BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003H12 412 bp,:Filtered

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006830462.1|  hypothetical protein AMTR_s00115p00112450        80.5    5e-17   
ref|XP_002516402.1|  conserved hypothetical protein                   66.2    9e-12   
ref|XP_002515778.1|  conserved hypothetical protein                   59.7    5e-09   
ref|XP_003588355.1|  Mitochondrial protein, putative                  52.8    3e-05   



>ref|XP_006830462.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda]
 gb|ERM97878.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda]
Length=61

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  ESEGKRGQPSARSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGFLRDR  3
            ESEGKRGQP ARSSNS QQTGMV  SKQL H RVPIGRQPF+GFLRDR
Sbjct  2    ESEGKRGQPMARSSNSFQQTGMVQQSKQLHHSRVPIGRQPFQGFLRDR  49



>ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46019.1| conserved hypothetical protein [Ricinus communis]
Length=52

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  38   RWVHESDEVALTTEPCLSVGANWMIGPRAAPSSPHSPFPN  157
            RWV ES EVAL TEPCL VGANWMIGPR   S PHSPFPN
Sbjct  12   RWVDESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPN  51



>ref|XP_002515778.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46617.1| conserved hypothetical protein [Ricinus communis]
Length=87

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  105  QFAPTDRHGSVVKATSSLSCTHRTAALSGVP  13
            QF PTDRHGSVVKATSSLSCT+RT ALSGVP
Sbjct  57   QFTPTDRHGSVVKATSSLSCTYRTIALSGVP  87



>ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula]
Length=1106

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 42/102 (41%), Gaps = 46/102 (45%)
 Frame = -3

Query  320  QGGTLCSLATPTLIKRLKAPTEDRSPNYDESFAF*SASRVGPGRVRKALMTQGSY*GKES  141
            +GGTLCSLATPTL  +       R           S    GPGRVRK             
Sbjct  670  EGGTLCSLATPTLTSKQVNYLLKRQ----------SRRATGPGRVRK-------------  706

Query  140  EGKRGQPSARSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGF  15
                                   SKQLRHFRVPIGRQPFRGF
Sbjct  707  -----------------------SKQLRHFRVPIGRQPFRGF  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567734137750