BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003H05 647 bp,

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  63.2    2e-08   Nicotiana tomentosiformis
ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               61.2    4e-08   Nicotiana sylvestris
dbj|BAM28759.1|  ROX1 homologue                                       58.9    4e-07   Nicotiana tabacum [American tobacco]
dbj|BAM28758.1|  ROX1 homologue                                       58.9    5e-07   Nicotiana benthamiana
ref|XP_009757117.1|  PREDICTED: protein E6                            58.2    7e-07   Nicotiana sylvestris
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    56.6    2e-06   Nicotiana tomentosiformis
ref|XP_002279294.1|  PREDICTED: protein E6                            56.2    2e-06   Vitis vinifera
gb|ABH01084.1|  putative ROX1                                         56.6    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               54.3    2e-05   Solanum lycopersicum
ref|XP_006364298.1|  PREDICTED: protein E6-like                       53.9    2e-05   Solanum tuberosum [potatoes]
ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  53.9    2e-05   Sesamum indicum [beniseed]
ref|XP_011096354.1|  PREDICTED: protein E6-like                       50.8    2e-04   Sesamum indicum [beniseed]
ref|XP_008225146.1|  PREDICTED: protein E6                            50.8    2e-04   Prunus mume [ume]
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              50.4    3e-04   Erythranthe guttata [common monkey flower]



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 7/71 (10%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSRnqfnnnggfdnnnnnndgfmennYQN  309
            EQQG+S TRF ENG+Y+YDVNTEKYA  PYENSR    NN  F NN            QN
Sbjct  434  EQQGISGTRFFENGKYFYDVNTEKYANDPYENSREFATNNNEFKNNFVWTK-------QN  486

Query  310  MEEFQDQEDLP  342
             E+FQD E++P
Sbjct  487  EEKFQDDEEMP  497



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSRnqfnnnggfdnnnnnndgfmennYQN  309
            +QQ MSDTRF+ENG+Y YDVNTEKY R PYENSR     N   DN  +N +      Y+N
Sbjct  199  QQQRMSDTRFLENGKYSYDVNTEKYVRDPYENSR--EFANSYADNELSNYNNVNFVKYEN  256

Query  310  MEEFQDQEDLP  342
             EEFQ + D+P
Sbjct  257  EEEFQPEGDMP  267



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINGEKHARDPYENAR  306



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ENGRYYYD+N+EK  R+ YENSR
Sbjct  172  KQQGMSDTRFLENGRYYYDLNSEKNYRNEYENSR  205



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  271  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  304



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  278  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  311



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKY-ARHPYE  222
            + QGMSDTRF+ENG+YYYDVNT+KY + HPYE
Sbjct  201  QPQGMSDTRFLENGKYYYDVNTDKYSSNHPYE  232



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 11/80 (14%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYAR-HPYENSRnqfn----------nnggfdnnnnn  276
            E QGMSDTR + NG+YYYD+NT +Y+R HPYE+ R               N   +    +
Sbjct  219  EPQGMSDTRSVGNGKYYYDINTGRYSRNHPYESLRGVGARNAYNNRNYYGNSENNGYELS  278

Query  277  ndgfmennYQNMEEFQDQED  336
            ++  +   YQN EEFQD+E+
Sbjct  279  SENSIGGGYQNQEEFQDEEN  298



>ref|XP_008225146.1| PREDICTED: protein E6 [Prunus mume]
Length=296

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEK-YARHPYENSR  231
            E+QGMSDTRF+ENGRY+YD+ +EK Y ++ YENSR
Sbjct  227  EKQGMSDTRFLENGRYHYDIGSEKNYNQNQYENSR  261



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 1/30 (3%)
 Frame = +1

Query  136  QGMSDTRFMENGRYYYDVNTEKY-ARHPYE  222
            QGMSDTR +ENG+YYYD+NTEKY + HPYE
Sbjct  177  QGMSDTRSLENGKYYYDLNTEKYNSNHPYE  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090