRVGVVKTNTEGPKTYNIAEPPSNIGQ  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG+LLESGK TDV+F+V+ E FAAHK+VL+ARSPVF+AQLFGP+KD+N   I VED+EA
Sbjct  194  HFGKLLESGKLTDVSFKVDEEVFAAHKVVLAARSPVFKAQLFGPLKDKNTDFIIVEDIEA  253

Query  360  PVFKALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            P FK LLHFIY D LPD++EL G +NS WAST+MAQHLLAA+DRY L+RL+L+CEA LCE
Sbjct  254  PAFKVLLHFIYWDSLPDLQELVGLLNSSWASTVMAQHLLAAADRYALERLKLMCEAKLCE  313

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            +V IN VATTLALAEQH C QL++VCL
Sbjct  314  NVAINNVATTLALAEQHQCEQLRAVCL  340



>ref|NP_566275.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
 sp|Q9M8J9.1|BPM2_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 2; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 2; Short=AtBPM2 
[Arabidopsis thaliana]
 gb|AAF30312.1|AC018907_12 unknown protein [Arabidopsis thaliana]
 gb|AAK76565.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14388.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74358.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
Length=406

 Score =   317 bits (812),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+ L + CCVGVV+SRTEGP+ Y I VP S +G 
Sbjct  131  LKYRGSMWGYKRFFKRSLLESSDYLKDNGLLVRCCVGVVKSRTEGPRCYNIPVPVSGLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLESGKG DV FEV+GETF AHKLVL+ARS VFRAQLFGP++ +N + I +ED++A
Sbjct  191  QFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENTNCIIIEDVQA  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D +PDM++L G +  WASTL+AQHLLAA+DRY L+RLR +CE+ LCE 
Sbjct  251  PIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEG  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  311  ISINTVATTLALAEQHHCFQLKAACL  336



>ref|XP_002463303.1| hypothetical protein SORBIDRAFT_02g041470 [Sorghum bicolor]
 gb|EER99824.1| hypothetical protein SORBIDRAFT_02g041470 [Sorghum bicolor]
Length=426

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP S++ L
Sbjct  153  LKYRGSMWGYKRFFKRTALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPRSNMAL  212

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL SGK TD+ FEV+GE F AHK++LSARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  213  HIGQLLTSGKRTDIAFEVDGEMFPAHKVILSARSPVFRAQLFGPMKDKNMKCIKIEDMEA  272

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  273  PVFKALLHFMYWDELPDIEELTGVNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  332

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  333  VAINTVANTLALAEQHHCYQLKTVCL  358



>gb|ACG38997.1| speckle-type POZ protein [Zea mays]
Length=422

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP S++ L
Sbjct  149  LKYRGSMWGYKRFFKRTALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPRSNMAL  208

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL SGK TD+ FEV+GE F AHK++LSARSPVFRAQLFGPMKD++M  I +EDMEA
Sbjct  209  HIGQLLTSGKRTDIAFEVDGEMFPAHKVILSARSPVFRAQLFGPMKDKDMKCIKIEDMEA  268

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  269  PVFKALLHFMYWDELPDIEELTGVNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  328

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  329  VAINTVANTLALAEQHHCYQLKTVCL  354



>ref|NP_001130519.1| speckle-type POZ protein [Zea mays]
 gb|ACF78765.1| unknown [Zea mays]
 gb|ACL52602.1| unknown [Zea mays]
 gb|ACR38478.1| unknown [Zea mays]
 tpg|DAA63939.1| TPA: speckle-type POZ protein [Zea mays]
 gb|AIB05424.1| orphans transcription factor, partial [Zea mays]
Length=422

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP S++ L
Sbjct  149  LKYRGSMWGYKRFFKRTALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPRSNMAL  208

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL SGK TD+ FEV+GE F AHK++LSARSPVFRAQLFGPMKD++M  I +EDMEA
Sbjct  209  HIGQLLTSGKRTDIAFEVDGEMFPAHKVILSARSPVFRAQLFGPMKDKDMKCIKIEDMEA  268

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  269  PVFKALLHFMYWDELPDIEELTGVNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  328

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  329  VAINTVANTLALAEQHHCYQLKTVCL  354



>ref|NP_001140355.1| hypothetical protein [Zea mays]
 gb|ACF83655.1| unknown [Zea mays]
 tpg|DAA41632.1| TPA: hypothetical protein ZEAMMB73_935561 [Zea mays]
 gb|AIB05408.1| orphans transcription factor, partial [Zea mays]
Length=426

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR  LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP S++ L
Sbjct  153  LKYRGSMWGYKRFFKRVALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPRSNMAL  212

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL SGK TD+ FEV+GE F AHK++LSARSPVFRAQLFGPMKD++M  I +EDMEA
Sbjct  213  HIGQLLTSGKRTDIAFEVDGEMFPAHKVILSARSPVFRAQLFGPMKDKDMKCIKIEDMEA  272

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  273  PVFKALLHFMYWDELPDLEELTGVNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  332

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  333  VAINTVANTLALAEQHHCYQLKTVCL  358



>ref|NP_001060495.1| Os07g0655300 [Oryza sativa Japonica Group]
 dbj|BAC20790.1| putative zinc finger POZ domain protein [Oryza sativa Japonica 
Group]
 dbj|BAF22409.1| Os07g0655300 [Oryza sativa Japonica Group]
 dbj|BAG93366.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67726.1| hypothetical protein OsJ_25406 [Oryza sativa Japonica Group]
Length=434

 Score =   313 bits (801),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VPPS++  
Sbjct  161  LKYRGSMWGYKRFFKRSALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPPSNMSQ  220

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL  GK TD+ FEV+GE F AHK+VL+ARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  221  HIGQLLTDGKRTDITFEVDGEVFPAHKVVLAARSPVFRAQLFGPMKDKNMKRITIEDMEA  280

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  281  SVFKALLHFMYWDELPDIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  340

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  341  VAINTVANTLALAEQHHCYQLKTVCL  366



>gb|EEC82594.1| hypothetical protein OsI_27153 [Oryza sativa Indica Group]
Length=434

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VPPS++  
Sbjct  161  LKYRGSMWGYKRFFKRSALETSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPPSNMSQ  220

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            H GQLL  GK TD+ FEV+GE F AHK+VL+ARSPVFRAQLFGPMKD+NM  I +EDMEA
Sbjct  221  HIGQLLMDGKRTDITFEVDGEVFPAHKVVLAARSPVFRAQLFGPMKDKNMKRITIEDMEA  280

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKALLHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCED
Sbjct  281  SVFKALLHFMYWDELPDIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCED  340

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVA TLALAEQHHC+QLK+VCL
Sbjct  341  VAINTVANTLALAEQHHCYQLKTVCL  366



>ref|XP_009120926.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Brassica rapa]
Length=400

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFK++ LESSDY+KD+ L + C VGVV+S TE  + Y I VP S++G 
Sbjct  125  LKYRGSMWGYKRFFKKSSLESSDYMKDNSLLVRCRVGVVKSCTEVQRNYNIPVPVSNLGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG LLESGKG DV F+V+GETF+AHKLVL+ARSPVFRAQLFGP++D+N   + +EDME+
Sbjct  185  QFGNLLESGKGCDVTFQVDGETFSAHKLVLAARSPVFRAQLFGPLRDRNTDRVEIEDMES  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM+EL G +S  ASTL+AQHLLAA+DRY L+RL+L+CE+ LCE 
Sbjct  245  PIFKVLLHFIYWDELPDMQELMGTDSKSASTLVAQHLLAAADRYALERLKLICESRLCEG  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +TINTVATTLALAEQHHCFQLK+VCL
Sbjct  305  ITINTVATTLALAEQHHCFQLKAVCL  330



>ref|XP_010436693.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 2-like [Camelina sativa]
Length=429

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 177/229 (77%), Gaps = 24/229 (10%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+ L + CCVGVV+SRTEGP++Y I VP SD+G 
Sbjct  131  LKYRGSMWGYKRFFKRSLLESSDYLKDNGLLVRCCVGVVKSRTEGPRSYNIHVPVSDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG+LLES KG DV F+V+GETF AHKLVL+ARSPVFRAQLFGP++ +N   I +ED+EA
Sbjct  191  QFGKLLESEKGADVTFDVDGETFPAHKLVLAARSPVFRAQLFGPLRSENTKCITIEDIEA  250

Query  360  PVF-----------------------KALLHFIYCDVLPDMEELTGMNSMWASTLMAQHL  470
            P+F                       K LLHFIY D LPDM++L G +  WASTL+AQHL
Sbjct  251  PIFKDILFTRPSPGVLLLFSNLLTRDKMLLHFIYWDELPDMQDLIGTDLKWASTLVAQHL  310

Query  471  LAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKSVCL  617
            LAA+DRY L+RLR +CE+ LCE ++INTVATTLALAEQHHCFQLK+ CL
Sbjct  311  LAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACL  359



>ref|XP_006400454.1| hypothetical protein EUTSA_v10013699mg [Eutrema salsugineum]
 gb|ESQ41907.1| hypothetical protein EUTSA_v10013699mg [Eutrema salsugineum]
Length=407

 Score =   308 bits (789),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLKD+ L + C VGVV+SRTEGP+ Y I VP S++G 
Sbjct  131  LKYRGSMWGYKRFFRRSSLESSDYLKDNSLLVRCRVGVVKSRTEGPRNYNIPVPVSNLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV FEV+GETFAAHKLVL+ RSPVFRAQLFGP++D+N   I +EDME+
Sbjct  191  QLGNLLESGKGCDVTFEVDGETFAAHKLVLATRSPVFRAQLFGPLRDRNTERIVIEDMES  250

Query  360  PVFKALLHFIYCDVLPDMEELT-GMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            P+FK LLHFIY D LPDM+EL  G++S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE
Sbjct  251  PIFKVLLHFIYWDELPDMQELMGGVDSQSASTLVAQHLLAAADRYALERLKAICESKLCE  310

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
             +   TVATTLALAEQHHCFQLK VCL
Sbjct  311  GIATKTVATTLALAEQHHCFQLKGVCL  337



>ref|XP_008353276.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=288

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +3

Query  15   GSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGLHFGQ  194
            G   GYKRF+KR++LE+SDYLKDDCL I C VGVV++ TEGPKTY I+ PPS+IG HFG+
Sbjct  16   GCCRGYKRFYKRSLLEASDYLKDDCLIIKCRVGVVKTNTEGPKTYNIAEPPSNIGQHFGK  75

Query  195  LLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEAPVFK  371
            LLESGK TDV+F+V+ E FAAHK+VL+ARS VF+AQLFGP+KD+N  SI VED+EAPVFK
Sbjct  76   LLESGKLTDVSFKVDEEVFAAHKVVLAARSRVFKAQLFGPLKDKNTDSIIVEDIEAPVFK  135

Query  372  ALLHFIYCDVLPDMEELTG-MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTI  548
            ALLHFIY D LPDM+EL G +NS W STLMAQHLLAA+DRY L+RL+LLCEA LCE+V I
Sbjct  136  ALLHFIYWDSLPDMQELVGPLNSNWVSTLMAQHLLAAADRYALERLKLLCEAKLCENVAI  195

Query  549  NTVATTLALAEQHHCFQLKSVCL  617
            N VATTLALAEQH C QL++VCL
Sbjct  196  NNVATTLALAEQHQCEQLRAVCL  218



>ref|XP_006658050.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Oryza brachyantha]
Length=268

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 171/200 (86%), Gaps = 1/200 (1%)
 Frame = +3

Query  21   MWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGLHFGQLL  200
            MWGYKRFFKR+ LESSDYLKDDCL ++C VGVV+S TEGPK Y I VPPS++  H GQLL
Sbjct  1    MWGYKRFFKRSALESSDYLKDDCLLVNCTVGVVQSHTEGPKIYTIPVPPSNMSKHIGQLL  60

Query  201  ESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEAPVFKAL  377
              GK TD+ FEV+GE F AHK+VL+ARSPVFRAQLFGPMKD+NM  I +EDMEA VFKAL
Sbjct  61   TDGKRTDITFEVDGEVFPAHKVVLAARSPVFRAQLFGPMKDKNMKRIAIEDMEASVFKAL  120

Query  378  LHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTV  557
            LHF+Y D LPD+EELTG+N+ W STLMAQHLLAA+DRY L+RL+LLCE  LCEDV INTV
Sbjct  121  LHFMYWDELPDIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLCELKLCEDVAINTV  180

Query  558  ATTLALAEQHHCFQLKSVCL  617
            A TLALAEQHHC+QLK+VCL
Sbjct  181  ANTLALAEQHHCYQLKTVCL  200



>gb|KFK26137.1| hypothetical protein AALP_AA8G208400 [Arabis alpina]
Length=399

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LESSDYLKD+ L + C VGVV+S TEGP++Y I VP SD+G 
Sbjct  124  LKYRGSMWGYKRFFRRTGLESSDYLKDNSLLVRCRVGVVKSHTEGPRSYNIPVPVSDLGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLE GKG DV F+V  ETF AHKLVL+ RSPVFRAQLFGP+ D+N   IN+EDME+
Sbjct  184  QLGNLLECGKGCDVTFKVGEETFPAHKLVLATRSPVFRAQLFGPLGDRNTQCINIEDMES  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM+EL G +S   STL+AQHLLAA+D Y L+RL+ +CE+ LCE 
Sbjct  244  PIFKVLLHFIYWDELPDMQELMGTDSKSGSTLVAQHLLAAADCYALERLKAICESKLCEG  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHCFQLK+VCL
Sbjct  304  IAINTVATTLALAEQHHCFQLKAVCL  329



>emb|CDY66705.1| BnaAnng22770D [Brassica napus]
Length=403

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDD L + C VGVV+S TEGP+ Y I+VP S++G 
Sbjct  128  LKYRGSMWGYKRFFRRDSLETSDYLKDDSLLVRCRVGVVKSCTEGPRDYNINVPVSNLGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV FEV+GETF+AHKLVL+ RS VFRAQLFGP++D++   I +ED+EA
Sbjct  188  QLGSLLESGKGCDVTFEVDGETFSAHKLVLATRSRVFRAQLFGPLRDRDTDRIEIEDVEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FK LLHFIY D LPDM+EL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE 
Sbjct  248  SIFKVLLHFIYWDELPDMQELIGTDSKSASTLVAQHLLAAADRYALERLKAICESKLCEG  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T+NTVATTLALAEQHHCFQLK VCL
Sbjct  308  ITVNTVATTLALAEQHHCFQLKEVCL  333



>gb|EMT06101.1| Speckle-type POZ protein-like protein [Aegilops tauschii]
Length=426

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +3

Query  27   GYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGLHFGQLLES  206
            GYKRFFKR+ LE+SDYLKDDCL ++C VGVV+S TEGPK Y I VP SD+  H G LL S
Sbjct  161  GYKRFFKRSGLETSDYLKDDCLLVNCTVGVVQSHTEGPKIYRIPVPQSDMSQHIGHLLTS  220

Query  207  GKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEAPVFKALLH  383
            GK TD+ FEV+ E F AHK+VL+ARSPVFRAQLFGPMKD+NM  I +EDMEAPVFKALLH
Sbjct  221  GKRTDITFEVDEEMFPAHKVVLAARSPVFRAQLFGPMKDKNMKCIKIEDMEAPVFKALLH  280

Query  384  FIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVAT  563
            F+Y D LP++EELTG+N+ W STLMAQHLLAA+DRY L+RL+LL E  LCEDV INTVA 
Sbjct  281  FMYWDELPNIEELTGLNTTWVSTLMAQHLLAAADRYALERLKLLSELKLCEDVAINTVAN  340

Query  564  TLALAEQHHCFQLKSVCL  617
            TLALAEQHHC QLK+VCL
Sbjct  341  TLALAEQHHCHQLKTVCL  358



>ref|XP_002871853.1| BTB-POZ and math domain 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48112.1| BTB-POZ and math domain 1 [Arabidopsis lyrata subsp. lyrata]
Length=407

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+++GETF AHKLVL+ RSPVF+AQLFGP+ D+N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQLDGETFNAHKLVLATRSPVFKAQLFGPLGDRNTKCITIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM+EL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE 
Sbjct  252  PIFKVLLHFIYWDELPDMQELMGTDSTLASTLVAQHLLAAADRYALERLKAICESKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V +NTVATTLALAEQHHCFQLK+VCL
Sbjct  312  VAVNTVATTLALAEQHHCFQLKAVCL  337



>ref|NP_197401.2| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
 sp|Q8L765.1|BPM1_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 1; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 1; Short=AtBPM1 
[Arabidopsis thaliana]
 gb|AAM97116.1| putative protein [Arabidopsis thaliana]
 gb|AAO00953.1| putative protein [Arabidopsis thaliana]
 gb|AED92637.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=407

 Score =   301 bits (772),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+GETF AHKLVL+ RSPVF AQLFGP+ D+N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNAQLFGPLGDRNTKCITIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDM+EL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE 
Sbjct  252  PIFKVLLHFIYWDELPDMQELIGTDSTLASTLVAQHLLAAADRYALERLKAICESKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V INTVATTLALAEQHHC QLK+VCL
Sbjct  312  VAINTVATTLALAEQHHCLQLKAVCL  337



>emb|CDP00137.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL +HC VGVVR+R EGPK Y ISVPPSD+G 
Sbjct  50   LKYRGSMWGYKRFFRRTSLETSDYLKDDCLAMHCTVGVVRTRVEGPKQYTISVPPSDMGQ  109

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSI-NVEDMEA  359
            +   LLES  G+D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D N  I  + D+E 
Sbjct  110  NLKYLLESEIGSDITFQVGDEAFKAHKLILAARSPVFRAQFFGLIGDPNKEIVELADIEP  169

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FK +LHFIY D LPD+ E+TG  SM  ST+M QHLLAA+DRYGLDRL+ LCEA LCE+
Sbjct  170  SIFKVMLHFIYSDDLPDLHEITGSTSMCTSTIMLQHLLAAADRYGLDRLKQLCEARLCEE  229

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+ +TVATTL+LAEQHHC QLK++CL
Sbjct  230  VSADTVATTLSLAEQHHCLQLKAICL  255



>ref|XP_006287870.1| hypothetical protein CARUB_v10001097mg [Capsella rubella]
 gb|EOA20768.1| hypothetical protein CARUB_v10001097mg [Capsella rubella]
Length=407

 Score =   300 bits (767),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+GETF AHKLVL+ RSPVF+AQLFGP+ D+N   I +EDM+A
Sbjct  192  QLGNLLESGKGCDVMFQVDGETFNAHKLVLATRSPVFKAQLFGPLGDRNTKCITIEDMQA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FK LLHFIY D LPDMEEL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE 
Sbjct  252  PIFKVLLHFIYWDELPDMEELMGADSTLASTLIAQHLLAAADRYALERLKAICELKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + +NTVATTLALAEQHHC QLK+VCL
Sbjct  312  IAVNTVATTLALAEQHHCSQLKAVCL  337



>ref|XP_009131717.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Brassica rapa]
Length=403

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDD L + C VGVV+S TEGP+ Y I+VP S++G 
Sbjct  128  LKYRGSMWGYKRFFRRDSLETSDYLKDDSLLVRCRVGVVKSCTEGPRDYNINVPVSNLGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
              G LLESGKG DV FEV+GETF+AHKLVL+ RS VFRAQLFGP++D++   I +ED+EA
Sbjct  188  QLGSLLESGKGCDVTFEVDGETFSAHKLVLATRSRVFRAQLFGPLRDRDTDGIEIEDVEA  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FK LLHFIY D LPDM+EL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE 
Sbjct  248  SIFKVLLHFIYWDELPDMQELIGTDSKSASTLVAQHLLAAADRYALERLKAICESKLCEG  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T+NTVATTLALAEQ HCFQLK+VCL
Sbjct  308  ITVNTVATTLALAEQLHCFQLKAVCL  333



>ref|XP_010454160.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Camelina sativa]
 ref|XP_010454161.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=407

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+GET+ AHKLVL+ RSPVF+AQLFGP+ + N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQVDGETYNAHKLVLATRSPVFKAQLFGPLGNPNTKCIMIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPDM+EL G ++  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE 
Sbjct  252  PIFKALLHFIYWDELPDMQELMGADTTLASTLVAQHLLAAADRYALERLKAICELKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHCFQLK+VCL
Sbjct  312  IAINTVATTLALAEQHHCFQLKAVCL  337



>emb|CDY18844.1| BnaAnng03090D [Brassica napus]
Length=429

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 177/246 (72%), Gaps = 41/246 (17%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR++LESSDYLKD+CL + CCVG+V+SRTEGP++Y I VP S+ G 
Sbjct  114  LKYRGSMWGYKRFFKRSLLESSDYLKDNCLLVRCCVGLVKSRTEGPRSYNIPVPVSEFGR  173

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG++LESG+G DV F V+GETF AHKLVL+ARSPVFRAQ+FGP+K ++   I++EDMEA
Sbjct  174  QFGKVLESGRGADVTFRVDGETFPAHKLVLAARSPVFRAQIFGPLKSRDTECIDIEDMEA  233

Query  360  PVFKA----------------------------------------LLHFIYCDVLPDMEE  419
            P+FK                                          LHFIY D LPDM++
Sbjct  234  PIFKVPPFNSLLLSWFIAFSLVRKMGTALILLIIHLFQILLTKHMFLHFIYWDELPDMQD  293

Query  420  LTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQ  599
            + G +  WA+TL+AQHLLAA+DRY L+RLR +CE+ LCE ++INTVATTLALAEQHHCFQ
Sbjct  294  VMGTDLKWAATLVAQHLLAAADRYALERLRTICESQLCEGISINTVATTLALAEQHHCFQ  353

Query  600  LKSVCL  617
            LK+ CL
Sbjct  354  LKAACL  359



>ref|XP_002961582.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
 ref|XP_002971221.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ27819.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ36842.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
Length=409

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R VLE+SD+LKDD L I C VGVV S  +  K +++ VP SDIG 
Sbjct  135  LKYRGSMWGYKRFFRRAVLETSDFLKDDSLSITCTVGVVVSSMQALKQHSLLVPESDIGQ  194

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HF  LLESG+GTDVNF V GE F+AHKL+L+ARSPVF+AQLFGPMKD+N   I ++DME 
Sbjct  195  HFLSLLESGEGTDVNFNVKGEAFSAHKLLLAARSPVFKAQLFGPMKDENGDVIEIDDMEP  254

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+LHFIY D LPD  E+TG +S   +T+MAQHLLAA+DR+ LDRLRLLCE+ LCE 
Sbjct  255  PVFKAMLHFIYKDSLPDTNEMTGSSSQSTATMMAQHLLAAADRFCLDRLRLLCESRLCEQ  314

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T++TVATTLALA+QHH  QLK+VCL
Sbjct  315  ITVDTVATTLALADQHHASQLKNVCL  340



>ref|XP_010420683.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Camelina sativa]
Length=407

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+ ETF AHKLVL+ RSPVF+AQLFGP+ + N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQVDEETFNAHKLVLATRSPVFKAQLFGPLGNPNTKCITIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPD++EL G +S  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE 
Sbjct  252  PIFKALLHFIYWDELPDLQELMGADSTLASTLVAQHLLAAADRYALERLKAICELKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHC QLK+VCL
Sbjct  312  IAINTVATTLALAEQHHCSQLKAVCL  337



>ref|XP_010496737.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Camelina sativa]
Length=407

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+ ET+ AHKLVL+ RSPVF+AQLFGP+ + N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQVDEETYNAHKLVLATRSPVFKAQLFGPLGNPNTKCITIEDMEA  251

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKALLHFIY D LPD++EL G ++  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE 
Sbjct  252  PIFKALLHFIYWDELPDLQELMGADTTLASTLVAQHLLAAADRYALERLKAICELKLCEG  311

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + INTVATTLALAEQHHC QLK+VCL
Sbjct  312  IAINTVATTLALAEQHHCLQLKAVCL  337



>emb|CDX92567.1| BnaA10g16060D [Brassica napus]
Length=439

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 176/245 (72%), Gaps = 40/245 (16%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFK++ LESSDY+KD+ L + C VGVV+S TEG + Y+I VP S++G 
Sbjct  125  LKYRGSMWGYKRFFKKSSLESSDYMKDNSLLVRCRVGVVKSCTEGQRNYSIPVPISNLGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG LLESGKG DV FEV GETF+AHKLVL+ARSPVFRAQLFGP++D+N   + ++DME+
Sbjct  185  QFGNLLESGKGCDVTFEVGGETFSAHKLVLAARSPVFRAQLFGPLRDRNTDRVEIDDMES  244

Query  360  PVF---------------------------------------KALLHFIYCDVLPDMEEL  422
            P+F                                       K LLHFIY D LPDM+EL
Sbjct  245  PIFKVLSLTLFLGLLLIFYSRMYHPGSSPGALLLLLSLLTQDKVLLHFIYWDELPDMQEL  304

Query  423  TGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQL  602
             G +S  ASTL+AQHLLAA+DRY L+RL+++CE+ LCE +TINTVATTLALAEQHHCFQL
Sbjct  305  MGTDSKSASTLVAQHLLAAADRYALERLKVICESRLCEGITINTVATTLALAEQHHCFQL  364

Query  603  KSVCL  617
            K+VCL
Sbjct  365  KAVCL  369



>emb|CBI31621.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD++KDDCL +HC VGVVR+R EGPK Y I +PPSDIG 
Sbjct  50   LKYRGSMWGYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQ  109

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + + NM  + VED+E 
Sbjct  110  SLKDLLESEVGCDITFQVADETFKAHKLILAARSPVFRAQFFGLVGNPNMDKVVVEDVEP  169

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+TG  S+  ST+M QHLLAA+DR+GLDRL+LLCE+ LC++
Sbjct  170  SIFKAMLLFIYSDKLPDVDEITGSASVCTSTIMVQHLLAAADRFGLDRLKLLCESKLCKE  229

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+  TVATTLALAEQH C QLK++CL
Sbjct  230  VSAETVATTLALAEQHRCPQLKAICL  255



>ref|XP_009120927.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X2 [Brassica rapa]
Length=439

 Score =   290 bits (743),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 175/245 (71%), Gaps = 40/245 (16%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFK++ LESSDY+KD+ L + C VGVV+S TE  + Y I VP S++G 
Sbjct  125  LKYRGSMWGYKRFFKKSSLESSDYMKDNSLLVRCRVGVVKSCTEVQRNYNIPVPVSNLGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG LLESGKG DV F+V+GETF+AHKLVL+ARSPVFRAQLFGP++D+N   + +EDME+
Sbjct  185  QFGNLLESGKGCDVTFQVDGETFSAHKLVLAARSPVFRAQLFGPLRDRNTDRVEIEDMES  244

Query  360  PVF---------------------------------------KALLHFIYCDVLPDMEEL  422
            P+F                                       K LLHFIY D LPDM+EL
Sbjct  245  PIFKVLSLILFLRLHLIFYSRMYHPGSSPGALLLLLSLLTQDKVLLHFIYWDELPDMQEL  304

Query  423  TGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQL  602
             G +S  ASTL+AQHLLAA+DRY L+RL+L+CE+ LCE +TINTVATTLALAEQHHCFQL
Sbjct  305  MGTDSKSASTLVAQHLLAAADRYALERLKLICESRLCEGITINTVATTLALAEQHHCFQL  364

Query  603  KSVCL  617
            K+VCL
Sbjct  365  KAVCL  369



>emb|CDX70860.1| BnaC03g09440D [Brassica napus]
Length=440

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 174/243 (72%), Gaps = 38/243 (16%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKD+ L + C VGVV+S TEGP+ Y ISVP S++G 
Sbjct  128  LKYRGSMWGYKRFFRRDSLETSDYLKDNSLLVRCRVGVVKSCTEGPRDYNISVPVSNLGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV FEV+GETF+AHKLVL+ RSPVFRAQLFGP++D++   I +ED+EA
Sbjct  188  QLGSLLESGKGCDVTFEVDGETFSAHKLVLATRSPVFRAQLFGPLRDRDTDRIEIEDVEA  247

Query  360  PVF-------------------------------------KALLHFIYCDVLPDMEELTG  428
            P+F                                     K LLHFIY D LPDM+EL G
Sbjct  248  PIFKVRPLILFLGFMMFCSRMYHPGSSPGALLLLSLLTRDKVLLHFIYWDELPDMQELIG  307

Query  429  MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKS  608
             +S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE +T+NTVATTLALAEQHHCFQLK+
Sbjct  308  TDSKSASTLVAQHLLAAADRYALERLKAICESKLCEGITVNTVATTLALAEQHHCFQLKA  367

Query  609  VCL  617
            VCL
Sbjct  368  VCL  370



>ref|XP_010658525.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Vitis vinifera]
Length=341

 Score =   286 bits (733),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD++KDDCL +HC VGVVR+R EGPK Y I +PPSDIG 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + + NM  + VED+E 
Sbjct  181  SLKDLLESEVGCDITFQVADETFKAHKLILAARSPVFRAQFFGLVGNPNMDKVVVEDVEP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+TG  S+  ST+M QHLLAA+DR+GLDRL+LLCE+ LC++
Sbjct  241  SIFKAMLLFIYSDKLPDVDEITGSASVCTSTIMVQHLLAAADRFGLDRLKLLCESKLCKE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+  TVATTLALAEQH C QLK++CL
Sbjct  301  VSAETVATTLALAEQHRCPQLKAICL  326



>ref|XP_002282536.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Vitis vinifera]
Length=406

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD++KDDCL +HC VGVVR+R EGPK Y I +PPSDIG 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + + NM  + VED+E 
Sbjct  181  SLKDLLESEVGCDITFQVADETFKAHKLILAARSPVFRAQFFGLVGNPNMDKVVVEDVEP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+TG  S+  ST+M QHLLAA+DR+GLDRL+LLCE+ LC++
Sbjct  241  SIFKAMLLFIYSDKLPDVDEITGSASVCTSTIMVQHLLAAADRFGLDRLKLLCESKLCKE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+  TVATTLALAEQH C QLK++CL
Sbjct  301  VSAETVATTLALAEQHRCPQLKAICL  326



>emb|CDY13941.1| BnaC09g38850D [Brassica napus]
Length=439

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 173/245 (71%), Gaps = 40/245 (16%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFK++ LESSDY+KD+ L + C VGVV+S TEG + Y I VP S++G 
Sbjct  125  LKYRGSMWGYKRFFKKSTLESSDYIKDNSLLVRCRVGVVKSCTEGQRNYNIPVPVSNLGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             FG LLESGKG DV FEV+ ETF+AHKLVL+ARSPVFRAQLFGP++D+N   I +EDME+
Sbjct  185  QFGNLLESGKGCDVTFEVDEETFSAHKLVLAARSPVFRAQLFGPLRDRNTDRIEIEDMES  244

Query  360  PVF---------------------------------------KALLHFIYCDVLPDMEEL  422
            P+F                                       K LLHFIY D LPDM+EL
Sbjct  245  PIFKVLSFWDCICLVWIFYSRMYHPGSSPGALLLLLSLLTQDKVLLHFIYWDELPDMQEL  304

Query  423  TGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQL  602
             G++S  ASTL+AQHLL  +DRY L+RL+++CE+ LCE +TINT ATTLALAEQHHCFQL
Sbjct  305  MGIDSKSASTLVAQHLLVVADRYALERLKVICESRLCEGITINTAATTLALAEQHHCFQL  364

Query  603  KSVCL  617
            K+VCL
Sbjct  365  KAVCL  369



>ref|XP_009409035.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=340

 Score =   282 bits (722),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL +HC VGVVR+R E P  +++SVP  D+G 
Sbjct  124  LKYRGSMWGYKRFYRRTALETSDYLKDDCLIMHCTVGVVRNRIETPTQFSVSVPSPDLGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LL+SG G+D+ F V  ETF AHK +L+ARSPVF AQ +G + + N+  ++VED+E 
Sbjct  184  CLKELLKSGIGSDIVFHVGDETFKAHKRILAARSPVFNAQFYGLVGNPNVDRVDVEDVEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D LPD+ ELTG  SM  ST+M QHLLAA+DRYGLDRLRLLCEA LCE 
Sbjct  244  PVFKAMLIFIYSDELPDVHELTGSISMCTSTIMIQHLLAAADRYGLDRLRLLCEAKLCEG  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVATTLALAEQH C QLK+VCL
Sbjct  304  ITADTVATTLALAEQHQCVQLKNVCL  329



>ref|XP_009797730.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana sylvestris]
Length=343

 Score =   282 bits (721),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+VLE+SDYLKDDCL +HC VGVVR+R EGPK Y++SVPPSD+G 
Sbjct  125  LKYRGSMWGYKRFFRRSVLETSDYLKDDCLSMHCTVGVVRTRVEGPKDYSVSVPPSDMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                +L++  G D++F V  ETF AHKL+L+ARSPVFR+Q FG + + N   + +ED+E 
Sbjct  185  SLKYVLDAELGCDIDFRVGEETFKAHKLILAARSPVFRSQFFGLVGNPNSDKVELEDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+LHFIY D LPD+ E+ G  S   ST+M QH+LAA+DR+GLDRL+ LCEA LCE+
Sbjct  245  SIFKAMLHFIYSDELPDLLEIAGSTSTCTSTIMMQHILAAADRFGLDRLKQLCEAKLCEE  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V + TVATTL+L+EQH C QLK++CL
Sbjct  305  VNVETVATTLSLSEQHQCLQLKAICL  330



>ref|XP_009621951.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X3 [Nicotiana tomentosiformis]
Length=342

 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+VLE+SDYLKDDCL + C VGVVR+R EGPK Y++SVPPSD+G 
Sbjct  125  LKYRGSMWGYKRFFRRSVLETSDYLKDDCLSMRCTVGVVRTRVEGPKDYSVSVPPSDMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                +L++  G D++F V  ETF AHKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  185  SLKYVLDAELGCDIDFRVGEETFKAHKLILAARSPVFRAQFFGLVGNPNSDKVELEDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+LHFIY D LPD+ E+ G  S   ST+M QH+LAA+DR+GLDRL+ LCEA LCE+
Sbjct  245  SIFKAMLHFIYSDELPDLLEIAGSTSTRTSTIMMQHILAAADRFGLDRLKQLCEAKLCEE  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+L+EQH C QLK++CL
Sbjct  305  VNVDTVATTLSLSEQHQCLQLKAICL  330



>ref|XP_002311186.2| hypothetical protein POPTR_0008s06000g [Populus trichocarpa]
 gb|EEE88553.2| hypothetical protein POPTR_0008s06000g [Populus trichocarpa]
Length=407

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL ++C VGVVR+R EGPK Y+ISVPPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTRLEGPKQYSISVPPSDMGW  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LLES  G D++F+V  ETF AHKL+L+ARSPVFRAQ FG + D NM  + V+D++ 
Sbjct  181  GFKELLESESGCDIDFQVGDETFRAHKLILAARSPVFRAQFFGLVGDPNMDKVVVKDVDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+TG  SM  ST M QHLLA SD Y LDRL+LLCEA LCE+
Sbjct  241  LIFKAMLLFIYTDKLPDAHEITGSTSMCTSTNMVQHLLAVSDLYNLDRLKLLCEAKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++   VATTLALAEQH C QLK++CL
Sbjct  301  LSAENVATTLALAEQHQCMQLKAICL  326



>ref|XP_009797729.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+VLE+SDYLKDDCL +HC VGVVR+R EGPK Y++SVPPSD+G 
Sbjct  125  LKYRGSMWGYKRFFRRSVLETSDYLKDDCLSMHCTVGVVRTRVEGPKDYSVSVPPSDMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                +L++  G D++F V  ETF AHKL+L+ARSPVFR+Q FG + + N   + +ED+E 
Sbjct  185  SLKYVLDAELGCDIDFRVGEETFKAHKLILAARSPVFRSQFFGLVGNPNSDKVELEDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+LHFIY D LPD+ E+ G  S   ST+M QH+LAA+DR+GLDRL+ LCEA LCE+
Sbjct  245  SIFKAMLHFIYSDELPDLLEIAGSTSTCTSTIMMQHILAAADRFGLDRLKQLCEAKLCEE  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V + TVATTL+L+EQH C QLK++CL
Sbjct  305  VNVETVATTLSLSEQHQCLQLKAICL  330



>ref|XP_009621950.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana tomentosiformis]
Length=343

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+VLE+SDYLKDDCL + C VGVVR+R EGPK Y++SVPPSD+G 
Sbjct  125  LKYRGSMWGYKRFFRRSVLETSDYLKDDCLSMRCTVGVVRTRVEGPKDYSVSVPPSDMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                +L++  G D++F V  ETF AHKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  185  SLKYVLDAELGCDIDFRVGEETFKAHKLILAARSPVFRAQFFGLVGNPNSDKVELEDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+LHFIY D LPD+ E+ G  S   ST+M QH+LAA+DR+GLDRL+ LCEA LCE+
Sbjct  245  SIFKAMLHFIYSDELPDLLEIAGSTSTRTSTIMMQHILAAADRFGLDRLKQLCEAKLCEE  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+L+EQH C QLK++CL
Sbjct  305  VNVDTVATTLSLSEQHQCLQLKAICL  330



>ref|NP_001190334.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
 gb|AED92638.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=442

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 169/241 (70%), Gaps = 36/241 (15%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+GETF AHKLVL+ RSPVF AQLFGP+ D+N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNAQLFGPLGDRNTKCITIEDMEA  251

Query  360  PVF-----------------------------------KALLHFIYCDVLPDMEELTGMN  434
            P+F                                   K LLHFIY D LPDM+EL G +
Sbjct  252  PIFKVLPLTLLLIVYSRMYHPGSSPGALLLFSSLLTRDKVLLHFIYWDELPDMQELIGTD  311

Query  435  SMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKSVC  614
            S  ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE V INTVATTLALAEQHHC QLK+VC
Sbjct  312  STLASTLVAQHLLAAADRYALERLKAICESKLCEGVAINTVATTLALAEQHHCLQLKAVC  371

Query  615  L  617
            L
Sbjct  372  L  372



>ref|XP_009621947.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621948.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621949.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+VLE+SDYLKDDCL + C VGVVR+R EGPK Y++SVPPSD+G 
Sbjct  125  LKYRGSMWGYKRFFRRSVLETSDYLKDDCLSMRCTVGVVRTRVEGPKDYSVSVPPSDMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                +L++  G D++F V  ETF AHKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  185  SLKYVLDAELGCDIDFRVGEETFKAHKLILAARSPVFRAQFFGLVGNPNSDKVELEDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+LHFIY D LPD+ E+ G  S   ST+M QH+LAA+DR+GLDRL+ LCEA LCE+
Sbjct  245  SIFKAMLHFIYSDELPDLLEIAGSTSTRTSTIMMQHILAAADRFGLDRLKQLCEAKLCEE  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+L+EQH C QLK++CL
Sbjct  305  VNVDTVATTLSLSEQHQCLQLKAICL  330



>ref|XP_009409034.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=405

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL +HC VGVVR+R E P  +++SVP  D+G 
Sbjct  124  LKYRGSMWGYKRFYRRTALETSDYLKDDCLIMHCTVGVVRNRIETPTQFSVSVPSPDLGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LL+SG G+D+ F V  ETF AHK +L+ARSPVF AQ +G + + N+  ++VED+E 
Sbjct  184  CLKELLKSGIGSDIVFHVGDETFKAHKRILAARSPVFNAQFYGLVGNPNVDRVDVEDVEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D LPD+ ELTG  SM  ST+M QHLLAA+DRYGLDRLRLLCEA LCE 
Sbjct  244  PVFKAMLIFIYSDELPDVHELTGSISMCTSTIMIQHLLAAADRYGLDRLRLLCEAKLCEG  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVATTLALAEQH C QLK+VCL
Sbjct  304  ITADTVATTLALAEQHQCVQLKNVCL  329



>ref|XP_011034402.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Populus euphratica]
Length=407

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL ++C VGVVR+R EGPK Y+ISVPPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTRLEGPKQYSISVPPSDMGW  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LLES  G D++F+V  ET+ AHKL+L+ARSPVFRAQ FG + D NM  + V+D++ 
Sbjct  181  GFKELLESESGCDIDFQVGDETYRAHKLILAARSPVFRAQFFGLVGDPNMDKVVVKDVDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+TG  SM  ST M QHLLA SD Y LDRL+LLCEA LCE+
Sbjct  241  LIFKAMLLFIYTDKLPDAHEITGSTSMCTSTNMVQHLLAVSDLYNLDRLKLLCEAKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +    VATTLALAEQH C QLK++CL
Sbjct  301  LNAENVATTLALAEQHQCMQLKAICL  326



>ref|XP_010256806.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Nelumbo nucifera]
Length=354

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD+LKDDCL +HC VGVVR+R EG K Y I +PPSD+G 
Sbjct  133  LKYRGSMWGYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLE+G G+D+ FEV  + F AHKL+L+ARSPVFRAQ FG + + N   + VED+E 
Sbjct  193  SLKELLETGLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFFGLIGNPNTDRVVVEDVEP  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LPD+ ELTG  S   ST+M QHLLAA+DR+GLDRL+LLCEA LCE+
Sbjct  253  SIFKAMLLFMYTDELPDVYELTGSISTCTSTIMVQHLLAAADRFGLDRLKLLCEAKLCEE  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V  +TV TTLALAEQHHC QLK +CL
Sbjct  313  VNADTVMTTLALAEQHHCSQLKMICL  338



>ref|XP_010256807.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X3 [Nelumbo nucifera]
Length=350

 Score =   280 bits (715),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD+LKDDCL +HC VGVVR+R EG K Y I +PPSD+G 
Sbjct  133  LKYRGSMWGYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLE+G G+D+ FEV  + F AHKL+L+ARSPVFRAQ FG + + N   + VED+E 
Sbjct  193  SLKELLETGLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFFGLIGNPNTDRVVVEDVEP  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LPD+ ELTG  S   ST+M QHLLAA+DR+GLDRL+LLCEA LCE+
Sbjct  253  SIFKAMLLFMYTDELPDVYELTGSISTCTSTIMVQHLLAAADRFGLDRLKLLCEAKLCEE  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V  +TV TTLALAEQHHC QLK +CL
Sbjct  313  VNADTVMTTLALAEQHHCSQLKMICL  338



>ref|XP_007009288.1| BTB/POZ/MATH-domains containing protein isoform 2 [Theobroma 
cacao]
 gb|EOY18098.1| BTB/POZ/MATH-domains containing protein isoform 2 [Theobroma 
cacao]
Length=335

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDY+KDDCL ++C VGVVR+R EGPK  +ISVPPS++G 
Sbjct  116  LKYRGSMWGYKRFFRRTTLETSDYIKDDCLIMNCTVGVVRTRLEGPKQCSISVPPSEMGQ  175

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D NM  + VED E 
Sbjct  176  NLKALLESEVGCDIIFQVVDEKFKAHKLILAARSPVFRAQFFGLVGDPNMDKVVVEDFEP  235

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+TG  SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  236  SIFKAMLLFIYTDKLPDVQEITGSTSMCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  295

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  296  LNADTVATTLALAEQHHCAQLKAICL  321



>ref|XP_009131718.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Brassica rapa]
Length=437

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 171/240 (71%), Gaps = 35/240 (15%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDD L + C VGVV+S TEGP+ Y I+VP S++G 
Sbjct  128  LKYRGSMWGYKRFFRRDSLETSDYLKDDSLLVRCRVGVVKSCTEGPRDYNINVPVSNLGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
              G LLESGKG DV FEV+GETF+AHKLVL+ RS VFRAQLFGP++D++   I +ED+EA
Sbjct  188  QLGSLLESGKGCDVTFEVDGETFSAHKLVLATRSRVFRAQLFGPLRDRDTDGIEIEDVEA  247

Query  360  PVF----------------------------------KALLHFIYCDVLPDMEELTGMNS  437
             +F                                  K LLHFIY D LPDM+EL G +S
Sbjct  248  SIFKVLIVVSYRMCLSRMYHPGSSPVTLLLLNLLTRDKVLLHFIYWDELPDMQELIGTDS  307

Query  438  MWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKSVCL  617
              ASTL+AQHLLAA+DRY L+RL+ +CE+ LCE +T+NTVATTLALAEQ HCFQLK+VCL
Sbjct  308  KSASTLVAQHLLAAADRYALERLKAICESKLCEGITVNTVATTLALAEQLHCFQLKAVCL  367



>ref|XP_010256804.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010256805.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Nelumbo nucifera]
Length=419

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD+LKDDCL +HC VGVVR+R EG K Y I +PPSD+G 
Sbjct  133  LKYRGSMWGYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQ  192

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLE+G G+D+ FEV  + F AHKL+L+ARSPVFRAQ FG + + N   + VED+E 
Sbjct  193  SLKELLETGLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFFGLIGNPNTDRVVVEDVEP  252

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LPD+ ELTG  S   ST+M QHLLAA+DR+GLDRL+LLCEA LCE+
Sbjct  253  SIFKAMLLFMYTDELPDVYELTGSISTCTSTIMVQHLLAAADRFGLDRLKLLCEAKLCEE  312

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V  +TV TTLALAEQHHC QLK +CL
Sbjct  313  VNADTVMTTLALAEQHHCSQLKMICL  338



>ref|XP_011002614.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Populus euphratica]
Length=408

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL ++C VGVVR+R EGPK Y+ISVPPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTRLEGPKQYSISVPPSDMGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + D  M  + V+D++ 
Sbjct  181  GLKELLESEAGCDIAFQVGDETFKAHKLILAARSPVFRAQFFGLVGDPKMDKVAVKDVDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+TG  SM  ST M QHLLA SD Y LDRL+LLCE+ LCE+
Sbjct  241  LIFKAMLLFIYTDKLPDVHEITGSTSMCTSTNMVQHLLAVSDLYNLDRLKLLCESKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++  TVATTLALAEQH C QLK++CL
Sbjct  301  LSAETVATTLALAEQHQCTQLKAICL  326



>gb|AEZ00903.1| putative protein binding, partial [Elaeis guineensis]
Length=311

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+  E P   +I VPP D+G 
Sbjct  63   LKYRGSMWGYKRFYRRTSLETSDYLKDDCLIMNCTVGVVRNHIETPTQLSIFVPPPDLGQ  122

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +L  SG G+D++FEV  ETF AHK +L+ARSPVF AQ FG + + N+  I VED+E 
Sbjct  123  CLKELFTSGIGSDIDFEVGDETFKAHKQILAARSPVFSAQFFGLIGNPNVDKIVVEDVEP  182

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKA+L FIY D LPD+ +LTG  SM  ST+M QHLLAA+DRYGL+RL+LLCEA LCE+
Sbjct  183  PIFKAMLLFIYSDELPDVHDLTGSVSMCTSTIMVQHLLAAADRYGLERLKLLCEAKLCEE  242

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VT +TVATTLALAEQH C QLK+VCL
Sbjct  243  VTADTVATTLALAEQHQCAQLKAVCL  268



>ref|XP_002976951.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
 ref|XP_002980693.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ18344.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ22061.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
Length=413

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 5/210 (2%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R VLE+SDYLKDD L I C VGVV S  +  +  ++ VP SDIG 
Sbjct  130  LKYRGSMWGYKRFFRRAVLETSDYLKDDSLSITCTVGVVVSSMQALRQQSLPVPESDIGR  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG LLESG+G+D+ FEV+GE F AHK+VL+ARSPVFRAQL GP+ D N+  + +ED++A
Sbjct  190  HFGALLESGEGSDITFEVDGEVFHAHKMVLAARSPVFRAQLNGPLSDSNVKLLQLEDIKA  249

Query  360  PVFKALLHFIYCDVLPD----MEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEAN  527
            PVF+A+L+FIY D LPD    +   +  ++  AST+MAQHLLAA+DRYGLDRLR++CEA 
Sbjct  250  PVFEAMLYFIYRDALPDASEVLSSSSYSSTSLASTMMAQHLLAAADRYGLDRLRIVCEAK  309

Query  528  LCEDVTINTVATTLALAEQHHCFQLKSVCL  617
            LCEDV+I+TVATTLALAEQHH  QLK VCL
Sbjct  310  LCEDVSIDTVATTLALAEQHHATQLKRVCL  339



>ref|XP_001783005.1| predicted protein [Physcomitrella patens]
 gb|EDQ52168.1| predicted protein [Physcomitrella patens]
Length=401

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R VLE+SD+LK+D L I C VGVV S T+GP+ Y+I VP  D+G 
Sbjct  125  LKYRGSMWGYKRFFRRAVLETSDFLKNDSLAITCTVGVVVSSTQGPRLYSIPVPEPDLGH  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            HFG LL+SG+G DV FEV+GE + AHKLVL+ARSPVF+AQLFGPM+D+N   I ++D+E 
Sbjct  185  HFGALLDSGEGADVKFEVDGELYHAHKLVLAARSPVFKAQLFGPMRDRNSDHIEIKDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD +EL G  S   STL+AQHLLAA+DRYGLDRLRLLCE+ LCE+
Sbjct  245  PVFKALLHFIYRDSLPDTKELIGAPS--TSTLLAQHLLAAADRYGLDRLRLLCESKLCEN  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+++TVATTLALAE HH  +LK+VCL
Sbjct  303  VSVDTVATTLALAEHHHAAELKAVCL  328



>ref|XP_007009287.1| BTB/POZ/MATH-domains containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY18097.1| BTB/POZ/MATH-domains containing protein isoform 1 [Theobroma 
cacao]
Length=402

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDY+KDDCL ++C VGVVR+R EGPK  +ISVPPS++G 
Sbjct  116  LKYRGSMWGYKRFFRRTTLETSDYIKDDCLIMNCTVGVVRTRLEGPKQCSISVPPSEMGQ  175

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D NM  + VED E 
Sbjct  176  NLKALLESEVGCDIIFQVVDEKFKAHKLILAARSPVFRAQFFGLVGDPNMDKVVVEDFEP  235

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+TG  SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  236  SIFKAMLLFIYTDKLPDVQEITGSTSMCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  295

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  296  LNADTVATTLALAEQHHCAQLKAICL  321



>ref|XP_001772248.1| predicted protein [Physcomitrella patens]
 gb|EDQ62901.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R VLE+SD+LK+D L I C VGVV S T+GP+ Y+I VP  D+G 
Sbjct  126  LKYRGSMWGYKRFFRRAVLETSDFLKNDSLAITCTVGVVVSSTQGPRMYSIPVPELDLGE  185

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG LL+SG+GTDV  EV+GE + AHKLVL+ARSPVF+AQLFGPM+D++  +I ++D+E 
Sbjct  186  HFGALLDSGEGTDVTLEVDGELYHAHKLVLAARSPVFQAQLFGPMRDRSSGNIEIKDIEP  245

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPDM+EL G  S   S L+AQHLLAA+DRYGLDRLRLLCE+ LCE+
Sbjct  246  PVFKALLHFIYRDSLPDMKELAGAPS--TSILLAQHLLAAADRYGLDRLRLLCESKLCEN  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+++TVATTLALAEQHH  +LK+VCL
Sbjct  304  VSVDTVATTLALAEQHHAAELKAVCL  329



>ref|XP_002316266.1| hypothetical protein POPTR_0010s20670g [Populus trichocarpa]
 gb|EEF02437.1| hypothetical protein POPTR_0010s20670g [Populus trichocarpa]
Length=408

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL ++C VGVVR+  EGPK Y+ISVPPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTHLEGPKQYSISVPPSDMGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + D  M  + V+D++ 
Sbjct  181  GLKELLESEAGCDIAFQVGDETFKAHKLILAARSPVFRAQFFGLVGDPKMDKVAVKDVDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+TG  SM  ST M QHLLA SD Y LDRL+LLCE+ LCE+
Sbjct  241  LIFKAMLLFIYTDKLPDVHEITGSTSMCTSTNMVQHLLAVSDLYNLDRLKLLCESKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++  TVATTLALAEQH C QLK++CL
Sbjct  301  LSAETVATTLALAEQHQCMQLKAICL  326



>ref|XP_001776409.1| predicted protein [Physcomitrella patens]
 gb|EDQ58793.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R V+E+SD+LK+D L I C VGVV S T+GP+ Y+I VP  D+G 
Sbjct  120  LKYRGSMWGYKRFFRRAVMETSDFLKNDSLAITCTVGVVVSSTQGPRLYSIPVPEPDLGQ  179

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            HFG LL+SG+G DV FEV+GE + AHK+VL+ARSPVF+AQLFGPM+D+N  +I +ED+E 
Sbjct  180  HFGALLDSGEGADVTFEVDGEVYQAHKMVLAARSPVFKAQLFGPMRDRNSGNIEIEDVEP  239

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKALLHFIY D LPD +EL  + +   S L+AQHLLAA+DRYGLDRLRLLCE+ LCE+
Sbjct  240  PVFKALLHFIYRDSLPDTKEL--IRAPSTSILLAQHLLAAADRYGLDRLRLLCESKLCEN  297

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+++TVATTLALAEQHH  +LK+VCL
Sbjct  298  VSVDTVATTLALAEQHHAAELKAVCL  323



>ref|XP_008785535.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Phoenix dactylifera]
Length=411

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+  E P   +ISVPP D+G 
Sbjct  131  LKYRGSMWGYKRFYRRTSLETSDYLKDDCLIMNCTVGVVRNHIETPTQLSISVPPPDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +L  SG G+D++FEV  ETF AHK +L+ARSPVF AQ FG + + N+  I VED+E 
Sbjct  191  CLKELFISGIGSDIDFEVGDETFKAHKQILAARSPVFSAQFFGLIGNPNVDKIVVEDVEP  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKA+L FIY D LPD+ +LTG  SM  ST+M QHLLAA+DRYGL+RL+LLCEA LCE+
Sbjct  251  PIFKAMLLFIYSDELPDVHDLTGSVSMCTSTIMVQHLLAAADRYGLERLKLLCEAKLCEE  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VT +TVATTLALAEQH C QLK+VCL
Sbjct  311  VTADTVATTLALAEQHQCAQLKAVCL  336



>gb|KJB67619.1| hypothetical protein B456_010G200500 [Gossypium raimondii]
Length=353

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I VPPSD+G 
Sbjct  124  LKYRGSMWGYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  ETF AHKL+L+ARSPVF+AQ FG + D N+  I V+D E 
Sbjct  184  NLRALLESEVGCDIMFQVGDETFKAHKLILAARSPVFKAQFFGLVGDPNLDKIVVKDFEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+    SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  244  SIFKAMLLFIYTDKLPDVQEIVDSTSMCTSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  304  LNADTVATTLALAEQHHCAQLKAICL  329



>gb|KJB67618.1| hypothetical protein B456_010G200500 [Gossypium raimondii]
Length=352

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I VPPSD+G 
Sbjct  124  LKYRGSMWGYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  ETF AHKL+L+ARSPVF+AQ FG + D N+  I V+D E 
Sbjct  184  NLRALLESEVGCDIMFQVGDETFKAHKLILAARSPVFKAQFFGLVGDPNLDKIVVKDFEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+    SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  244  SIFKAMLLFIYTDKLPDVQEIVDSTSMCTSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  304  LNADTVATTLALAEQHHCAQLKAICL  329



>ref|XP_002970063.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
 ref|XP_002985255.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ13749.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ29187.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
Length=405

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE SDYL +D L I C VGVV S T+  K Y+I  P  DIG 
Sbjct  129  LKYRGSMWGYKRFFRREALEMSDYLNNDSLDITCTVGVVMSWTQVTKIYSIQPPEQDIGK  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSI-NVEDMEA  359
            HFG L ESG+G D+ F+ +GETF AHKLVL+ARSPVF+AQL GP++++   +  VED+ A
Sbjct  189  HFGALFESGEGADLTFDADGETFKAHKLVLAARSPVFKAQLMGPLRERTSDVLRVEDILA  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L F+Y D LPD  EL+G++S  + TL+ QHLLAA+DRYGLDRLRLLCEA LCE 
Sbjct  249  PVFKAMLQFMYTDALPDTAELSGVSSSSSPTLLYQHLLAAADRYGLDRLRLLCEAKLCET  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+++TVATTLALAE HH  QLK VCL
Sbjct  309  VSVDTVATTLALAELHHASQLKGVCL  334



>ref|XP_002524218.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF38142.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=408

 Score =   276 bits (706),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDY+KDDCL ++C VGVVR+R EGPK Y+IS+PPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLENSDYIKDDCLIMNCTVGVVRTRLEGPKQYSISLPPSDMGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG + D N+  + VED++ 
Sbjct  181  GLKELLESEVGCDIVFQVGDETFKAHKLILAARSPVFRAQFFGLVGDPNLDKVVVEDIDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LP++ E+TG  SM  ST M QHLLAA+D Y LD+L+LLCE+ LCE+
Sbjct  241  SIFKAMLLFIYTDKLPNVHEITGTTSMCTSTNMVQHLLAAADLYNLDQLKLLCESKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++  TVATTLALAEQH C QLK VCL
Sbjct  301  LSAETVATTLALAEQHQCSQLKVVCL  326



>ref|XP_010923233.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Elaeis guineensis]
Length=411

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+  E P   +I VPP D+G 
Sbjct  131  LKYRGSMWGYKRFYRRTSLETSDYLKDDCLIMNCTVGVVRNHIETPTQLSIFVPPPDLGQ  190

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +L  SG G+D++FEV  ETF AHK +L+ARSPVF AQ FG + + N+  I VED+E 
Sbjct  191  CLKELFTSGIGSDIDFEVGDETFKAHKQILAARSPVFSAQFFGLIGNPNVDKIVVEDVEP  250

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            P+FKA+L FIY D LPD+ +LTG  SM  ST+M QHLLAA+DRYGL+RL+LLCEA LCE+
Sbjct  251  PIFKAMLLFIYSDELPDVHDLTGSVSMCTSTIMVQHLLAAADRYGLERLKLLCEAKLCEE  310

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            VT +TVATTLALAEQH C QLK+VCL
Sbjct  311  VTADTVATTLALAEQHQCAQLKAVCL  336



>ref|XP_006657384.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Oryza brachyantha]
Length=400

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R++LESSD+LKDDCL ++C VGVV++R E PK   I +PPSD+G 
Sbjct  120  LKYRGSMWGYKRFYRRSLLESSDFLKDDCLVMNCTVGVVKNRLETPKNIQIHIPPSDMGR  179

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  LL  G G D+ FEV  +T  AHK +L+ARSPVF+AQ FGP+ + ++ S+ VED+E 
Sbjct  180  CFKNLLNLGIGCDITFEVGDDTVQAHKWILAARSPVFKAQFFGPIGNPDLHSVTVEDVEP  239

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  S W ST++ QHLLAA+DRYGLDRLRLLCE  LC++
Sbjct  240  VVFKAMVNFIYSDELPSIHELAGSVSTWTSTVVVQHLLAAADRYGLDRLRLLCEEKLCDE  299

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  300  LTAETVATTLALAEQHHCTQLKSACL  325



>gb|EMT28091.1| Speckle-type POZ protein-like protein A [Aegilops tauschii]
Length=324

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SD+LKDDCL ++C VGVV++R E PK   I+VPPSDIG 
Sbjct  82   LKYRGSMWGYKRFYRRTQLEASDFLKDDCLVMNCTVGVVKNRLETPKNIQINVPPSDIGR  141

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F +L E   G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   +M  + VED+E 
Sbjct  142  CFKELFELHIGCDITFEVGDEKVQAHKWILAARSPVFKAQFFGPIGKPDMDRVVVEDVEP  201

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + E+ G  SMW ST + QHLLAA+DRYGLDRLR+LCEA LC++
Sbjct  202  IVFKAMVNFIYSDELPSIHEVAGSFSMWTSTAVTQHLLAAADRYGLDRLRILCEAKLCDE  261

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  262  LTSETVATTLALAEQHHCAQLKSACL  287



>gb|KJB67617.1| hypothetical protein B456_010G200500 [Gossypium raimondii]
Length=410

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I VPPSD+G 
Sbjct  124  LKYRGSMWGYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  ETF AHKL+L+ARSPVF+AQ FG + D N+  I V+D E 
Sbjct  184  NLRALLESEVGCDIMFQVGDETFKAHKLILAARSPVFKAQFFGLVGDPNLDKIVVKDFEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+    SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  244  SIFKAMLLFIYTDKLPDVQEIVDSTSMCTSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  304  LNADTVATTLALAEQHHCAQLKAICL  329



>ref|XP_010937554.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Elaeis guineensis]
Length=353

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+R E  + ++I VPP D+G 
Sbjct  136  LKYRGSMWGYKRFYRRTALETSDYLKDDCLVMNCTVGVVRNRIETSRQFSIPVPPPDMGK  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLESG G+D+ FEV  ETF AHK +L+ARSPVF AQ FG + D  M  + V+D+E 
Sbjct  196  CLKELLESGMGSDIVFEVGDETFKAHKQILAARSPVFNAQFFGLIGDPKMDRVVVQDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D  PD+ ELTG  S+  ST++ QHLLAA+DRYGLDRLR LCE+ LCE+
Sbjct  256  PVFKAMLLFIYSDEFPDVHELTGSVSLCTSTILVQHLLAAADRYGLDRLRKLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVA TLALAEQH C  LKSVCL
Sbjct  316  LTADTVAATLALAEQHQCSHLKSVCL  341



>gb|KHG28259.1| BTB/POZ and MATH domain-containing 3 -like protein [Gossypium 
arboreum]
Length=410

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I VPPSD+G 
Sbjct  124  LKYRGSMWGYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  ETF AHKL+L+ARSPVF+AQ FG + D N+  I V+D E 
Sbjct  184  NLRALLESEVGCDIMFQVGDETFKAHKLILAARSPVFKAQFFGLVGDPNLDKIVVKDFEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+    SM  ST M QHLLAA+D Y LDRL++LCEA LCE+
Sbjct  244  SIFKAMLLFIYTDKLPDVQEIVDSTSMCTSTNMVQHLLAAADLYNLDRLKVLCEAKLCEE  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  304  LNADTVATTLALAEQHHCAQLKAICL  329



>ref|XP_010937555.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X3 [Elaeis guineensis]
Length=352

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+R E  + ++I VPP D+G 
Sbjct  136  LKYRGSMWGYKRFYRRTALETSDYLKDDCLVMNCTVGVVRNRIETSRQFSIPVPPPDMGK  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLESG G+D+ FEV  ETF AHK +L+ARSPVF AQ FG + D  M  + V+D+E 
Sbjct  196  CLKELLESGMGSDIVFEVGDETFKAHKQILAARSPVFNAQFFGLIGDPKMDRVVVQDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D  PD+ ELTG  S+  ST++ QHLLAA+DRYGLDRLR LCE+ LCE+
Sbjct  256  PVFKAMLLFIYSDEFPDVHELTGSVSLCTSTILVQHLLAAADRYGLDRLRKLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVA TLALAEQH C  LKSVCL
Sbjct  316  LTADTVAATLALAEQHQCSHLKSVCL  341



>ref|XP_006846362.1| hypothetical protein AMTR_s00012p00261580 [Amborella trichopoda]
 gb|ERN08037.1| hypothetical protein AMTR_s00012p00261580 [Amborella trichopoda]
Length=390

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 164/206 (80%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LE+SDYLKDDCL + C VGVVR+R EG   Y+I VPPSD+G 
Sbjct  118  LKYRGSMWGYKRFFRRSALEASDYLKDDCLAMRCTVGVVRNRFEGIMQYSIYVPPSDMGQ  177

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LL++G  +DV FEV GETF AHKLVL+ RSPVF+AQ FG + D N+  I +E +E 
Sbjct  178  CFKELLDTGSASDVVFEVCGETFKAHKLVLATRSPVFKAQFFGLVGDPNIDKIEIEGIEP  237

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+LHFIY D LPD+ E    +S ++ T MAQHLLAA+DRYGLDRL+L+CEA LCE+
Sbjct  238  AVFKAMLHFIYSDTLPDLPE---SSSTYSWTPMAQHLLAAADRYGLDRLKLVCEARLCEE  294

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V+ ++VATTLALAE++HC QLK VCL
Sbjct  295  VSTDSVATTLALAERYHCKQLKDVCL  320



>dbj|BAJ94248.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99354.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SD+LKDDCL ++C VGVV++R E PK   I+VPPSDIG 
Sbjct  116  LKYRGSMWGYKRFYRRTQLEASDFLKDDCLVMNCTVGVVKNRLETPKNIQINVPPSDIGR  175

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +F +LL+   G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++  + VED+E 
Sbjct  176  YFKELLKLHIGCDITFEVGDEKVQAHKWILAARSPVFKAQFFGPIGKPDLDRVVVEDVEP  235

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + E+ G  SMW ST + QHLLAA+DRYGLDRLR+LCEA LC++
Sbjct  236  IVFKAMVNFIYSDELPSIHEVAGSFSMWTSTAVTQHLLAAADRYGLDRLRILCEAKLCDE  295

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  296  LTSETVATTLALAEQHHCAQLKSACL  321



>ref|XP_010420684.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X2 [Camelina sativa]
Length=447

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 168/246 (68%), Gaps = 41/246 (17%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+ ETF AHKLVL+ RSPVF+AQLFGP+ + N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQVDEETFNAHKLVLATRSPVFKAQLFGPLGNPNTKCITIEDMEA  251

Query  360  PVF----------------------------------------KALLHFIYCDVLPDMEE  419
            P+F                                        KALLHFIY D LPD++E
Sbjct  252  PIFKVLPLTLLMVVSYRIVYSRMYHPGSSPGALLLFSSLLTRDKALLHFIYWDELPDLQE  311

Query  420  LTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQ  599
            L G +S  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE + INTVATTLALAEQHHC Q
Sbjct  312  LMGADSTLASTLVAQHLLAAADRYALERLKAICELKLCEGIAINTVATTLALAEQHHCSQ  371

Query  600  LKSVCL  617
            LK+VCL
Sbjct  372  LKAVCL  377



>ref|XP_010937553.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Elaeis guineensis]
Length=417

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+SDYLKDDCL ++C VGVVR+R E  + ++I VPP D+G 
Sbjct  136  LKYRGSMWGYKRFYRRTALETSDYLKDDCLVMNCTVGVVRNRIETSRQFSIPVPPPDMGK  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLESG G+D+ FEV  ETF AHK +L+ARSPVF AQ FG + D  M  + V+D+E 
Sbjct  196  CLKELLESGMGSDIVFEVGDETFKAHKQILAARSPVFNAQFFGLIGDPKMDRVVVQDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D  PD+ ELTG  S+  ST++ QHLLAA+DRYGLDRLR LCE+ LCE+
Sbjct  256  PVFKAMLLFIYSDEFPDVHELTGSVSLCTSTILVQHLLAAADRYGLDRLRKLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVA TLALAEQH C  LKSVCL
Sbjct  316  LTADTVAATLALAEQHQCSHLKSVCL  341



>ref|XP_010496738.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=447

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 168/246 (68%), Gaps = 41/246 (17%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LESSDYLK++ L + C VGVV+S TEGP+ Y I VP S++G 
Sbjct  132  LKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRCYNIPVPVSNLGQ  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G LLESGKG DV F+V+ ET+ AHKLVL+ RSPVF+AQLFGP+ + N   I +EDMEA
Sbjct  192  QLGNLLESGKGCDVIFQVDEETYNAHKLVLATRSPVFKAQLFGPLGNPNTKCITIEDMEA  251

Query  360  PVF----------------------------------------KALLHFIYCDVLPDMEE  419
            P+F                                        KALLHFIY D LPD++E
Sbjct  252  PIFKVIPLTLLMVVSYRIVYSRMYHPGSSPGALLLFSSLLTRDKALLHFIYWDELPDLQE  311

Query  420  LTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQ  599
            L G ++  ASTL+AQHLLAA+DRY L+RL+ +CE  LCE + INTVATTLALAEQHHC Q
Sbjct  312  LMGADTTLASTLVAQHLLAAADRYALERLKAICELKLCEGIAINTVATTLALAEQHHCLQ  371

Query  600  LKSVCL  617
            LK+VCL
Sbjct  372  LKAVCL  377



>gb|EAZ02463.1| hypothetical protein OsI_24569 [Oryza sativa Indica Group]
Length=335

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R++LESSD+LKDDCL ++C VGVV++R E PK   I++PPSD+G 
Sbjct  115  LKYRGSMWGYKRFYRRSLLESSDFLKDDCLVMNCTVGVVKNRLETPKNIHINIPPSDMGR  174

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  LL    G DV+FEV  E   AHK +L+ARSPVF+AQ FGP+ + ++ ++ VED+E 
Sbjct  175  CFNNLLNLRIGCDVSFEVGDERVQAHKWILAARSPVFKAQFFGPIGNPDLHTVIVEDVEP  234

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  S W ST++ QHLLAA+DRYGLDRLRLLCE  LC++
Sbjct  235  LVFKAMVNFIYSDELPSIHELAGSVSTWTSTVVVQHLLAAADRYGLDRLRLLCEEKLCDE  294

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  295  LTAETVATTLALAEQHHCTQLKSACL  320



>ref|NP_001058677.1| Os07g0101400 [Oryza sativa Japonica Group]
 dbj|BAD31828.1| putative speckle-type POZ protein [Oryza sativa Japonica Group]
 dbj|BAF20591.1| Os07g0101400 [Oryza sativa Japonica Group]
 dbj|BAG91629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R++LESSD+LKDDCL ++C VGVV++R E PK   I++PPSD+G 
Sbjct  115  LKYRGSMWGYKRFYRRSLLESSDFLKDDCLVMNCTVGVVKNRLETPKNIHINIPPSDMGR  174

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  LL    G DV+FEV  E   AHK +L+ARSPVF+AQ FGP+ + ++ ++ VED+E 
Sbjct  175  CFNNLLNLRIGCDVSFEVGDERVQAHKWILAARSPVFKAQFFGPIGNPDLHTVIVEDVEP  234

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  S W ST++ QHLLAA+DRYGLDRLRLLCE  LC++
Sbjct  235  LVFKAMVNFIYSDELPSIHELAGSVSTWTSTVVVQHLLAAADRYGLDRLRLLCEEKLCDE  294

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  295  LTAETVATTLALAEQHHCTQLKSACL  320



>gb|KJB74035.1| hypothetical protein B456_011G268500 [Gossypium raimondii]
 gb|KJB74040.1| hypothetical protein B456_011G268500 [Gossypium raimondii]
Length=410

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I V PSD+G 
Sbjct  124  LKYRGSMWGYKRFYRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKQCSIHVLPSDMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D N+  + V+D+E 
Sbjct  184  NLKALLESEVGCDITFQVGDEAFKAHKLILAARSPVFRAQFFGLVGDPNIDKVVVKDVEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+L FIY D  PD++E+TG  S   ST M QHLLAA+D Y LDRL++LCEA LCE 
Sbjct  244  SVFKAMLLFIYSDKFPDIQEITGSGSTCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEK  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK+VCL
Sbjct  304  LNADTVATTLALAEQHHCSQLKAVCL  329



>ref|XP_003557713.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Brachypodium 
distachyon]
 ref|XP_010228487.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Brachypodium 
distachyon]
Length=397

 Score =   268 bits (686),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R+ LE+SD+LK+DCL ++C VGVV++R E PK   I+VPPSDIG 
Sbjct  117  LKYRGSMWGYKRFYRRSQLETSDFLKNDCLVMNCTVGVVKTRLETPKNIQINVPPSDIGR  176

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F +LL    G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++  + VED+E 
Sbjct  177  CFKELLRLRIGCDITFEVGDEKVQAHKWILAARSPVFKAQFFGPIGKADLDRVVVEDVEP  236

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  SMW ST + QHLLAA+DRYGLDRLR+LCEA LC+ 
Sbjct  237  IVFKAMVNFIYSDELPSIHELAGSFSMWTSTAVIQHLLAAADRYGLDRLRILCEAQLCDG  296

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLKS CL
Sbjct  297  LTAETVATTLALAEQHHCAQLKSACL  322



>gb|KDP44889.1| hypothetical protein JCGZ_01389 [Jatropha curcas]
Length=407

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDY+KDDCL ++C VGVVR+R  GPK   I++PPSD+G 
Sbjct  121  LKYRGSMWGYKRFFRRTTLENSDYIKDDCLLMNCTVGVVRTRLVGPKQCFITIPPSDMGQ  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
               +LLES  G D+ F+V  ETF AHKL+L+ARSPVFRAQ FG   D N+  + V+D++ 
Sbjct  181  GLKELLESEVGCDIAFQVGDETFKAHKLILAARSPVFRAQFFGLFGDPNLDKVVVKDIDP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LPD+ E+TG  SM  ST M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  241  SIFKAMLLFVYTDKLPDVHEITGTTSMCTSTNMVQHLLAAADLYNLDRLKLLCESKLCEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            ++  TVATTLALAEQH C QL+++CL
Sbjct  301  LSAETVATTLALAEQHQCSQLRAICL  326



>gb|EYU19945.1| hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata]
Length=340

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD+LKDDCL +HC VGVVR+R EGPK+Y++ VPPSD+G 
Sbjct  123  LKYRGSMWGYKRFFRRTSLETSDFLKDDCLSMHCTVGVVRTRVEGPKSYSVIVPPSDMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LL+S  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  183  SLKYLLDSETGCDITFQVGEESFRAHKLILAARSPVFRAQFFGLVGNPNSDKVEIEDVEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKALL FIY D LP  +E+   ++   S +M QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  243  FIFKALLQFIYSDELPSFDEIMD-STTTPSAIMMQHLLAAADRFGLDRLKQLCEVKLCEE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V   TVATTL+LAEQH C QLK++CL
Sbjct  302  VNAETVATTLSLAEQHRCPQLKAICL  327



>gb|EYU19944.1| hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata]
Length=408

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SD+LKDDCL +HC VGVVR+R EGPK+Y++ VPPSD+G 
Sbjct  123  LKYRGSMWGYKRFFRRTSLETSDFLKDDCLSMHCTVGVVRTRVEGPKSYSVIVPPSDMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LL+S  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  183  SLKYLLDSETGCDITFQVGEESFRAHKLILAARSPVFRAQFFGLVGNPNSDKVEIEDVEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKALL FIY D LP  +E+   ++   S +M QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  243  FIFKALLQFIYSDELPSFDEIMD-STTTPSAIMMQHLLAAADRFGLDRLKQLCEVKLCEE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V   TVATTL+LAEQH C QLK++CL
Sbjct  302  VNAETVATTLSLAEQHRCPQLKAICL  327



>ref|XP_006435615.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 ref|XP_006435616.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 ref|XP_006486412.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Citrus sinensis]
 gb|ESR48855.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 gb|ESR48856.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 gb|KDO69177.1| hypothetical protein CISIN_1g015560mg [Citrus sinensis]
 gb|KDO69178.1| hypothetical protein CISIN_1g015560mg [Citrus sinensis]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDY+KDDCL I+C VGVVR+R EGPK Y+I VPPSD+G 
Sbjct  117  LKYRGSMWGYKRFFKRTSLETSDYIKDDCLLINCTVGVVRNRLEGPKQYSIPVPPSDMGQ  176

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ FEV  ETF AHKL+L+ARSPVFRAQ +G + D+N+  + V+D+E 
Sbjct  177  GLKDLLESEIGCDIVFEVGDETFKAHKLILAARSPVFRAQFYGLVGDRNLDKVVVKDVEP  236

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D  PD+ E+TG  SM  +T M QHLLAA+D Y +DRL+LLCE+ LCE+
Sbjct  237  SIFKAMLLFIYTDKFPDVYEITGTTSMCTTTNMVQHLLAAADLYNVDRLKLLCESKLCEE  296

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +   TVATTLALAEQH C QLK++CL
Sbjct  297  LNAETVATTLALAEQHQCPQLKAICL  322



>ref|XP_010517338.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Camelina sativa]
Length=349

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R+ LE+SDY+KDDCL +HC VGVVR+R EGPK Y I +P S++G 
Sbjct  128  LKYKGSMWGYKRFFRRSALETSDYIKDDCLVVHCTVGVVRARLEGPKQYGIVLPLSNMGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I +ED+E 
Sbjct  188  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  248  SIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH  FQLK+ CL
Sbjct  308  LDVDNVATTLALAEQHQFFQLKTFCL  333



>ref|XP_006435614.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 ref|XP_006486411.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Citrus sinensis]
 gb|ESR48854.1| hypothetical protein CICLE_v10031714mg [Citrus clementina]
 gb|KDO69175.1| hypothetical protein CISIN_1g015560mg [Citrus sinensis]
Length=404

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKRT LE+SDY+KDDCL I+C VGVVR+R EGPK Y+I VPPSD+G 
Sbjct  117  LKYRGSMWGYKRFFKRTSLETSDYIKDDCLLINCTVGVVRNRLEGPKQYSIPVPPSDMGQ  176

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ FEV  ETF AHKL+L+ARSPVFRAQ +G + D+N+  + V+D+E 
Sbjct  177  GLKDLLESEIGCDIVFEVGDETFKAHKLILAARSPVFRAQFYGLVGDRNLDKVVVKDVEP  236

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D  PD+ E+TG  SM  +T M QHLLAA+D Y +DRL+LLCE+ LCE+
Sbjct  237  SIFKAMLLFIYTDKFPDVYEITGTTSMCTTTNMVQHLLAAADLYNVDRLKLLCESKLCEE  296

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +   TVATTLALAEQH C QLK++CL
Sbjct  297  LNAETVATTLALAEQHQCPQLKAICL  322



>ref|XP_010517337.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Camelina sativa]
Length=405

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R+ LE+SDY+KDDCL +HC VGVVR+R EGPK Y I +P S++G 
Sbjct  128  LKYKGSMWGYKRFFRRSALETSDYIKDDCLVVHCTVGVVRARLEGPKQYGIVLPLSNMGQ  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I +ED+E 
Sbjct  188  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  248  SIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH  FQLK+ CL
Sbjct  308  LDVDNVATTLALAEQHQFFQLKTFCL  333



>ref|XP_010067446.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Eucalyptus grandis]
 gb|KCW65573.1| hypothetical protein EUGRSUZ_G02967 [Eucalyptus grandis]
 gb|KCW65574.1| hypothetical protein EUGRSUZ_G02967 [Eucalyptus grandis]
Length=419

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF KR  LE+SDY+KDDCL +HC VGVVR+ TEGPK Y I +PPSD+G 
Sbjct  130  LKYRGSMWGYKRFLKRVALETSDYIKDDCLVMHCTVGVVRTHTEGPKQYRIPIPPSDMGQ  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LL+S  G D+ F V  ETF AHKL+L+ARSPVFRAQ FG + D N+  + VED++ 
Sbjct  190  CLKALLDSEVGCDIAFVVGDETFRAHKLILAARSPVFRAQFFGLVGDCNIEKVVVEDVDP  249

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D +PD+ E+TG +S    T + QHLLAA+DRY L+RL+LLCE+ LCE+
Sbjct  250  SIFKAMLLFIYMDEMPDLREITGSSSSGTLTNVVQHLLAAADRYNLERLKLLCESKLCEE  309

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVATTLALAEQH   QLK++CL
Sbjct  310  ITADTVATTLALAEQHQFGQLKAMCL  335



>ref|XP_010508976.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Camelina sativa]
Length=347

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R+ LE+SDY+KDDCL +HC VGVVR+R EGPK Y I +P S++G 
Sbjct  126  LKYKGSMWGYKRFFRRSALETSDYIKDDCLVVHCTVGVVRARLEGPKQYGIVLPLSNMGQ  185

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  186  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  245

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  246  SIFKAMLSFIYTDVLPDVHEITGSASASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  305

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH  FQLK+ CL
Sbjct  306  LDVDNVATTLALAEQHQFFQLKTFCL  331



>ref|XP_009785862.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009785863.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009785864.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana sylvestris]
Length=337

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR  LE+SDYLKDDCL +HC VGVVRSR EGPK Y++ VPPSD+G 
Sbjct  119  LKYRGSMWGYKRFFKRINLETSDYLKDDCLAMHCTVGVVRSRVEGPKDYSVVVPPSDMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LL++  G D+ F+V  ETF  HKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  179  NLKYLLDAELGCDIVFQVGEETFKGHKLILAARSPVFRAQFFGLIGNPNTDKVELEDIEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L +IY D LPD+ E+TG  S   ST+M QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  239  SIFKAMLQYIYSDELPDLGEITGSTSTCTSTIMMQHLLAAADRFGLDRLKELCEVKLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+LAE H C QLK++CL
Sbjct  299  VNVDTVATTLSLAELHCCPQLKAICL  324



>ref|XP_006294342.1| hypothetical protein CARUB_v10023357mg [Capsella rubella]
 gb|EOA27240.1| hypothetical protein CARUB_v10023357mg [Capsella rubella]
Length=401

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R+ LE+SDYLKDDCL +HC VGVVR+R EGPK Y I +P S++G 
Sbjct  124  LKYKGSMWGYKRFFRRSALETSDYLKDDCLVVHCTVGVVRARLEGPKQYGIVLPLSNMGQ  183

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D++F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  184  GLKDLLDSEVGCDISFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  243

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE+
Sbjct  244  SIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEE  303

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  304  LDVDNVATTLALAEQHQFLQLKAFCL  329



>ref|XP_002879815.1| hypothetical protein ARALYDRAFT_903228 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56074.1| hypothetical protein ARALYDRAFT_903228 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFFKR+ LE+SDYLKDDCL I+C VGVVR+R EGPK Y I +P S++G 
Sbjct  123  LKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I +ED+EA
Sbjct  183  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIEDIEA  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  243  SIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  303  LDVDNVATTLALAEQHQFLQLKAFCL  328



>ref|XP_010691290.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010691298.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R  LESS++LK+DCL + C VGVVRSR E PK Y+I++PPSD+G 
Sbjct  134  LKYKGSMWGYKRFFRRPALESSEFLKEDCLVLECTVGVVRSRMERPKQYSINMPPSDMGR  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  L E+  G D+ F+V  +TF AHKLVL+ARSPVF+AQ FG + + +M ++ VED+E 
Sbjct  194  CFKDLFENEIGCDIVFKVGDDTFNAHKLVLAARSPVFKAQFFGLVGNPDMDTVVVEDVEP  253

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +F+A+L +IY D LPD+ E+ G N+  + T+M QHLLA++DR+GLDRL+L+CE+ LC++
Sbjct  254  SIFRAMLLYIYSDSLPDVHEIMGSNTSCSFTIMVQHLLASADRFGLDRLKLICESKLCDE  313

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T+ TV TTL+LAEQH C QLKS CL
Sbjct  314  ITVETVPTTLSLAEQHRCVQLKSACL  339



>ref|XP_009785861.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana sylvestris]
Length=404

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR  LE+SDYLKDDCL +HC VGVVRSR EGPK Y++ VPPSD+G 
Sbjct  119  LKYRGSMWGYKRFFKRINLETSDYLKDDCLAMHCTVGVVRSRVEGPKDYSVVVPPSDMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LL++  G D+ F+V  ETF  HKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  179  NLKYLLDAELGCDIVFQVGEETFKGHKLILAARSPVFRAQFFGLIGNPNTDKVELEDIEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L +IY D LPD+ E+TG  S   ST+M QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  239  SIFKAMLQYIYSDELPDLGEITGSTSTCTSTIMMQHLLAAADRFGLDRLKELCEVKLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+LAE H C QLK++CL
Sbjct  299  VNVDTVATTLSLAELHCCPQLKAICL  324



>ref|XP_006355692.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Solanum tuberosum]
Length=340

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE SDYLKDDCL +HC VGVVR+R EGPK Y++++PPSD+G 
Sbjct  122  LKYRGSMWGYKRFFRRASLEMSDYLKDDCLSMHCTVGVVRTRVEGPKDYSVTIPPSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFG----PMKDQNMSINVED  350
                LL++  G D+ F V  E F  HKL+L+ARSPVFRAQ FG    P  D+   + +ED
Sbjct  182  SLKYLLDAELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFFGLIGNPKTDE---VEIED  238

Query  351  MEAPVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANL  530
            +E  VFKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+GLDRL+ LCEA L
Sbjct  239  IEPSVFKAMLQYIYSDELPDLIEITGSTSTCTSTIVMQHLLAAADRFGLDRLKELCEAKL  298

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            CE+V ++TVATTL+LAEQH C QLK++CL
Sbjct  299  CEEVNVDTVATTLSLAEQHRCPQLKAICL  327



>ref|XP_010508974.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Camelina sativa]
Length=403

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R+ LE+SDY+KDDCL +HC VGVVR+R EGPK Y I +P S++G 
Sbjct  126  LKYKGSMWGYKRFFRRSALETSDYIKDDCLVVHCTVGVVRARLEGPKQYGIVLPLSNMGQ  185

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  186  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  245

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  246  SIFKAMLSFIYTDVLPDVHEITGSASASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  305

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH  FQLK+ CL
Sbjct  306  LDVDNVATTLALAEQHQFFQLKTFCL  331



>emb|CDY02591.1| BnaC02g08440D [Brassica napus]
Length=400

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 163/233 (70%), Gaps = 41/233 (18%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGS+WGYKRFF+R+ LESSDYLKD+ L              GP+ Y ISVP S++  
Sbjct  111  LKYRGSVWGYKRFFRRSGLESSDYLKDNSLL-------------GPRDYNISVPVSNLRQ  157

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
              G+LLESGKG DV F V+GETF AHKLVL+ RSPVF+AQLFGP++D+N   I ++DME+
Sbjct  158  QLGKLLESGKGCDVTFVVDGETFYAHKLVLATRSPVFKAQLFGPLRDRNTDRIKIDDMES  217

Query  360  PVFK---------------------------ALLHFIYCDVLPDMEELTGMNSMWASTLM  458
            P+FK                            LLHFIY D LPDM+EL G +S  ASTL+
Sbjct  218  PIFKDFVFFLSAYLPSCDVGWILECHNRFCDVLLHFIYWDELPDMQELIGTDSKSASTLV  277

Query  459  AQHLLAASDRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKSVCL  617
            AQHLLAA+DRY L+RL+ +CE+ LCE +TINTVATTLALAEQHHCFQLK+VCL
Sbjct  278  AQHLLAAADRYALERLKAICESKLCEGITINTVATTLALAEQHHCFQLKAVCL  330



>ref|XP_009601989.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009601990.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Nicotiana tomentosiformis]
Length=337

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR  LE+SDYLKDDCL +HC VGVVRSR EGPK Y++ VPPSD+G 
Sbjct  119  LKYRGSMWGYKRFFKRINLETSDYLKDDCLAMHCTVGVVRSRVEGPKDYSVVVPPSDMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LL++  G D+ F+V  ETF  HKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  179  NLKYLLDAELGCDIVFQVGEETFKGHKLILAARSPVFRAQFFGLIGNPNTDKVELEDIEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  239  SIFKAMLQYIYSDELPDLVEITGSTSTCTSTILMQHLLAAADRFGLDRLKELCEVKLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+LAE H C QLK++CL
Sbjct  299  VNVDTVATTLSLAELHCCPQLKAICL  324



>ref|XP_010321433.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010321434.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Solanum lycopersicum]
Length=340

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDDCL +HC VGVVR+R EGPK Y++++PPSD+G 
Sbjct  122  LKYRGSMWGYKRFFRRASLETSDYLKDDCLSMHCTVGVVRTRVEGPKNYSVTIPPSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFG----PMKDQNMSINVED  350
                LL++  G D+ F V  E F  HKL+L+ARSPVFRAQ FG    P  D+   + +ED
Sbjct  182  SLKYLLDAELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFFGLIGNPKTDE---VEIED  238

Query  351  MEAPVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANL  530
            +E  VFKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+G+DRL+ LCEA L
Sbjct  239  IEPSVFKAMLQYIYSDELPDLIEITGSTSTCTSTIVTQHLLAAADRFGVDRLKELCEAKL  298

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            CE+V ++TVATTL+LAEQH C QLK++CL
Sbjct  299  CEEVNVDTVATTLSLAEQHRCPQLKAICL  327



>gb|KJB74039.1| hypothetical protein B456_011G268500 [Gossypium raimondii]
Length=409

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRF++RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I V PSD+G 
Sbjct  124  LKYRGSM-GYKRFYRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKQCSIHVLPSDMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D N+  + V+D+E 
Sbjct  183  NLKALLESEVGCDITFQVGDEAFKAHKLILAARSPVFRAQFFGLVGDPNIDKVVVKDVEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+L FIY D  PD++E+TG  S   ST M QHLLAA+D Y LDRL++LCEA LCE 
Sbjct  243  SVFKAMLLFIYSDKFPDIQEITGSGSTCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK+VCL
Sbjct  303  LNADTVATTLALAEQHHCSQLKAVCL  328



>ref|XP_009601988.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Nicotiana tomentosiformis]
Length=403

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR  LE+SDYLKDDCL +HC VGVVRSR EGPK Y++ VPPSD+G 
Sbjct  119  LKYRGSMWGYKRFFKRINLETSDYLKDDCLAMHCTVGVVRSRVEGPKDYSVVVPPSDMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LL++  G D+ F+V  ETF  HKL+L+ARSPVFRAQ FG + + N   + +ED+E 
Sbjct  179  NLKYLLDAELGCDIVFQVGEETFKGHKLILAARSPVFRAQFFGLIGNPNTDKVELEDIEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+GLDRL+ LCE  LCE+
Sbjct  239  SIFKAMLQYIYSDELPDLVEITGSTSTCTSTILMQHLLAAADRFGLDRLKELCEVKLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            V ++TVATTL+LAE H C QLK++CL
Sbjct  299  VNVDTVATTLSLAELHCCPQLKAICL  324



>ref|XP_006355691.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Solanum tuberosum]
Length=408

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE SDYLKDDCL +HC VGVVR+R EGPK Y++++PPSD+G 
Sbjct  122  LKYRGSMWGYKRFFRRASLEMSDYLKDDCLSMHCTVGVVRTRVEGPKDYSVTIPPSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFG----PMKDQNMSINVED  350
                LL++  G D+ F V  E F  HKL+L+ARSPVFRAQ FG    P  D+   + +ED
Sbjct  182  SLKYLLDAELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFFGLIGNPKTDE---VEIED  238

Query  351  MEAPVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANL  530
            +E  VFKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+GLDRL+ LCEA L
Sbjct  239  IEPSVFKAMLQYIYSDELPDLIEITGSTSTCTSTIVMQHLLAAADRFGLDRLKELCEAKL  298

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            CE+V ++TVATTL+LAEQH C QLK++CL
Sbjct  299  CEEVNVDTVATTLSLAEQHRCPQLKAICL  327



>gb|KHG23447.1| BTB/POZ and MATH domain-containing 3 -like protein [Gossypium 
arboreum]
Length=409

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRF++RT LESSDY+KDDCL ++C VGVVR+R EGPK  +I V PSD+G 
Sbjct  124  LKYRGSM-GYKRFYRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKQCSIHVLPSDMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
            +   LLES  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D N+  + V+D+E 
Sbjct  183  NLKALLESEVGCDITFQVGDEAFKAHKLILAARSPVFRAQFFGLVGDPNIDKVVVKDVEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+L FIY D  PD++E+TG  S   ST M QHLLAA+D Y LDRL++LCEA LCE 
Sbjct  243  SVFKAMLLFIYSDKFPDIQEITGSGSTCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +   TVATTLALAEQHHC QLK+VCL
Sbjct  303  LNAETVATTLALAEQHHCSQLKAVCL  328



>ref|XP_004239913.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDDCL +HC VGVVR+R EGPK Y++++PPSD+G 
Sbjct  122  LKYRGSMWGYKRFFRRASLETSDYLKDDCLSMHCTVGVVRTRVEGPKNYSVTIPPSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFG----PMKDQNMSINVED  350
                LL++  G D+ F V  E F  HKL+L+ARSPVFRAQ FG    P  D+   + +ED
Sbjct  182  SLKYLLDAELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFFGLIGNPKTDE---VEIED  238

Query  351  MEAPVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANL  530
            +E  VFKA+L +IY D LPD+ E+TG  S   ST++ QHLLAA+DR+G+DRL+ LCEA L
Sbjct  239  IEPSVFKAMLQYIYSDELPDLIEITGSTSTCTSTIVTQHLLAAADRFGVDRLKELCEAKL  298

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            CE+V ++TVATTL+LAEQH C QLK++CL
Sbjct  299  CEEVNVDTVATTLSLAEQHRCPQLKAICL  327



>ref|XP_010691281.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R  LESS++LK+DCL + C VGVVRSR E PK Y+I++PPSD+G 
Sbjct  134  LKYKGSMWGYKRFFRRPALESSEFLKEDCLVLECTVGVVRSRMERPKQYSINMPPSDMGR  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  L E+  G D+ F+V  +TF AHKLVL+ARSPVF+AQ FG + + +M ++ VED+E 
Sbjct  194  CFKDLFENEIGCDIVFKVGDDTFNAHKLVLAARSPVFKAQFFGLVGNPDMDTVVVEDVEP  253

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +F+A+L +IY D LPD+ E+ G N+  + T+M QHLLA++DR+GLDRL+L+CE+ LC++
Sbjct  254  SIFRAMLLYIYSDSLPDVHEIMGSNTSCSFTIMVQHLLASADRFGLDRLKLICESKLCDE  313

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T+ TV TTL+LAEQH C QLKS CL
Sbjct  314  ITVETVPTTLSLAEQHRCVQLKSACL  339



>ref|XP_010691271.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=420

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R  LESS++LK+DCL + C VGVVRSR E PK Y+I++PPSD+G 
Sbjct  134  LKYKGSMWGYKRFFRRPALESSEFLKEDCLVLECTVGVVRSRMERPKQYSINMPPSDMGR  193

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F  L E+  G D+ F+V  +TF AHKLVL+ARSPVF+AQ FG + + +M ++ VED+E 
Sbjct  194  CFKDLFENEIGCDIVFKVGDDTFNAHKLVLAARSPVFKAQFFGLVGNPDMDTVVVEDVEP  253

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +F+A+L +IY D LPD+ E+ G N+  + T+M QHLLA++DR+GLDRL+L+CE+ LC++
Sbjct  254  SIFRAMLLYIYSDSLPDVHEIMGSNTSCSFTIMVQHLLASADRFGLDRLKLICESKLCDE  313

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T+ TV TTL+LAEQH C QLKS CL
Sbjct  314  ITVETVPTTLSLAEQHRCVQLKSACL  339



>ref|NP_001031516.1| BTB/POZ and MATH domain-containing protein [Arabidopsis thaliana]
 dbj|BAH19418.1| AT2G39760 [Arabidopsis thaliana]
 gb|AEC09720.1| BTB/POZ and MATH domain-containing protein [Arabidopsis thaliana]
Length=343

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFFKR+ LE+SDYLKDDCL I+C VGVVR+R EGPK Y I +P S++G 
Sbjct  123  LKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  183  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLP++ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  243  SIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  303  LDVDNVATTLALAEQHQFLQLKAFCL  328



>ref|XP_009141835.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Brassica rapa]
Length=399

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRF +RT LE+SDYLKDDCL I+C VGVVR+R EGPK + I  PPS++G 
Sbjct  119  LKYKGSMWGYKRFLRRTALEASDYLKDDCLIINCTVGVVRARLEGPKQFGIVPPPSNMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + ++  + +EDME 
Sbjct  179  GLKDLLDSELGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPVGNNSVDRVVIEDMEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCEA LCE+
Sbjct  239  SIFKAMLSFIYTDVLPDVHEITGSTSTASFTNMIQHLLAAADLYDLGRLKILCEAFLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALA+QH   QLK+ CL
Sbjct  299  LNVDNVATTLALADQHQFLQLKAFCL  324



>gb|AAM66127.1| unknown [Arabidopsis thaliana]
Length=408

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFFKR+ LE+SDYLKDDCL I+C VGVVR+R EGPK Y I +P S++G 
Sbjct  123  LKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  183  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLP++ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  243  SIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  303  LDVDNVATTLALAEQHQFLQLKAFCL  328



>ref|NP_030522.1| BTB/POZ and MATH domain-containing protein [Arabidopsis thaliana]
 sp|O22286.1|BPM3_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 3; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 3; Short=AtBPM3 
[Arabidopsis thaliana]
 gb|AAB87125.1| expressed protein [Arabidopsis thaliana]
 gb|AAM91518.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15363.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09719.1| BTB/POZ and MATH domain-containing protein [Arabidopsis thaliana]
Length=408

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFFKR+ LE+SDYLKDDCL I+C VGVVR+R EGPK Y I +P S++G 
Sbjct  123  LKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQ  182

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FGP+ + N+  I ++D+E 
Sbjct  183  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEP  242

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLP++ E+TG  S  + T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  243  SIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEK  302

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  303  LDVDNVATTLALAEQHQFLQLKAFCL  328



>ref|XP_008803125.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Phoenix dactylifera]
Length=352

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+S YLKDDCL +HC VGVVR+R E  + ++I VPP D+G 
Sbjct  136  LKYRGSMWGYKRFYRRTALETSHYLKDDCLVMHCTVGVVRNRIETARQFSIPVPPPDMGK  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLESG G+D+ FEV  ETF AHK +L+ARSPVF AQ FG + D  M  + VED+E 
Sbjct  196  CLKELLESGMGSDIVFEVGDETFKAHKKILAARSPVFNAQFFGLIGDPKMDRVVVEDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D  PD+ ELTG  S+  ST++ QHLLAA+DRYGLDRLR LCE+ LCE+
Sbjct  256  PVFKAMLLFIYSDGFPDVHELTGSVSLCTSTILVQHLLAAADRYGLDRLRKLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVA TLALAEQH C  LKSVCL
Sbjct  316  LTADTVAATLALAEQHQCSHLKSVCL  341



>ref|XP_010108399.1| BTB/POZ and MATH domain-containing protein 3 [Morus notabilis]
 gb|EXC19390.1| BTB/POZ and MATH domain-containing protein 3 [Morus notabilis]
Length=417

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  +E+SDYLKDDCL + C VGVVR+  EGPK +AI VPPSD+G 
Sbjct  130  LKYRGSMWGYKRFFRRAAVETSDYLKDDCLVMKCTVGVVRTHLEGPKQFAIPVPPSDMGR  189

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                LL S  G D+ F V  E++ AHKL+L+ARSPVFRAQ FG + D ++   V     P
Sbjct  190  GLKDLLSSEVGCDIVFHVGDESYKAHKLILAARSPVFRAQFFGLVGDPSVDKVVVKDVEP  249

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+ G +SM + T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  250  FIFKAMLLFIYSDKLPDVYEVMGSSSMCSFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  309

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  +TVATTLALAEQHHC QLK++CL
Sbjct  310  INTDTVATTLALAEQHHCPQLKAMCL  335



>ref|XP_008803124.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Phoenix dactylifera]
Length=417

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++RT LE+S YLKDDCL +HC VGVVR+R E  + ++I VPP D+G 
Sbjct  136  LKYRGSMWGYKRFYRRTALETSHYLKDDCLVMHCTVGVVRNRIETARQFSIPVPPPDMGK  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
               +LLESG G+D+ FEV  ETF AHK +L+ARSPVF AQ FG + D  M  + VED+E 
Sbjct  196  CLKELLESGMGSDIVFEVGDETFKAHKKILAARSPVFNAQFFGLIGDPKMDRVVVEDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
            PVFKA+L FIY D  PD+ ELTG  S+  ST++ QHLLAA+DRYGLDRLR LCE+ LCE+
Sbjct  256  PVFKAMLLFIYSDGFPDVHELTGSVSLCTSTILVQHLLAAADRYGLDRLRKLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T +TVA TLALAEQH C  LKSVCL
Sbjct  316  LTADTVAATLALAEQHQCSHLKSVCL  341



>emb|CDX93238.1| BnaC04g46580D [Brassica napus]
Length=396

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRF +RT LE+SDYLKDDCL I+C VGVVR+R EGPK + I  PPS++G 
Sbjct  117  LKYKGSMWGYKRFLRRTALEASDYLKDDCLIINCTVGVVRARLEGPKQFCIVPPPSNMGQ  176

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + ++  + +ED+E 
Sbjct  177  GLKDLLDSELGCDIIFQVGDETYKAHKLILAARSPVFRAQFYGPVGNNSVDRVVIEDIEP  236

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCEA LCE+
Sbjct  237  SIFKAMLSFIYTDVLPDVHEITGSTSTASFTNMIQHLLAAADLYDLGRLKILCEAFLCEE  296

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALA+QH   QLK+ CL
Sbjct  297  LNVDNVATTLALADQHQFLQLKAFCL  322



>gb|EMS62743.1| BTB/POZ and MATH domain-containing protein 3 [Triticum urartu]
Length=333

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +3

Query  27   GYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGLHFGQLLES  206
            GYKRF++RT LE+SD+LKDDCL ++C VGVV++R E PK   I+VPPSDIG  F +L E 
Sbjct  121  GYKRFYRRTQLEASDFLKDDCLVMNCTVGVVKNRLETPKNIQINVPPSDIGRCFKELFEL  180

Query  207  GKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEAPVFKALLH  383
              G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   +M  + VED+E  VFKA+++
Sbjct  181  HIGCDITFEVGDEKVQAHKWILAARSPVFKAQFFGPIGKPDMDRVVVEDVEPIVFKAMVN  240

Query  384  FIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCEDVTINTVAT  563
            FIY D LP + E+ G  SMW ST + QHLLAA+DRYGLDRLR+LCEA LC+++T  TVAT
Sbjct  241  FIYSDELPSIHEVAGSFSMWTSTAVTQHLLAAADRYGLDRLRILCEAKLCDELTSETVAT  300

Query  564  TLALAEQHHCFQLKSVCL  617
            TLALAEQHHC QLKS CL
Sbjct  301  TLALAEQHHCAQLKSACL  318



>ref|XP_006411210.1| hypothetical protein EUTSA_v10017774mg [Eutrema salsugineum]
 gb|ESQ52663.1| hypothetical protein EUTSA_v10017774mg [Eutrema salsugineum]
Length=398

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 154/206 (75%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRF +RT LE+SD+LKDDCL + C VGVV++R EGPK Y I +PPS++G 
Sbjct  122  LKYKGSMWGYKRFLRRTALETSDFLKDDCLIVSCTVGVVKARVEGPKHYGIVLPPSNMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + N+  I +ED+E 
Sbjct  182  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPIGNNNVDRIVIEDVEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLA +D Y L RL++LCE  LCE 
Sbjct  242  SIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAIADLYDLGRLKILCEVFLCEK  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QL++ CL
Sbjct  302  LNVDNVATTLALAEQHQFLQLRAFCL  327



>gb|KDO69176.1| hypothetical protein CISIN_1g015560mg [Citrus sinensis]
Length=403

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSM GYKRFFKRT LE+SDY+KDDCL I+C VGVVR+R EGPK Y+I VPPSD+G 
Sbjct  117  LKYRGSM-GYKRFFKRTSLETSDYIKDDCLLINCTVGVVRNRLEGPKQYSIPVPPSDMGQ  175

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                LLES  G D+ FEV  ETF AHKL+L+ARSPVFRAQ +G + D+N+  + V+D+E 
Sbjct  176  GLKDLLESEIGCDIVFEVGDETFKAHKLILAARSPVFRAQFYGLVGDRNLDKVVVKDVEP  235

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D  PD+ E+TG  SM  +T M QHLLAA+D Y +DRL+LLCE+ LCE+
Sbjct  236  SIFKAMLLFIYTDKFPDVYEITGTTSMCTTTNMVQHLLAAADLYNVDRLKLLCESKLCEE  295

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +   TVATTLALAEQH C QLK++CL
Sbjct  296  LNAETVATTLALAEQHQCPQLKAICL  321



>emb|CDY07031.1| BnaA04g22840D [Brassica napus]
Length=399

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRF +RT LE+SDYLKDDCL I+C VGVVR+R E PK + I  PPS++G 
Sbjct  119  LKYKGSMWGYKRFLRRTALEASDYLKDDCLIINCTVGVVRARLECPKQFGIVPPPSNMGQ  178

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + ++  + +EDME 
Sbjct  179  GLKDLLDSELGCDIAFQVGEETYKAHKLILAARSPVFRAQFYGPVGNNSVDRVVIEDMEP  238

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCEA LCE+
Sbjct  239  SIFKAMLSFIYTDVLPDVHEITGSTSTASFTNMIQHLLAAADLYDLGRLKILCEAFLCEE  298

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALA+QH   QLK+ CL
Sbjct  299  LNVDNVATTLALADQHQFLQLKAFCL  324



>ref|XP_010554622.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Tarenaya 
hassleriana]
Length=412

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+RT LE+SD+LKDDCL I+C VGVVR+R EGPK Y I +PPS++G 
Sbjct  125  LKYKGSMWGYKRFFRRTTLEASDFLKDDCLVINCTVGVVRTRLEGPKQYHIPLPPSNMGQ  184

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ FG + D ++  I ++D+E 
Sbjct  185  GLKDLLDSEVGCDIAFQVREETYKAHKLILAARSPVFRAQFFGLVGDNSVDRIVIDDIEP  244

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L+FIY D LPD+ E+TG  S  + T M QHLLAA+D Y L RL++LCEA LCE 
Sbjct  245  SIFKAMLNFIYTDELPDVNEITGSVSPSSFTNMVQHLLAAADLYDLGRLKILCEAVLCEH  304

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   QLK+ CL
Sbjct  305  LNVDNVATTLALAEQHQFSQLKTFCL  330



>ref|XP_007218050.1| hypothetical protein PRUPE_ppa006151mg [Prunus persica]
 gb|EMJ19249.1| hypothetical protein PRUPE_ppa006151mg [Prunus persica]
Length=425

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+S++L+DDCL ++C VGVVR+R E PK ++I+VP SD+G 
Sbjct  136  LKYRGSMWGYKRFFKRSALETSEFLRDDCLVLNCTVGVVRTRLERPKQFSITVPSSDMGQ  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                 L+S  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D ++  + V+D+E 
Sbjct  196  DLKDFLDSEAGCDIVFQVGDELFKAHKLILAARSPVFRAQFFGLVGDCSIDKVVVKDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+ G + +   T+M QHLLAA+D Y L+RL++LCE+ LCE+
Sbjct  256  FIFKAMLLFIYTDKLPDVHEVMGSSPLCTFTVMVQHLLAAADLYNLERLKVLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLK+VCL
Sbjct  316  ITTETVATTLALAEQHHCPQLKAVCL  341



>ref|XP_008233485.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Prunus 
mume]
Length=425

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFFKR+ LE+S++L+DDCL ++C VGVVR+R E PK ++I+VP SD+G 
Sbjct  136  LKYRGSMWGYKRFFKRSALETSEFLRDDCLVLNCTVGVVRTRLERPKQFSITVPSSDMGR  195

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
                 L+S  G D+ F+V  E F AHKL+L+ARSPVFRAQ FG + D ++  + V+D+E 
Sbjct  196  DLKDFLDSEAGCDIVFQVGDELFKAHKLILAARSPVFRAQFFGLVGDCSIDKVVVKDVEP  255

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+ G + +   T+M QHLLAA+D Y L+RL++LCE+ LCE+
Sbjct  256  FIFKAMLLFIYTDKLPDVHEVMGSSPLCTFTVMVQHLLAAADLYNLERLKVLCESKLCEE  315

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLK+VCL
Sbjct  316  ITTETVATTLALAEQHHCPQLKAVCL  341



>ref|XP_004307466.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Fragaria 
vesca subsp. vesca]
Length=429

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R+ LE+S++LKDD L ++C VGVVR+R E PK +AI+VPPSD+G 
Sbjct  139  LKYRGSMWGYKRFFRRSALETSEFLKDDSLVLNCTVGVVRTRLECPKHFAITVPPSDMGE  198

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+SG G D+ F+V  E F AHKL+L+ARSPVF+AQ FG + D ++   V     P
Sbjct  199  GLKAFLDSGAGCDLVFQVGDEEFKAHKLILAARSPVFKAQFFGHLGDSSVDKVVVKDVEP  258

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+TG +S+   T+M QHLLAA+D Y L+RL+LLCE+ LCE+
Sbjct  259  FIFKAMLLFIYGDKLPDIREVTGSSSLCTFTVMVQHLLAAADLYDLERLKLLCESMLCEE  318

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC QLK+VCL
Sbjct  319  ITTETVATTLALAEQHHCPQLKAVCL  344



>ref|XP_002461292.1| hypothetical protein SORBIDRAFT_02g000320 [Sorghum bicolor]
 gb|EER97813.1| hypothetical protein SORBIDRAFT_02g000320 [Sorghum bicolor]
Length=402

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KR++LE+SD+LK+DCL ++C VGVV++R E PK   I VP SD+G 
Sbjct  122  LKYRGSMWGYKRFYKRSLLEASDFLKNDCLVMNCTVGVVKNRMETPKDIQIHVPRSDMGH  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LL  G G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++ ++ VED+E 
Sbjct  182  CFKELLSRGIGCDITFEVRDEKVRAHKWILAARSPVFKAQFFGPIGKPDLHTVVVEDVEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++F+Y D LP + EL G  S W ST++ QHLLAA+DRYGLDRLR+LCE+ LC++
Sbjct  242  VVFKAMVNFMYTDELPSISELAGSASTWTSTVVVQHLLAAADRYGLDRLRILCESKLCDE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC +LKS CL
Sbjct  302  LTPETVATTLALAEQHHCAELKSACL  327



>ref|XP_007163464.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
 gb|ESW35458.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
Length=414

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 159/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R +LESS+YLKDDCL +HC VGVV++R EG K   ++VP SD+G 
Sbjct  129  LKYRGSMWGYKRFFRRNLLESSEYLKDDCLVMHCTVGVVKTRFEGSKQ-GVTVPQSDMGR  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +F  LL+S  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D ++  + VED+E 
Sbjct  188  NFKDLLDSEVGCDIVFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPSLEEVVVEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+    ++ +  +M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  248  FIFKAMLLFIYSDKLPDIYEVMDSMNVCSYAVMVQHLLAAADLYNLDRLKLLCESKLCEE  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQH+C QLK++CL
Sbjct  308  INTDNVATTLALAEQHNCPQLKAICL  333



>ref|XP_007163465.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
 gb|ESW35459.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
Length=434

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 159/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R +LESS+YLKDDCL +HC VGVV++R EG K   ++VP SD+G 
Sbjct  129  LKYRGSMWGYKRFFRRNLLESSEYLKDDCLVMHCTVGVVKTRFEGSKQ-GVTVPQSDMGR  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
            +F  LL+S  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D ++  + VED+E 
Sbjct  188  NFKDLLDSEVGCDIVFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPSLEEVVVEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+    ++ +  +M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  248  FIFKAMLLFIYSDKLPDIYEVMDSMNVCSYAVMVQHLLAAADLYNLDRLKLLCESKLCEE  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQH+C QLK++CL
Sbjct  308  INTDNVATTLALAEQHNCPQLKAICL  333



>ref|XP_004987280.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Setaria italica]
Length=375

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R++LE+SD+LK+DCL ++C VGVV++R E PK   +  P SD+G 
Sbjct  122  LKYRGSMWGYKRFYRRSLLETSDFLKNDCLVLNCTVGVVKNRIETPKNAQVHFPLSDMGR  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LL  G G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++  + VED+E 
Sbjct  182  CFKELLSLGIGCDITFEVGDEKVRAHKWILAARSPVFKAQFFGPIGKPDLHRVVVEDVEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  SMW ST++ QHLLAA+DRYGLDRLR+LCEA LC++
Sbjct  242  VVFKAMVNFIYADELPSIHELAGSVSMWTSTVVVQHLLAAADRYGLDRLRILCEAKLCDE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC +LK  CL
Sbjct  302  LTPETVATTLALAEQHHCAELKFACL  327



>ref|XP_004987279.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Setaria italica]
Length=402

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF++R++LE+SD+LK+DCL ++C VGVV++R E PK   +  P SD+G 
Sbjct  122  LKYRGSMWGYKRFYRRSLLETSDFLKNDCLVLNCTVGVVKNRIETPKNAQVHFPLSDMGR  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LL  G G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++  + VED+E 
Sbjct  182  CFKELLSLGIGCDITFEVGDEKVRAHKWILAARSPVFKAQFFGPIGKPDLHRVVVEDVEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  SMW ST++ QHLLAA+DRYGLDRLR+LCEA LC++
Sbjct  242  VVFKAMVNFIYADELPSIHELAGSVSMWTSTVVVQHLLAAADRYGLDRLRILCEAKLCDE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC +LK  CL
Sbjct  302  LTPETVATTLALAEQHHCAELKFACL  327



>ref|XP_006601981.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Glycine max]
Length=344

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 155/206 (75%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+RT LE+S+YLK+DCL +HC VGVV++R EG K   I VP SD+G 
Sbjct  129  LKYKGSMWGYKRFFRRTQLETSEYLKNDCLVMHCTVGVVKTRFEGSKQGVI-VPQSDMGR  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F  LLES  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D  +  + VED+E 
Sbjct  188  DFKDLLESEVGCDILFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPTLEEVVVEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LP + E+     + + T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  248  FIFKAMLLFVYSDKLPGIYEVMDSMPLCSYTVMVQHLLAAADLYNLDRLKLLCESKLCEE  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQHHC QLK++CL
Sbjct  308  INTDNVATTLALAEQHHCPQLKAICL  333



>ref|XP_010918009.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=348

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRTALETSDYLKDDCLKINCTVGVVVSVMDSPRLHSIQVPESDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL+  +G+DV F+V GE F AHKLVL+ARSPVFRAQ F  +  +   I V DME  
Sbjct  187  HFGMLLDKQEGSDVVFDVAGEKFHAHKLVLAARSPVFRAQFFDELDCEKNEIVVTDMEPK  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNSMWASTL--MAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + L   +S  +S    +A  LLAA+D+YGL+RL+L+CE+ LC+
Sbjct  247  VFEAMLHFIYRDTFVEDDALIASSSPVSSVSDTLAGKLLAAADKYGLERLQLMCESYLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++N+VA+TLALA++HH  +LK+ CL
Sbjct  307  DISVNSVASTLALADRHHAMELKAACL  333



>ref|XP_004503177.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Cicer arietinum]
Length=407

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R++LE+S+YLK+DCL +HC VGVV++R EG K   I VP  D+G 
Sbjct  122  LKYRGSMWGYKRFFRRSLLENSEYLKNDCLVMHCTVGVVKTRFEGSKQGVI-VPAPDMGR  180

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F  L ES  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D  +  + VED+E 
Sbjct  181  DFKSLFESQVGCDMVFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPCLEEVVVEDIEP  240

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD++E+ G   M + T+M QHLLAA+D Y LDRL++LCE+ L E+
Sbjct  241  FIFKAMLLFIYSDKLPDIDEVMGSIPMCSYTVMVQHLLAAADLYNLDRLKMLCESKLSEE  300

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +   TVATTLALAEQHHC QLK++CL
Sbjct  301  INTETVATTLALAEQHHCPQLKAICL  326



>gb|AFJ68127.1| BTB protein, partial [Musa acuminata AAA Group]
Length=366

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  91   LKYRGSMWGYKRFFRRAALETSDYLKDDCLKINCTVGVVVSVMDSPRLHSIQVPDSDIGM  150

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL++ +G+DV   V+GE F AHKLVL+ARSPVFRAQ F     Q   I V DME  
Sbjct  151  HFGALLDNQEGSDVIVHVSGEKFHAHKLVLAARSPVFRAQFFDDSDGQKSDIVVADMEPR  210

Query  363  VFKALLHFIYCDVLPDMEELTGMNS--MWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + LT  +S   +AS  +A  LLAASD+YGL+RLRLLCEA+LC+
Sbjct  211  VFEAMLHFIYRDTFIEDDVLTTSSSPESFASDTLAAKLLAASDKYGLERLRLLCEAHLCK  270

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++++VA+ L+LA+ +H  +LK+ CL
Sbjct  271  DISVDSVASILSLADCYHATELKAACL  297



>ref|NP_001142069.1| uncharacterized protein LOC100274226 [Zea mays]
 gb|ACF87578.1| unknown [Zea mays]
 gb|ACG35203.1| speckle-type POZ protein [Zea mays]
Length=399

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRF+KRT+LE SD+LK+DCL ++C VGVV++R E PK   I VP SD+G 
Sbjct  122  LKYRGSMWGYKRFYKRTLLEESDFLKNDCLVMNCTVGVVKNRIETPKDIQIHVPRSDMGR  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNM-SINVEDMEA  359
             F +LL    G D+ FEV  E   AHK +L+ARSPVF+AQ FGP+   ++ ++ VED+E 
Sbjct  182  CFKELLSRCIGCDITFEVRDEKVRAHKWILAARSPVFKAQFFGPIGKPDLHTVVVEDVEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             VFKA+++FIY D LP + EL G  S W ST++ QHLLAA+DRYGL RLR+LCE+ LC++
Sbjct  242  VVFKAMVNFIYADELPSIPELAGSASTWTSTVVVQHLLAAADRYGLVRLRILCESKLCDE  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQHHC +LKS CL
Sbjct  302  LTPETVATTLALAEQHHCAELKSACL  327



>ref|XP_003552772.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Glycine max]
 gb|KHN07596.1| BTB/POZ and MATH domain-containing protein 3 [Glycine soja]
Length=414

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 155/206 (75%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+RT LE+S+YLK+DCL +HC VGVV++R EG K   I VP SD+G 
Sbjct  129  LKYKGSMWGYKRFFRRTQLETSEYLKNDCLVMHCTVGVVKTRFEGSKQGVI-VPQSDMGR  187

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F  LLES  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D  +  + VED+E 
Sbjct  188  DFKDLLESEVGCDILFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPTLEEVVVEDIEP  247

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L F+Y D LP + E+     + + T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  248  FIFKAMLLFVYSDKLPGIYEVMDSMPLCSYTVMVQHLLAAADLYNLDRLKLLCESKLCEE  307

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQHHC QLK++CL
Sbjct  308  INTDNVATTLALAEQHHCPQLKAICL  333



>ref|XP_008789447.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Phoenix dactylifera]
Length=348

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRTALETSDYLKDDCLKINCTVGVVLSVMDSPRLHSIQVPESDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL+  +G+DV F+V GE F AHKLVL+ARSPVFRAQ F  +  +   I V DME  
Sbjct  187  HFGMLLDKQEGSDVVFDVAGEKFHAHKLVLAARSPVFRAQFFDELDCEKNEIVVTDMEPK  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNSMWASTL--MAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + L   +S  +S    +   LLAA+D+YGL+RL+L+CE+ LC+
Sbjct  247  VFEAMLHFIYRDTFVEDDALMASSSPASSVSDTLPGKLLAAADKYGLERLQLMCESYLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++N+VA+TLALA+QHH  +LK+ CL
Sbjct  307  DISVNSVASTLALADQHHAMELKAACL  333



>ref|XP_010918008.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=415

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRTALETSDYLKDDCLKINCTVGVVVSVMDSPRLHSIQVPESDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL+  +G+DV F+V GE F AHKLVL+ARSPVFRAQ F  +  +   I V DME  
Sbjct  187  HFGMLLDKQEGSDVVFDVAGEKFHAHKLVLAARSPVFRAQFFDELDCEKNEIVVTDMEPK  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNSMWASTL--MAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + L   +S  +S    +A  LLAA+D+YGL+RL+L+CE+ LC+
Sbjct  247  VFEAMLHFIYRDTFVEDDALIASSSPVSSVSDTLAGKLLAAADKYGLERLQLMCESYLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++N+VA+TLALA++HH  +LK+ CL
Sbjct  307  DISVNSVASTLALADRHHAMELKAACL  333



>ref|XP_008372036.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X2 [Malus domestica]
Length=357

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYK+FF+R++LE+S++LKDDCL ++C VGVVR+R E PK + I+VP SD+G 
Sbjct  137  LKYRGSMWGYKKFFRRSILETSEFLKDDCLVLNCTVGVVRTRLEQPKQFTITVPSSDMGR  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+S  G D+ F+V  E F AHKL+L+ARS VFRAQ +G + D N+   V     P
Sbjct  197  DLKDFLDSEAGCDIVFQVGDEQFKAHKLILAARSRVFRAQFYGLVGDCNVDKVVVKDVEP  256

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+ G + +   T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  257  FIFKAMLLFIYTDKLPDTHEVMGSSPLCTFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQH C QLK VCL
Sbjct  317  ITTETVATTLALAEQHQCRQLKDVCL  342



>ref|XP_006591356.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Glycine max]
Length=382

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 155/206 (75%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R++LE+S YLK+DCL +HC VGVV++R EG K   I VP SD+G 
Sbjct  130  LKYKGSMWGYKRFFRRSLLENSLYLKNDCLVMHCTVGVVKTRFEGSKQGVI-VPQSDMGR  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F  LLES  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D  +  + VED+E 
Sbjct  189  DFKDLLESEVGCDIVFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPTLEEVVVEDIEP  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LP + E+     + + T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  249  FIFKAMLLFIYSDKLPGIYEVMDSMPLCSYTVMVQHLLAAADLYNLDRLKLLCESKLCEE  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQHHC QLK++CL
Sbjct  309  INTDNVATTLALAEQHHCPQLKAICL  334



>ref|XP_003538428.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Glycine max]
 gb|KHN17888.1| BTB/POZ and MATH domain-containing protein 3 [Glycine soja]
Length=415

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 155/206 (75%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKY+GSMWGYKRFF+R++LE+S YLK+DCL +HC VGVV++R EG K   I VP SD+G 
Sbjct  130  LKYKGSMWGYKRFFRRSLLENSLYLKNDCLVMHCTVGVVKTRFEGSKQGVI-VPQSDMGR  188

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
             F  LLES  G D+ F+V  E+F AHKL+L+ARSPVFRAQ FG + D  +  + VED+E 
Sbjct  189  DFKDLLESEVGCDIVFKVKSESFKAHKLILAARSPVFRAQFFGLVGDPTLEEVVVEDIEP  248

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LP + E+     + + T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  249  FIFKAMLLFIYSDKLPGIYEVMDSMPLCSYTVMVQHLLAAADLYNLDRLKLLCESKLCEE  308

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +  + VATTLALAEQHHC QLK++CL
Sbjct  309  INTDNVATTLALAEQHHCPQLKAICL  334



>emb|CDY61778.1| BnaC03g72570D [Brassica napus]
Length=422

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LK +GSMWGYKRF +RT LE+SDYLKDD L I+C VGVVR+R EGPK + I +P SD+G 
Sbjct  144  LKCKGSMWGYKRFLRRTALEASDYLKDDSLVINCTVGVVRARLEGPKQFGIVLPSSDMGQ  203

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                LL+S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + N+  I +ED+E 
Sbjct  204  GLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPIGNNNVERIVIEDIEP  263

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S    T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  264  SIFKAMLSFIYTDVLPDVHEITGSASASLITNMIQHLLAAADLYDLGRLKVLCEVFLCEK  323

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLAL+EQ+   +LK+ CL
Sbjct  324  LNVDNVATTLALSEQYQLSELKAFCL  349



>ref|XP_009400061.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R  LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRAALETSDYLKDDCLKINCTVGVVVSVMDSPRLHSIQVPDSDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL++ +G+DV   V+GE F AHKLVL+ARSPVFRAQ F     Q   I V DME  
Sbjct  187  HFGALLDNQEGSDVIVHVSGEKFHAHKLVLAARSPVFRAQFFDDSDGQKSDIVVADMEPR  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNS--MWASTLMAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + LT  +S   +AS  +A  LLAASD+YGL+RLRLLCEA+LC+
Sbjct  247  VFEAMLHFIYRDTFIEDDVLTTSSSPESFASDTLAAKLLAASDKYGLERLRLLCEAHLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++++VA  L+LA+ +H  +LK+ CL
Sbjct  307  DISVDSVACILSLADCYHATELKAACL  333



>ref|XP_008789435.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=402

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRTALETSDYLKDDCLKINCTVGVVLSVMDSPRLHSIQVPESDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL+  +G+DV F+V GE F AHKLVL+ARSPVFRAQ F  +  +   I V DME  
Sbjct  187  HFGMLLDKQEGSDVVFDVAGEKFHAHKLVLAARSPVFRAQFFDELDCEKNEIVVTDMEPK  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNSMWASTL--MAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + L   +S  +S    +   LLAA+D+YGL+RL+L+CE+ LC+
Sbjct  247  VFEAMLHFIYRDTFVEDDALMASSSPASSVSDTLPGKLLAAADKYGLERLQLMCESYLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++N+VA+TLALA+QHH  +LK+ CL
Sbjct  307  DISVNSVASTLALADQHHAMELKAACL  333



>ref|XP_008372026.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Malus domestica]
Length=426

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYK+FF+R++LE+S++LKDDCL ++C VGVVR+R E PK + I+VP SD+G 
Sbjct  137  LKYRGSMWGYKKFFRRSILETSEFLKDDCLVLNCTVGVVRTRLEQPKQFTITVPSSDMGR  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+S  G D+ F+V  E F AHKL+L+ARS VFRAQ +G + D N+   V     P
Sbjct  197  DLKDFLDSEAGCDIVFQVGDEQFKAHKLILAARSRVFRAQFYGLVGDCNVDKVVVKDVEP  256

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+ G + +   T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  257  FIFKAMLLFIYTDKLPDTHEVMGSSPLCTFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQH C QLK VCL
Sbjct  317  ITTETVATTLALAEQHQCRQLKDVCL  342



>emb|CDY07638.1| BnaA03g18730D [Brassica napus]
Length=400

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LK +GSMWGYKRF +RT LE+SDYLKDD L I+C VGVVR+R E PK + + +P SD+G 
Sbjct  122  LKCKGSMWGYKRFLRRTALEASDYLKDDSLVINCTVGVVRARLEVPKQFGVVLPSSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                L++S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + N+  I +ED+E 
Sbjct  182  GLKDLIDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPIGNNNVERIVIEDIEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY DVLPD+ E+TG  S    T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  242  SIFKAMLSFIYTDVLPDVHEITGSASASLITNMIQHLLAAADLYDLGRLKVLCEVFLCEK  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   +LK+ CL
Sbjct  302  LNVDNVATTLALAEQHQLSELKAFCL  327



>ref|XP_009351416.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Pyrus x bretschneideri]
Length=357

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYK+FF+R++LE+S++LKDDCL ++C VGVVR+R E PK + I+VP SD+G 
Sbjct  137  LKYRGSMWGYKKFFRRSILETSEFLKDDCLVLNCTVGVVRTRLEQPKQFTITVPSSDMGR  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+S    D+ F+V  E F AHKL+L+ARS VFRAQ +G + D N+   V     P
Sbjct  197  DLRDFLDSEAACDIVFQVGDEQFKAHKLILAARSRVFRAQFYGLVGDCNVDKVVVKDVEP  256

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+ G + +   T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  257  FIFKAMLLFIYTDKLPDTHEVMGSSPLCTFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQH C QLK VCL
Sbjct  317  ITTETVATTLALAEQHQCQQLKDVCL  342



>ref|XP_009343897.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Pyrus x bretschneideri]
Length=357

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYK+FF+R++LE+S++LKDDCL ++C VGVVR+R E PK + I+VP SD+G 
Sbjct  137  LKYRGSMWGYKKFFRRSLLETSEFLKDDCLVLNCTVGVVRTRLEQPKQFTITVPLSDMGR  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+S  G D+ F+V  E   AHKL+L+ARS VFRAQ +G + D N+   V +   P
Sbjct  197  DLKDFLDSEAGCDIVFQVGDEQLKAHKLILAARSRVFRAQFYGLVGDCNVDKVVVEDVEP  256

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+ G + +   T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  257  FIFKAMLLFIYTDKLPDIHEVMGSSPLCTFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQH C QLK VCL
Sbjct  317  ITTETVATTLALAEQHQCRQLKDVCL  342



>ref|XP_009133382.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X2 [Brassica rapa]
Length=343

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 150/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LK +GSMWGYKRF +RT LE+SDYLKDD L I+C VGVVR+R E PK + + +P SD+G 
Sbjct  122  LKCKGSMWGYKRFLRRTALEASDYLKDDSLVINCTVGVVRARLEVPKQFGVVLPSSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                L++S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + N+  I +ED+E 
Sbjct  182  GLKDLIDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPIGNNNVERIVIEDIEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+TG  S    T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  242  SIFKAMLSFIYTDGLPDVHEITGSASASLITNMIQHLLAAADLYDLGRLKVLCEVFLCEK  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   +LK+ CL
Sbjct  302  LNVDNVATTLALAEQHQLSELKAFCL  327



>ref|XP_008811723.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Phoenix dactylifera]
Length=359

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+RT LE+SDYLKDDCL+I+C VGVV S  + P+ ++I VP SDIG+
Sbjct  127  LKYRGSMWGYKRFFRRTALETSDYLKDDCLKINCTVGVVVSVMDSPRLHSIQVPESDIGM  186

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LL+  +G+DV F+V GE F AHKLVL+ARSP+FRAQ F  +  +   I V DME  
Sbjct  187  HFGMLLDKQEGSDVVFDVAGEKFHAHKLVLAARSPMFRAQFFDELDCEESEIVVTDMEPK  246

Query  363  VFKALLHFIYCDVLPDMEELTGMNSMWASTL--MAQHLLAASDRYGLDRLRLLCEANLCE  536
            VF+A+LHFIY D   + + L   +S  +S    +A  LLAA+D+YGL+RLRL+CE+ LC+
Sbjct  247  VFEAMLHFIYRDTFIEDDALVASSSPESSMSDTLAGKLLAAADKYGLERLRLMCESYLCK  306

Query  537  DVTINTVATTLALAEQHHCFQLKSVCL  617
            D+++++VA+TL+LA+++H  +LK+ CL
Sbjct  307  DMSVDSVASTLSLADRYHAMELKAACL  333



>ref|XP_007015537.1| BTB/POZ and MATH domain-containing protein 4 isoform 2 [Theobroma 
cacao]
 gb|EOY33156.1| BTB/POZ and MATH domain-containing protein 4 isoform 2 [Theobroma 
cacao]
Length=348

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 159/209 (76%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYKRFF+R +LE+SDYLKDDCL+I+C VGVV S  +  + ++I VP S+IG 
Sbjct  132  LKYRGSMWGYKRFFRRALLETSDYLKDDCLKINCTVGVVVSAIDCSRLHSIQVPESNIGA  191

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
            HFG LLE+ +G+D+ F+V GE F AHKLVL+ARSPVFR++ F  M ++   I + + +  
Sbjct  192  HFGMLLENMEGSDITFDVAGEKFHAHKLVLAARSPVFRSEFFDGMDEEKQEIVITNFDPK  251

Query  363  VFKALLHFIYCDVLPDMEELTG----MNSMWASTLMAQHLLAASDRYGLDRLRLLCEANL  530
            VFKALLHFIY D L +  E  G      S  + TL+A+ LLAA+DRYGL+RL+L+CE++L
Sbjct  252  VFKALLHFIYRDTLSEDVESVGSTFSSVSSISETLIAK-LLAAADRYGLERLKLMCESHL  310

Query  531  CEDVTINTVATTLALAEQHHCFQLKSVCL  617
            C+++++N+VA  LALA+Q+H  +LK+VCL
Sbjct  311  CKNISVNSVAKILALADQYHASELKAVCL  339



>ref|XP_009133381.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Brassica rapa]
Length=400

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 150/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LK +GSMWGYKRF +RT LE+SDYLKDD L I+C VGVVR+R E PK + + +P SD+G 
Sbjct  122  LKCKGSMWGYKRFLRRTALEASDYLKDDSLVINCTVGVVRARLEVPKQFGVVLPSSDMGQ  181

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMS-INVEDMEA  359
                L++S  G D+ F+V  ET+ AHKL+L+ARSPVFRAQ +GP+ + N+  I +ED+E 
Sbjct  182  GLKDLIDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFYGPIGNNNVERIVIEDIEP  241

Query  360  PVFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD+ E+TG  S    T M QHLLAA+D Y L RL++LCE  LCE 
Sbjct  242  SIFKAMLSFIYTDGLPDVHEITGSASASLITNMIQHLLAAADLYDLGRLKVLCEVFLCEK  301

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            + ++ VATTLALAEQH   +LK+ CL
Sbjct  302  LNVDNVATTLALAEQHQLSELKAFCL  327



>ref|XP_009351410.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Pyrus x bretschneideri]
Length=426

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  3    LKYRGSMWGYKRFFKRTVLESSDYLKDDCLQIHCCVGVVRSRTEGPKTYAISVPPSDIGL  182
            LKYRGSMWGYK+FF+R++LE+S++LKDDCL ++C VGVVR+R E PK + I+VP SD+G 
Sbjct  137  LKYRGSMWGYKKFFRRSILETSEFLKDDCLVLNCTVGVVRTRLEQPKQFTITVPSSDMGR  196

Query  183  HFGQLLESGKGTDVNFEVNGETFAAHKLVLSARSPVFRAQLFGPMKDQNMSINVEDMEAP  362
                 L+S    D+ F+V  E F AHKL+L+ARS VFRAQ +G + D N+   V     P
Sbjct  197  DLRDFLDSEAACDIVFQVGDEQFKAHKLILAARSRVFRAQFYGLVGDCNVDKVVVKDVEP  256

Query  363  -VFKALLHFIYCDVLPDMEELTGMNSMWASTLMAQHLLAASDRYGLDRLRLLCEANLCED  539
             +FKA+L FIY D LPD  E+ G + +   T+M QHLLAA+D Y LDRL+LLCE+ LCE+
Sbjct  257  FIFKAMLLFIYTDKLPDTHEVMGSSPLCTFTVMVQHLLAAADLYNLDRLKLLCESKLCEE  316

Query  540  VTINTVATTLALAEQHHCFQLKSVCL  617
            +T  TVATTLALAEQH C QLK VCL
Sbjct  317  ITTETVATTLALAEQHQCQQLKDVCL  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520