BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003G03 644 bp,

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004249238.1|  PREDICTED: two-component response regulator ...  75.9    3e-19   Solanum lycopersicum
ref|XP_006351272.1|  PREDICTED: two-component response regulator ...  76.3    4e-19   Solanum tuberosum [potatoes]
ref|XP_004249241.1|  PREDICTED: two-component response regulator ...  74.7    1e-18   Solanum lycopersicum
ref|XP_009606673.1|  PREDICTED: two-component response regulator ...  73.6    1e-18   Nicotiana tomentosiformis
ref|XP_009606674.1|  PREDICTED: two-component response regulator ...  73.2    2e-18   Nicotiana tomentosiformis
ref|XP_009776026.1|  PREDICTED: two-component response regulator ...  73.2    2e-18   Nicotiana sylvestris
ref|XP_006351276.1|  PREDICTED: two-component response regulator ...  74.3    2e-18   Solanum tuberosum [potatoes]
ref|XP_009594904.1|  PREDICTED: two-component response regulator ...  73.9    2e-18   Nicotiana tomentosiformis
ref|XP_009788178.1|  PREDICTED: two-component response regulator ...  73.6    2e-18   Nicotiana sylvestris
dbj|BAL43557.1|  type-A response regulator                            70.9    2e-17   Petunia x hybrida [garden petunia]
ref|XP_011075407.1|  PREDICTED: two-component response regulator ...  69.3    2e-17   Sesamum indicum [beniseed]
ref|XP_009776023.1|  PREDICTED: two-component response regulator ...  71.6    2e-17   Nicotiana sylvestris
ref|XP_004136644.1|  PREDICTED: two-component response regulator ...  70.9    2e-17   Cucumis sativus [cucumbers]
ref|XP_009776025.1|  PREDICTED: two-component response regulator ...  71.2    3e-17   Nicotiana sylvestris
ref|XP_004170407.1|  PREDICTED: two-component response regulator ...  70.1    4e-17   
ref|XP_011078970.1|  PREDICTED: two-component response regulator ...  69.7    4e-17   Sesamum indicum [beniseed]
ref|XP_009626718.1|  PREDICTED: two-component response regulator ...  70.9    5e-17   Nicotiana tomentosiformis
ref|XP_009626719.1|  PREDICTED: two-component response regulator ...  70.9    6e-17   Nicotiana tomentosiformis
ref|XP_010525479.1|  PREDICTED: two-component response regulator ...  66.6    1e-16   Tarenaya hassleriana [spider flower]
gb|EYU18643.1|  hypothetical protein MIMGU_mgv1a012918mg              65.5    1e-16   Erythranthe guttata [common monkey flower]
gb|ABG35777.1|  SRR217                                                67.8    1e-16   Striga asiatica [witchweed]
ref|XP_009803217.1|  PREDICTED: two-component response regulator ...  69.3    2e-16   Nicotiana sylvestris
ref|XP_009604813.1|  PREDICTED: two-component response regulator ...  68.9    2e-16   Nicotiana tomentosiformis
ref|XP_006402918.1|  hypothetical protein EUTSA_v10006209mg           68.9    2e-16   Eutrema salsugineum
ref|XP_010554778.1|  PREDICTED: two-component response regulator ...  68.9    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_008443275.1|  PREDICTED: two-component response regulator ...  70.5    2e-16   Cucumis melo [Oriental melon]
ref|XP_008443276.1|  PREDICTED: two-component response regulator ...  70.5    2e-16   
ref|XP_006603749.1|  PREDICTED: uncharacterized protein LOC100814...  65.1    4e-16   Glycine max [soybeans]
gb|ABG35781.1|  SRR197                                                66.2    6e-16   Striga asiatica [witchweed]
gb|KEH23599.1|  two-component response regulator ARR3-like protein    65.5    7e-16   Medicago truncatula
emb|CDP09526.1|  unnamed protein product                              64.7    8e-16   Coffea canephora [robusta coffee]
ref|XP_009139049.1|  PREDICTED: two-component response regulator ...  67.0    8e-16   Brassica rapa
emb|CDX76036.1|  BnaA04g03000D                                        66.6    1e-15   Brassica napus [oilseed rape]
gb|KHN14915.1|  Two-component response regulator ARR9                 65.1    1e-15   Glycine soja [wild soybean]
ref|NP_001241095.1|  uncharacterized protein LOC100814494             65.1    1e-15   Glycine max [soybeans]
gb|AFK36913.1|  unknown                                               64.3    2e-15   Medicago truncatula
emb|CDY06142.1|  BnaA09g36380D                                        67.8    2e-15   Brassica napus [oilseed rape]
emb|CDY65526.1|  BnaCnng47460D                                        67.4    2e-15   Brassica napus [oilseed rape]
ref|XP_006291782.1|  hypothetical protein CARUB_v10017962mg           63.5    3e-15   Capsella rubella
ref|XP_004493425.1|  PREDICTED: two-component response regulator ...  64.7    3e-15   Cicer arietinum [garbanzo]
emb|CDY30966.1|  BnaC04g24580D                                        66.2    6e-15   Brassica napus [oilseed rape]
ref|XP_006662727.1|  PREDICTED: two-component response regulator ...  60.5    7e-15   Oryza brachyantha
emb|CBX25288.1|  hypothetical_protein                                 60.5    7e-15   Oryza brachyantha
ref|XP_002513063.1|  Two-component response regulator ARR8, putative  67.4    9e-15   Ricinus communis
gb|EYU20798.1|  hypothetical protein MIMGU_mgv1a013608mg              63.2    9e-15   Erythranthe guttata [common monkey flower]
ref|XP_006854776.1|  hypothetical protein AMTR_s00063p00116400        59.3    9e-15   Amborella trichopoda
ref|XP_003545839.1|  PREDICTED: two-component response regulator ...  63.5    1e-14   
ref|XP_003541594.1|  PREDICTED: two-component response regulator ...  63.5    1e-14   Glycine max [soybeans]
emb|CBX24427.1|  hypothetical_protein                                 60.5    2e-14   Oryza glaberrima
emb|CBX25471.1|  hypothetical_protein                                 60.5    2e-14   Oryza glaberrima
ref|NP_001065722.1|  Os11g0143300                                     60.5    2e-14   
ref|NP_001066118.2|  Os12g0139400                                     60.5    2e-14   
ref|XP_007133766.1|  hypothetical protein PHAVU_011G207200g           63.5    2e-14   Phaseolus vulgaris [French bean]
gb|ABA91414.2|  Two-component response regulator ARR8, putative, ...  60.5    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591196.1|  PREDICTED: two-component response regulator ...  65.5    2e-14   Glycine max [soybeans]
ref|XP_006340119.1|  PREDICTED: two-component response regulator ...  66.2    2e-14   
gb|ACF81303.1|  unknown                                               62.0    3e-14   Zea mays [maize]
gb|ACG32848.1|  RR10 - Corn type-A response regulator                 62.0    3e-14   Zea mays [maize]
gb|AFK41171.1|  unknown                                               63.5    4e-14   Lotus japonicus
gb|ACN35670.1|  unknown                                               61.6    4e-14   Zea mays [maize]
gb|KHN37666.1|  Two-component response regulator ARR8                 62.0    4e-14   Glycine soja [wild soybean]
ref|NP_001104857.1|  LOC541632                                        61.6    4e-14   Zea mays [maize]
ref|XP_002442679.1|  hypothetical protein SORBIDRAFT_08g001140        61.6    4e-14   Sorghum bicolor [broomcorn]
ref|XP_002267404.1|  PREDICTED: two-component response regulator ...  63.5    5e-14   Vitis vinifera
ref|XP_003606051.1|  Two-component response regulator ARR9            63.9    6e-14   Medicago truncatula
emb|CBI40161.3|  unnamed protein product                              61.6    7e-14   Vitis vinifera
emb|CBX25376.1|  hypothetical_protein                                 60.5    7e-14   Oryza brachyantha
ref|XP_006663809.1|  PREDICTED: two-component response regulator ...  60.5    7e-14   Oryza brachyantha
ref|XP_002267932.1|  PREDICTED: two-component response regulator ...  61.6    9e-14   Vitis vinifera
ref|XP_004978644.1|  PREDICTED: two-component response regulator ...  60.5    1e-13   Setaria italica
ref|XP_004977508.1|  PREDICTED: two-component response regulator ...  60.5    1e-13   Setaria italica
gb|AFK34510.1|  unknown                                               64.3    1e-13   Medicago truncatula
ref|XP_004977507.1|  PREDICTED: two-component response regulator ...  60.1    1e-13   
ref|XP_011091843.1|  PREDICTED: two-component response regulator ...  62.8    2e-13   Sesamum indicum [beniseed]
ref|XP_002268352.1|  PREDICTED: two-component response regulator ...  60.5    2e-13   Vitis vinifera
emb|CBI40157.3|  unnamed protein product                              61.2    2e-13   Vitis vinifera
emb|CDP21047.1|  unnamed protein product                              57.8    3e-13   Coffea canephora [robusta coffee]
ref|XP_006355595.1|  PREDICTED: two-component response regulator ...  58.2    7e-13   Solanum tuberosum [potatoes]
gb|EYU34521.1|  hypothetical protein MIMGU_mgv1a018237mg              58.5    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_010670482.1|  PREDICTED: two-component response regulator ...  57.8    2e-12   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007028513.1|  Type-a response regulator                        72.4    3e-12   Theobroma cacao [chocolate]
ref|XP_002532588.1|  two-component system sensor histidine kinase...  71.6    6e-12   Ricinus communis
ref|XP_007162123.1|  hypothetical protein PHAVU_001G125800g           70.5    1e-11   Phaseolus vulgaris [French bean]
ref|XP_011088585.1|  PREDICTED: two-component response regulator ...  58.2    2e-11   Sesamum indicum [beniseed]
gb|AAQ10677.1|  type-A response regulator                             50.1    2e-11   Catharanthus roseus [chatas]
ref|XP_004308594.1|  PREDICTED: two-component response regulator ...  68.9    3e-11   Fragaria vesca subsp. vesca
ref|XP_010504624.1|  PREDICTED: two-component response regulator ...  68.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007202538.1|  hypothetical protein PRUPE_ppa011054mg           68.9    4e-11   Prunus persica
ref|XP_008244835.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   Prunus mume [ume]
ref|XP_002322625.1|  hypothetical protein POPTR_0016s03750g           68.9    4e-11   Populus trichocarpa [western balsam poplar]
emb|CBX43989.1|  putative A-type response regulator 7                 68.9    5e-11   Populus x canadensis [Canadian poplar]
ref|XP_007011051.1|  Two-component response regulator ARR8            68.6    5e-11   Theobroma cacao [chocolate]
ref|XP_008392405.1|  PREDICTED: two-component response regulator ...  68.6    5e-11   Malus domestica [apple tree]
ref|XP_003618307.1|  Two-component response regulator ARR9            60.8    6e-11   Medicago truncatula
ref|XP_009141979.1|  PREDICTED: two-component response regulator ...  67.4    6e-11   Brassica rapa
gb|KJB73094.1|  hypothetical protein B456_011G214300                  67.8    6e-11   Gossypium raimondii
ref|XP_004144338.1|  PREDICTED: two-component response regulator ...  68.9    7e-11   Cucumis sativus [cucumbers]
ref|XP_010504623.1|  PREDICTED: two-component response regulator ...  68.6    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006492506.1|  PREDICTED: two-component response regulator ...  68.6    7e-11   Citrus sinensis [Valencia orange]
ref|XP_002876392.1|  hypothetical protein ARALYDRAFT_486148           68.6    7e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002273990.1|  PREDICTED: two-component response regulator ...  68.2    7e-11   Vitis vinifera
gb|KHG15156.1|  Two-component response regulator ARR9 -like protein   67.8    7e-11   Gossypium arboreum [tree cotton]
ref|NP_191263.1|  two-component response regulator ARR9               68.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173818.1|  PREDICTED: two-component response regulator ...  68.6    8e-11   
ref|XP_009116409.1|  PREDICTED: two-component response regulator ...  68.2    8e-11   Brassica rapa
emb|CDY14761.1|  BnaC04g47580D                                        68.2    8e-11   Brassica napus [oilseed rape]
gb|AHM24030.1|  two-component response regulator                      68.2    9e-11   Rosa canina [dog briar]
ref|XP_006442056.1|  hypothetical protein CICLE_v10021937mg           68.2    9e-11   Citrus clementina
gb|KFK34943.1|  hypothetical protein AALP_AA5G214000                  68.2    9e-11   Arabis alpina [alpine rockcress]
ref|XP_008245632.1|  PREDICTED: two-component response regulator ...  67.4    9e-11   Prunus mume [ume]
emb|CDY06934.1|  BnaA04g23810D                                        67.8    9e-11   Brassica napus [oilseed rape]
gb|KDO39649.1|  hypothetical protein CISIN_1g026239mg                 68.2    1e-10   Citrus sinensis [Valencia orange]
ref|XP_009142738.1|  PREDICTED: two-component response regulator ...  67.8    1e-10   Brassica rapa
ref|XP_010516309.1|  PREDICTED: two-component response regulator ...  67.8    1e-10   Camelina sativa [gold-of-pleasure]
emb|CDX67674.1|  BnaA07g17140D                                        67.8    1e-10   Brassica napus [oilseed rape]
ref|XP_011000439.1|  PREDICTED: two-component response regulator ...  67.8    1e-10   Populus euphratica
ref|XP_008455700.1|  PREDICTED: two-component response regulator ...  68.9    1e-10   Cucumis melo [Oriental melon]
emb|CDY23856.1|  BnaC04g01810D                                        67.4    1e-10   Brassica napus [oilseed rape]
ref|XP_010427564.1|  PREDICTED: two-component response regulator ...  67.8    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008387409.1|  PREDICTED: two-component response regulator ...  67.4    1e-10   Malus domestica [apple tree]
ref|XP_009350930.1|  PREDICTED: two-component response regulator ...  67.4    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009339571.1|  PREDICTED: two-component response regulator ...  67.4    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010670479.1|  PREDICTED: two-component response regulator ...  67.0    1e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011027272.1|  PREDICTED: two-component response regulator ...  67.4    2e-10   Populus euphratica
ref|XP_002307983.2|  Two-component response regulator ARR8 family...  67.4    2e-10   Populus trichocarpa [western balsam poplar]
gb|KDP40526.1|  hypothetical protein JCGZ_24525                       66.6    2e-10   Jatropha curcas
emb|CBX43988.1|  putative A-type response regulator 6                 67.0    2e-10   Populus x canadensis [Canadian poplar]
gb|EYU38278.1|  hypothetical protein MIMGU_mgv1a019913mg              55.5    3e-10   Erythranthe guttata [common monkey flower]
gb|EPS61460.1|  hypothetical protein M569_13338                       63.5    3e-10   Genlisea aurea
ref|XP_009133480.1|  PREDICTED: two-component response regulator ...  66.2    3e-10   Brassica rapa
ref|XP_010525480.1|  PREDICTED: two-component response regulator ...  66.6    3e-10   Tarenaya hassleriana [spider flower]
ref|NP_181663.1|  response regulator 3                                66.2    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505899.1|  PREDICTED: two-component response regulator ...  66.2    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010508734.1|  PREDICTED: two-component response regulator ...  66.2    4e-10   Camelina sativa [gold-of-pleasure]
emb|CDX79942.1|  BnaA05g02140D                                        65.9    5e-10   Brassica napus [oilseed rape]
ref|XP_004303597.1|  PREDICTED: two-component response regulator ...  65.9    5e-10   Fragaria vesca subsp. vesca
ref|XP_006294950.1|  hypothetical protein CARUB_v10024006mg           65.9    5e-10   Capsella rubella
ref|XP_010672987.1|  PREDICTED: two-component response regulator ...  66.2    5e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CBX43986.1|  putative A-type response regulator 4                 65.1    6e-10   Populus x canadensis [Canadian poplar]
ref|XP_008231573.1|  PREDICTED: two-component response regulator ...  65.1    6e-10   Prunus mume [ume]
ref|XP_010672986.1|  PREDICTED: two-component response regulator ...  66.2    6e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002304795.2|  hypothetical protein POPTR_0003s19710g           65.1    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007220067.1|  hypothetical protein PRUPE_ppa025335mg           65.1    6e-10   Prunus persica
ref|XP_009361964.1|  PREDICTED: two-component response regulator ...  65.1    6e-10   Pyrus x bretschneideri [bai li]
ref|XP_011020390.1|  PREDICTED: two-component response regulator ...  65.1    7e-10   Populus euphratica
gb|KJB74992.1|  hypothetical protein B456_012G017600                  64.7    8e-10   Gossypium raimondii
ref|XP_009339985.1|  PREDICTED: two-component response regulator ...  65.1    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_011000562.1|  PREDICTED: two-component response regulator ...  64.3    1e-09   Populus euphratica
ref|XP_010095706.1|  Two-component response regulator                 64.7    1e-09   Morus notabilis
gb|KFK36982.1|  hypothetical protein AALP_AA4G197100                  65.1    1e-09   Arabis alpina [alpine rockcress]
ref|XP_002879919.1|  hypothetical protein ARALYDRAFT_483202           64.7    1e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_004511028.1|  PREDICTED: two-component response regulator ...  64.3    1e-09   Cicer arietinum [garbanzo]
ref|NP_001240226.1|  uncharacterized protein LOC100788079             65.1    1e-09   Glycine max [soybeans]
emb|CDX72077.1|  BnaC08g27970D                                        64.7    2e-09   Brassica napus [oilseed rape]
ref|XP_004140290.1|  PREDICTED: two-component response regulator ...  63.5    2e-09   Cucumis sativus [cucumbers]
ref|XP_010517619.1|  PREDICTED: two-component response regulator ...  64.3    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008465907.1|  PREDICTED: two-component response regulator ...  63.2    2e-09   Cucumis melo [Oriental melon]
ref|XP_010036352.1|  PREDICTED: two-component response regulator ...  63.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010276614.1|  PREDICTED: two-component response regulator ...  63.9    2e-09   Nelumbo nucifera [Indian lotus]
gb|KDO49056.1|  hypothetical protein CISIN_1g046192mg                 63.5    2e-09   Citrus sinensis [Valencia orange]
ref|XP_006420721.1|  hypothetical protein CICLE_v10005987mg           63.5    2e-09   Citrus clementina
ref|XP_010095966.1|  Two-component response regulator                 63.5    2e-09   Morus notabilis
ref|XP_006470938.1|  PREDICTED: two-component response regulator ...  63.2    3e-09   Citrus sinensis [Valencia orange]
ref|XP_003627814.1|  Two-component response regulator ARR8            62.8    4e-09   Medicago truncatula
ref|XP_010100530.1|  Two-component response regulator                 50.4    4e-09   Morus notabilis
ref|XP_004135221.1|  PREDICTED: two-component response regulator ...  49.3    4e-09   Cucumis sativus [cucumbers]
ref|XP_010670481.1|  PREDICTED: two-component response regulator ...  62.4    4e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008446266.1|  PREDICTED: two-component response regulator ...  49.3    4e-09   Cucumis melo [Oriental melon]
ref|XP_009104039.1|  PREDICTED: two-component response regulator ...  63.5    5e-09   Brassica rapa
gb|KDP37824.1|  hypothetical protein JCGZ_06726                       63.2    5e-09   Jatropha curcas
emb|CBX43987.1|  putative A-type response regulator 5                 62.8    5e-09   Populus x canadensis [Canadian poplar]
gb|ACU24220.1|  unknown                                               62.4    5e-09   Glycine max [soybeans]
ref|NP_001242179.1|  uncharacterized protein LOC100818762             62.4    5e-09   Glycine max [soybeans]
ref|NP_178754.1|  putative two-component response regulator protein   61.6    5e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KHN45795.1|  Two-component response regulator ARR9                 61.6    6e-09   Glycine soja [wild soybean]
ref|XP_006847932.1|  hypothetical protein AMTR_s00029p00125630        47.8    6e-09   Amborella trichopoda
ref|XP_009104038.1|  PREDICTED: two-component response regulator ...  63.2    7e-09   Brassica rapa
emb|CBI30106.3|  unnamed protein product                              61.6    7e-09   Vitis vinifera
ref|XP_007148939.1|  hypothetical protein PHAVU_005G027100g           62.0    7e-09   Phaseolus vulgaris [French bean]
ref|XP_007208910.1|  hypothetical protein PRUPE_ppa027113mg           50.8    7e-09   Prunus persica
ref|XP_008239693.1|  PREDICTED: two-component response regulator ...  50.4    9e-09   Prunus mume [ume]
emb|CDY22518.1|  BnaC03g23280D                                        62.0    9e-09   Brassica napus [oilseed rape]
ref|XP_008466725.1|  PREDICTED: two-component response regulator ...  50.4    9e-09   Cucumis melo [Oriental melon]
gb|KJB78543.1|  hypothetical protein B456_013G004700                  61.2    9e-09   Gossypium raimondii
ref|XP_010067733.1|  PREDICTED: two-component response regulator ...  61.6    1e-08   Eucalyptus grandis [rose gum]
ref|XP_004149797.1|  PREDICTED: two-component response regulator ...  50.4    1e-08   Cucumis sativus [cucumbers]
ref|XP_010044665.1|  PREDICTED: two-component response regulator ...  47.4    1e-08   Eucalyptus grandis [rose gum]
ref|XP_004171546.1|  PREDICTED: two-component response regulator ...  50.4    1e-08   
ref|XP_011034187.1|  PREDICTED: two-component response regulator ...  49.3    1e-08   Populus euphratica
gb|ABG35780.1|  SRR198                                                62.0    2e-08   Striga asiatica [witchweed]
gb|ABQ95670.1|  type A response regulator                             49.3    2e-08   Malus domestica [apple tree]
ref|XP_010931988.1|  PREDICTED: two-component response regulator ...  60.8    2e-08   Elaeis guineensis
emb|CBX43983.1|  putative A-type response regulator 1b                49.3    2e-08   Populus x canadensis [Canadian poplar]
emb|CBX43982.1|  putative A-type response regulator 1a                49.3    2e-08   Populus x canadensis [Canadian poplar]
ref|XP_008786946.1|  PREDICTED: two-component response regulator ...  60.8    2e-08   Phoenix dactylifera
gb|EMT09801.1|  Two-component response regulator ARR8                 61.2    2e-08   Aegilops tauschii
gb|KDP21284.1|  hypothetical protein JCGZ_21755                       48.1    2e-08   Jatropha curcas
ref|XP_009622543.1|  PREDICTED: two-component response regulator ...  60.5    2e-08   Nicotiana tomentosiformis
emb|CBI40158.3|  unnamed protein product                              60.1    2e-08   Vitis vinifera
ref|XP_006378200.1|  hypothetical protein POPTR_0010s04740g           48.9    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010645611.1|  PREDICTED: two-component response regulator ...  59.7    2e-08   Vitis vinifera
gb|EMS50922.1|  Two-component response regulator ARR8                 61.2    2e-08   Triticum urartu
ref|XP_009765982.1|  PREDICTED: two-component response regulator ...  60.5    2e-08   Nicotiana sylvestris
ref|XP_007223876.1|  hypothetical protein PRUPE_ppa010863mg           47.4    2e-08   Prunus persica
ref|XP_010044664.1|  PREDICTED: two-component response regulator ...  46.6    2e-08   Eucalyptus grandis [rose gum]
dbj|BAJ88185.1|  predicted protein                                    62.0    2e-08   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006378201.1|  hypothetical protein POPTR_0010s04740g           48.9    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009765983.1|  PREDICTED: two-component response regulator ...  60.5    3e-08   Nicotiana sylvestris
ref|XP_003578944.1|  PREDICTED: two-component response regulator ...  60.8    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_010238744.1|  PREDICTED: two-component response regulator ...  60.8    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_008244969.1|  PREDICTED: two-component response regulator ...  47.4    3e-08   Prunus mume [ume]
ref|XP_009386845.1|  PREDICTED: two-component response regulator ...  60.5    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010269353.1|  PREDICTED: two-component response regulator ...  60.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010269354.1|  PREDICTED: two-component response regulator ...  60.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002322145.2|  hypothetical protein POPTR_0015s08130g           46.6    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002284504.2|  PREDICTED: two-component response regulator ...  50.8    4e-08   Vitis vinifera
ref|XP_010664202.1|  PREDICTED: two-component response regulator ...  50.8    4e-08   Vitis vinifera
emb|CBI19004.3|  unnamed protein product                              50.8    4e-08   Vitis vinifera
ref|XP_006411396.1|  hypothetical protein EUTSA_v10017200mg           60.5    5e-08   Eutrema salsugineum
ref|XP_011028649.1|  PREDICTED: two-component response regulator ...  46.2    5e-08   Populus euphratica
ref|XP_008374475.1|  PREDICTED: two-component response regulator ...  48.1    5e-08   Malus domestica [apple tree]
ref|XP_010683319.1|  PREDICTED: two-component response regulator ...  48.9    5e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAK14395.1|AF339732_1  response regulator protein                  50.1    5e-08   Dianthus caryophyllus [carnation]
ref|XP_009391546.1|  PREDICTED: two-component response regulator ...  59.3    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008388361.1|  PREDICTED: two-component response regulator ...  45.8    7e-08   Malus domestica [apple tree]
ref|XP_006856915.1|  hypothetical protein AMTR_s00055p00222350        48.9    8e-08   Amborella trichopoda
ref|XP_007044474.1|  Two-component response regulator ARR4            46.2    1e-07   Theobroma cacao [chocolate]
ref|XP_010547354.1|  PREDICTED: two-component response regulator ...  58.9    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_010922156.1|  PREDICTED: two-component response regulator ...  58.9    1e-07   Elaeis guineensis
ref|XP_002322144.1|  hypothetical protein POPTR_0015s08130g           46.6    1e-07   Populus trichocarpa [western balsam poplar]
gb|AFG52076.1|  hypothetical protein 0_7819_01                        46.6    1e-07   Pinus taeda
ref|XP_010063402.1|  PREDICTED: two-component response regulator ...  45.4    1e-07   Eucalyptus grandis [rose gum]
ref|XP_010652890.1|  PREDICTED: two-component response regulator ...  47.4    1e-07   Vitis vinifera
emb|CAN69259.1|  hypothetical protein VITISV_026384                   47.4    1e-07   Vitis vinifera
gb|ACO88941.1|  cytokinin A-type response regulator 1                 48.1    1e-07   Vitis vinifera
gb|AFG52083.1|  hypothetical protein 0_7819_01                        46.2    1e-07   Pinus taeda
ref|XP_004233018.1|  PREDICTED: two-component response regulator ...  58.2    1e-07   Solanum lycopersicum
ref|XP_009399982.1|  PREDICTED: two-component response regulator ...  58.5    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011028652.1|  PREDICTED: two-component response regulator ...  46.2    1e-07   Populus euphratica
ref|XP_004504496.1|  PREDICTED: two-component response regulator ...  46.6    2e-07   Cicer arietinum [garbanzo]
ref|XP_010926969.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   Elaeis guineensis
ref|XP_010683320.1|  PREDICTED: two-component response regulator ...  48.9    2e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AEW07642.1|  hypothetical protein 0_7819_01                        46.2    2e-07   Pinus radiata
ref|XP_009349081.1|  PREDICTED: two-component response regulator ...  44.3    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009362787.1|  PREDICTED: two-component response regulator ...  44.3    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008389572.1|  PREDICTED: two-component response regulator ...  45.8    2e-07   Malus domestica [apple tree]
gb|KHN47005.1|  Two-component response regulator ARR9                 47.0    2e-07   Glycine soja [wild soybean]
ref|XP_003526642.1|  PREDICTED: two-component response regulator ...  47.0    2e-07   Glycine max [soybeans]
ref|XP_008245269.1|  PREDICTED: two-component response regulator ...  51.6    2e-07   Prunus mume [ume]
ref|XP_008369375.1|  PREDICTED: two-component response regulator ...  43.5    2e-07   Malus domestica [apple tree]
ref|XP_008369376.1|  PREDICTED: two-component response regulator ...  43.1    2e-07   Malus domestica [apple tree]
ref|XP_008799106.1|  PREDICTED: two-component response regulator ...  58.2    2e-07   Phoenix dactylifera
gb|KHF99848.1|  Two-component response regulator ARR16 -like protein  42.4    2e-07   Gossypium arboreum [tree cotton]
ref|XP_006295143.1|  hypothetical protein CARUB_v10024214mg           44.7    2e-07   Capsella rubella
gb|KJB73023.1|  hypothetical protein B456_011G210000                  41.6    3e-07   Gossypium raimondii
gb|AFG52081.1|  hypothetical protein 0_7819_01                        45.1    3e-07   Pinus taeda
gb|KJB73006.1|  hypothetical protein B456_011G208900                  42.4    3e-07   Gossypium raimondii
ref|XP_009398196.1|  PREDICTED: two-component response regulator ...  41.2    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB73007.1|  hypothetical protein B456_011G208900                  42.7    3e-07   Gossypium raimondii
gb|KDP21642.1|  hypothetical protein JCGZ_03313                       42.0    4e-07   Jatropha curcas
ref|XP_009133448.1|  PREDICTED: two-component response regulator ...  40.8    4e-07   Brassica rapa
ref|XP_008808788.1|  PREDICTED: two-component response regulator ...  57.4    4e-07   Phoenix dactylifera
ref|XP_006645383.1|  PREDICTED: two-component response regulator ...  57.8    4e-07   Oryza brachyantha
ref|XP_010508820.1|  PREDICTED: two-component response regulator ...  40.4    4e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001189722.1|  two-component response regulator ARR16           42.0    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504497.1|  PREDICTED: two-component response regulator ...  46.6    5e-07   Cicer arietinum [garbanzo]
ref|XP_010095967.1|  Two-component response regulator                 58.5    5e-07   Morus notabilis
ref|XP_010517507.1|  PREDICTED: two-component response regulator ...  40.4    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011071285.1|  PREDICTED: two-component response regulator ...  45.8    5e-07   Sesamum indicum [beniseed]
ref|XP_002456944.1|  hypothetical protein SORBIDRAFT_03g046040        57.8    5e-07   Sorghum bicolor [broomcorn]
gb|KHG18552.1|  Two-component response regulator ARR16 -like protein  42.0    5e-07   Gossypium arboreum [tree cotton]
emb|CDP00229.1|  unnamed protein product                              45.4    6e-07   Coffea canephora [robusta coffee]
ref|XP_008799105.1|  PREDICTED: two-component response regulator ...  57.8    6e-07   Phoenix dactylifera
ref|XP_010668381.1|  PREDICTED: two-component response regulator ...  45.1    6e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU35194.1|  hypothetical protein MIMGU_mgv1a015731mg              40.8    6e-07   Erythranthe guttata [common monkey flower]
gb|KJB77155.1|  hypothetical protein B456_012G123500                  43.1    6e-07   Gossypium raimondii
gb|ABQ95669.1|  response regulator                                    46.2    6e-07   Malus domestica [apple tree]
ref|XP_009360508.1|  PREDICTED: two-component response regulator ...  45.4    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_007208607.1|  hypothetical protein PRUPE_ppa021876mg           50.4    7e-07   Prunus persica
gb|ABQ95668.1|  response regulator                                    46.2    7e-07   
ref|XP_006295142.1|  hypothetical protein CARUB_v10024214mg           42.7    8e-07   
ref|XP_009763111.1|  PREDICTED: two-component response regulator ...  47.0    8e-07   
ref|XP_002520876.1|  two-component system sensor histidine kinase...  43.5    8e-07   
ref|XP_002984192.1|  type A response regulator                        43.5    8e-07   
ref|XP_008339984.1|  PREDICTED: two-component response regulator ...  45.8    8e-07   
ref|XP_002879884.1|  hypothetical protein ARALYDRAFT_483126           40.0    9e-07   
ref|XP_002984191.1|  type A response regulator                        43.5    9e-07   
ref|XP_002972278.1|  hypothetical protein SELMODRAFT_97144            43.5    9e-07   
ref|XP_006439725.1|  hypothetical protein CICLE_v10022334mg           48.1    9e-07   
ref|XP_006838392.1|  hypothetical protein AMTR_s00002p00074510        56.6    1e-06   
ref|NP_001238075.1|  uncharacterized protein LOC100527828             47.0    1e-06   
ref|XP_003517746.1|  PREDICTED: two-component response regulator ...  45.1    1e-06   
ref|XP_006476689.1|  PREDICTED: two-component response regulator ...  48.1    1e-06   
ref|XP_009133449.1|  PREDICTED: two-component response regulator ...  40.4    1e-06   
gb|KCW90058.1|  hypothetical protein EUGRSUZ_A02259                   54.7    1e-06   
ref|XP_003598557.1|  Two-component response regulator ARR9            55.5    1e-06   
emb|CDY22469.1|  BnaC03g22790D                                        42.4    1e-06   
gb|KHG06593.1|  Two-component response regulator ARR17 -like protein  42.4    1e-06   
ref|XP_010505819.1|  PREDICTED: two-component response regulator ...  40.4    1e-06   
ref|NP_181599.1|  two-component response regulator ARR16              40.0    1e-06   
ref|XP_010508821.1|  PREDICTED: two-component response regulator ...  40.0    1e-06   
ref|XP_010517508.1|  PREDICTED: two-component response regulator ...  40.0    1e-06   
ref|XP_011084814.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  41.6    2e-06   
ref|XP_010525414.1|  PREDICTED: two-component response regulator ...  41.6    2e-06   
gb|ABG35779.1|  SRR200                                                54.7    2e-06   
ref|XP_010668382.1|  PREDICTED: two-component response regulator ...  45.1    2e-06   
ref|XP_006358744.1|  PREDICTED: two-component response regulator ...  39.3    2e-06   
ref|XP_011086463.1|  PREDICTED: two-component response regulator ...  44.7    2e-06   
ref|XP_010322123.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  39.7    2e-06   
gb|AFK35812.1|  unknown                                               55.8    2e-06   
gb|AFK44366.1|  unknown                                               55.8    2e-06   
emb|CDX75990.1|  BnaA04g02540D                                        38.9    3e-06   
emb|CDY71200.1|  BnaCnng71830D                                        39.3    3e-06   
gb|KHN13452.1|  Two-component response regulator ARR3                 45.4    3e-06   
ref|NP_001235042.1|  uncharacterized protein LOC100305926             45.4    3e-06   
dbj|BAM74646.1|  type-A response regulator                            40.0    3e-06   
ref|XP_008446956.1|  PREDICTED: two-component response regulator ...  54.3    3e-06   
emb|CDY27219.1|  BnaA09g35830D                                        39.3    4e-06   
emb|CDX72141.1|  BnaC08g27330D                                        38.9    4e-06   
ref|XP_009116342.1|  PREDICTED: two-component response regulator ...  38.9    4e-06   
ref|XP_004308985.1|  PREDICTED: two-component response regulator ...  40.0    4e-06   
ref|XP_009139104.1|  PREDICTED: two-component response regulator ...  38.9    4e-06   
ref|XP_010095968.1|  Two-component response regulator                 55.5    4e-06   
ref|XP_003565091.1|  PREDICTED: two-component response regulator ...  54.7    4e-06   
ref|XP_010505820.1|  PREDICTED: two-component response regulator ...  38.9    4e-06   
ref|XP_010067618.1|  PREDICTED: two-component response regulator ...  42.7    5e-06   
gb|ACG27358.1|  RR6 - Corn type-A response regulator                  38.9    5e-06   
gb|KHF98141.1|  Two-component response regulator ARR9 -like protein   42.4    5e-06   
ref|XP_010525415.1|  PREDICTED: two-component response regulator ...  40.0    5e-06   
ref|NP_001045420.1|  Os01g0952500                                     54.7    5e-06   
ref|XP_003543102.1|  PREDICTED: two-component response regulator ...  41.2    6e-06   
gb|KJB64419.1|  hypothetical protein B456_010G051300                  42.4    6e-06   
ref|XP_009590654.1|  PREDICTED: two-component response regulator ...  38.5    6e-06   
gb|KEH41351.1|  two-component response regulator ARR3-like protein    42.0    7e-06   
ref|NP_001149868.1|  RR4 - Corn type-A response regulator             54.7    7e-06   
ref|NP_001104856.1|  response regulator 5                             54.3    8e-06   
ref|XP_006411334.1|  hypothetical protein EUTSA_v10017348mg           40.0    8e-06   
gb|KJB64418.1|  hypothetical protein B456_010G051300                  41.6    8e-06   
ref|XP_008782007.1|  PREDICTED: two-component response regulator ...  53.9    9e-06   
dbj|BAM74645.1|  type-A response regulator                            53.9    9e-06   
ref|NP_001130159.1|  uncharacterized protein LOC100191253             54.3    1e-05   
ref|XP_009382585.1|  PREDICTED: two-component response regulator ...  53.5    1e-05   
ref|NP_567037.1|  two-component response regulator ARR17              38.5    1e-05   
gb|KFK36939.1|  hypothetical protein AALP_AA4G192000                  43.9    1e-05   
ref|XP_010427456.1|  PREDICTED: two-component response regulator ...  39.3    1e-05   
ref|XP_002876364.1|  predicted protein                                38.5    1e-05   
ref|XP_009139105.1|  PREDICTED: two-component response regulator ...  38.5    1e-05   
ref|XP_001763595.1|  predicted protein                                43.1    1e-05   
ref|XP_009116343.1|  PREDICTED: two-component response regulator ...  38.9    1e-05   
gb|AEV76988.1|  type A response regulator 4                           53.5    1e-05   
ref|XP_004971287.1|  PREDICTED: two-component response regulator ...  53.5    1e-05   
gb|ACN62086.1|  response regulator 1                                  52.8    2e-05   
dbj|BAA34730.1|  response regulator 6                                 52.4    2e-05   
ref|XP_004971286.1|  PREDICTED: two-component response regulator ...  53.5    2e-05   
emb|CBI40160.3|  unnamed protein product                              42.0    2e-05   
ref|XP_010276615.1|  PREDICTED: two-component response regulator ...  52.0    2e-05   
ref|XP_010938571.1|  PREDICTED: two-component response regulator ...  53.1    2e-05   
ref|XP_009374451.1|  PREDICTED: two-component response regulator ...  44.7    2e-05   
ref|XP_006402153.1|  hypothetical protein EUTSA_v10015424mg           38.1    2e-05   
emb|CDM86587.1|  unnamed protein product                              53.5    2e-05   
ref|XP_004142431.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
gb|KFK34102.1|  hypothetical protein AALP_AA5G102300                  52.4    3e-05   
ref|XP_006292820.1|  hypothetical protein CARUB_v10019069mg           37.7    3e-05   
gb|KDO80604.1|  hypothetical protein CISIN_1g0262472mg                50.4    3e-05   
gb|EMS47027.1|  Two-component response regulator ARR9                 52.4    3e-05   
gb|ABK25022.1|  unknown                                               38.1    3e-05   
ref|XP_009626245.1|  PREDICTED: two-component response regulator ...  43.9    3e-05   
gb|EYU42480.1|  hypothetical protein MIMGU_mgv1a0145051mg             51.2    3e-05   
ref|XP_009626258.1|  PREDICTED: two-component response regulator ...  43.9    3e-05   
ref|XP_009626253.1|  PREDICTED: two-component response regulator ...  43.9    3e-05   
gb|KFK36940.1|  hypothetical protein AALP_AA4G192000                  42.4    3e-05   
ref|XP_008384995.1|  PREDICTED: two-component response regulator ...  43.9    3e-05   
ref|XP_010427458.1|  PREDICTED: two-component response regulator ...  37.7    3e-05   
gb|ACG41700.1|  RR4 - Corn type-A response regulator                  52.8    3e-05   
ref|NP_001104855.1|  LOC541630                                        52.8    3e-05   
gb|EYU23878.1|  hypothetical protein MIMGU_mgv1a012238mg              43.5    3e-05   
gb|EYU23877.1|  hypothetical protein MIMGU_mgv1a012238mg              43.5    4e-05   
ref|XP_010507480.1|  PREDICTED: two-component response regulator ...  37.4    4e-05   
ref|XP_009777129.1|  PREDICTED: two-component response regulator ...  43.5    4e-05   
gb|KHN48630.1|  Two-component response regulator ARR5                 52.0    4e-05   
ref|XP_006291901.1|  hypothetical protein CARUB_v10018078mg           51.6    4e-05   
ref|XP_010426279.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_010252283.1|  PREDICTED: two-component response regulator ...  38.1    5e-05   
ref|XP_008466724.1|  PREDICTED: two-component response regulator ...  52.4    5e-05   
ref|XP_007155382.1|  hypothetical protein PHAVU_003G196500g           52.0    5e-05   
ref|XP_006579380.1|  PREDICTED: uncharacterized protein LOC100527...  52.0    5e-05   
ref|XP_010484006.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_010459459.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_010444157.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|NP_001237197.1|  uncharacterized protein LOC100527518             52.0    5e-05   
ref|XP_006404297.1|  hypothetical protein EUTSA_v10010754mg           51.6    5e-05   
ref|XP_006434215.1|  hypothetical protein CICLE_v10002312mg           52.4    5e-05   
ref|XP_006344995.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_010503433.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_003549646.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_002877596.1|  hypothetical protein ARALYDRAFT_906046           51.2    5e-05   
ref|XP_006600658.1|  PREDICTED: two-component response regulator ...  51.6    5e-05   
ref|XP_002866522.1|  hypothetical protein ARALYDRAFT_496477           51.2    5e-05   
ref|NP_190393.1|  two-component response regulator ARR5               51.2    5e-05   
ref|NP_201097.1|  two-component response regulator ARR6               51.2    6e-05   
emb|CDY54257.1|  BnaC01g42890D                                        51.2    6e-05   
ref|XP_006402992.1|  hypothetical protein EUTSA_v10006466mg           37.4    6e-05   
ref|XP_010515122.1|  PREDICTED: two-component response regulator ...  51.6    6e-05   
dbj|BAA34727.1|  response regulator 5                                 51.2    6e-05   
gb|ACL54727.1|  unknown                                               50.4    7e-05   
gb|AFK41993.1|  unknown                                               51.6    7e-05   
gb|KFK28019.1|  hypothetical protein AALP_AA8G460900                  51.2    7e-05   
ref|XP_010043832.1|  PREDICTED: two-component response regulator ...  51.6    8e-05   
ref|XP_009774749.1|  PREDICTED: two-component response regulator ...  36.6    1e-04   
gb|AAC26635.1|  two-component response regulator homolog              50.4    1e-04   
gb|AAP32005.1|  putative two-component system response regulator      48.5    1e-04   
gb|EEE57197.1|  hypothetical protein OsJ_07146                        42.0    1e-04   
ref|XP_009150827.1|  PREDICTED: two-component response regulator ...  51.2    1e-04   
ref|XP_006281027.1|  hypothetical protein CARUB_v10027044mg           51.2    1e-04   
ref|XP_002302230.2|  hypothetical protein POPTR_0002s08270g           51.2    1e-04   
ref|XP_011027510.1|  PREDICTED: two-component response regulator ...  51.2    1e-04   
emb|CBX43985.1|  putative A-type response regulator 3                 50.8    1e-04   
ref|XP_002961376.1|  type A response regulator                        40.8    2e-04   
ref|XP_008228315.1|  PREDICTED: two-component response regulator ...  50.1    2e-04   
ref|NP_001146776.1|  response regulator 4                             50.8    2e-04   
ref|XP_009351082.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
ref|XP_006394337.1|  hypothetical protein EUTSA_v10004962mg           50.1    2e-04   
ref|XP_002980896.1|  hypothetical protein SELMODRAFT_444661           40.4    2e-04   
gb|AFU91979.1|  response regulator 1 protein                          50.1    2e-04   
ref|XP_010674904.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
ref|XP_006472796.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
ref|XP_006472795.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
emb|CDY70164.1|  BnaCnng67000D                                        50.1    2e-04   
ref|XP_009149845.1|  PREDICTED: two-component response regulator ...  49.7    2e-04   
ref|XP_004299595.1|  PREDICTED: two-component response regulator ...  50.4    2e-04   
ref|XP_009351081.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
ref|XP_008378433.1|  PREDICTED: two-component response regulator ...  50.8    2e-04   
ref|XP_011021053.1|  PREDICTED: two-component response regulator ...  38.5    2e-04   
ref|XP_009631742.1|  PREDICTED: two-component response regulator ...  50.1    2e-04   
ref|XP_010277318.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_002312699.2|  hypothetical protein POPTR_0008s19730g           50.4    2e-04   
ref|XP_009351080.1|  PREDICTED: two-component response regulator ...  50.4    2e-04   
gb|ABK96781.1|  unknown                                               50.4    2e-04   
emb|CBX43984.1|  putative A-type response regulator 2                 50.4    2e-04   
gb|KFK43337.1|  hypothetical protein AALP_AA1G111900                  50.4    2e-04   
ref|XP_010111960.1|  Two-component response regulator                 50.1    3e-04   
emb|CBI40159.3|  unnamed protein product                              49.3    3e-04   
ref|XP_010550669.1|  PREDICTED: two-component response regulator ...  49.7    3e-04   
ref|XP_006842497.1|  hypothetical protein AMTR_s00077p00097790        36.6    3e-04   
ref|XP_004508816.1|  PREDICTED: two-component response regulator ...  49.7    3e-04   
ref|XP_011021052.1|  PREDICTED: two-component response regulator ...  38.1    3e-04   
ref|NP_172517.1|  two-component response regulator ARR4               50.1    3e-04   
ref|XP_001753701.1|  predicted protein                                40.8    3e-04   
ref|XP_011071752.1|  PREDICTED: two-component response regulator ...  49.7    3e-04   
ref|XP_011021054.1|  PREDICTED: two-component response regulator ...  37.7    3e-04   
gb|AES91134.2|  two-component response regulator ARR3-like protein    49.7    3e-04   
ref|XP_006304102.1|  hypothetical protein CARUB_v10010030mg           50.1    3e-04   
ref|XP_009796867.1|  PREDICTED: two-component response regulator ...  49.3    3e-04   
ref|XP_003608937.1|  Two-component response regulator ARR5            49.7    4e-04   
dbj|BAD16423.1|  putative response regulator 7                        40.0    4e-04   
ref|XP_002520201.1|  two-component sensor protein histidine prote...  49.7    4e-04   
emb|CDY59856.1|  BnaCnng35610D                                        48.9    4e-04   
ref|NP_001047142.2|  Os02g0557800                                     39.7    4e-04   
ref|XP_009151412.1|  PREDICTED: two-component response regulator ...  49.3    4e-04   
emb|CDY21807.1|  BnaA06g20760D                                        48.9    4e-04   
gb|EAY86293.1|  hypothetical protein OsI_07664                        39.7    4e-04   
ref|XP_001784311.1|  predicted protein                                40.0    5e-04   
ref|XP_004236156.1|  PREDICTED: two-component response regulator ...  48.9    5e-04   
ref|XP_006648745.1|  PREDICTED: two-component response regulator ...  39.3    5e-04   
ref|NP_176202.1|  response regulator 3                                49.3    5e-04   
ref|XP_002511471.1|  two-component sensor protein histidine prote...  49.3    5e-04   
ref|XP_002452271.1|  hypothetical protein SORBIDRAFT_04g022780        38.9    5e-04   
ref|XP_008680710.1|  PREDICTED: two-component response regulator ...  47.4    6e-04   
ref|XP_010243491.1|  PREDICTED: two-component response regulator ...  48.9    6e-04   
gb|KDP31161.1|  hypothetical protein JCGZ_11537                       48.9    6e-04   
ref|XP_002892573.1|  hypothetical protein ARALYDRAFT_888316           49.3    6e-04   
ref|XP_010510988.1|  PREDICTED: two-component response regulator ...  47.4    6e-04   
ref|NP_001104858.1|  response regulator 7                             38.9    6e-04   
ref|XP_006301719.1|  hypothetical protein CARUB_v10022177mg           48.9    7e-04   
gb|ACF82688.1|  unknown                                               38.9    7e-04   
ref|XP_004290880.1|  PREDICTED: two-component response regulator ...  48.9    7e-04   
ref|XP_010265270.1|  PREDICTED: two-component response regulator ...  48.5    8e-04   
ref|XP_010553643.1|  PREDICTED: two-component response regulator ...  48.9    8e-04   
ref|XP_010475910.1|  PREDICTED: two-component response regulator ...  48.9    8e-04   
gb|AGH13202.1|  cytokinin response regulator 5                        48.5    8e-04   
ref|XP_011006898.1|  PREDICTED: two-component response regulator ...  48.9    8e-04   
ref|XP_006836860.1|  hypothetical protein AMTR_s00099p00091470        38.1    8e-04   
gb|ACR36559.1|  unknown                                               38.5    8e-04   
ref|XP_010475909.1|  PREDICTED: two-component response regulator ...  48.9    9e-04   
ref|XP_010539939.1|  PREDICTED: two-component response regulator ...  48.1    9e-04   
gb|KDP32814.1|  hypothetical protein JCGZ_12106                       48.5    0.001   
ref|XP_007036075.1|  Two-component response regulator ARR5            48.5    0.001   
ref|XP_010491281.1|  PREDICTED: two-component response regulator ...  48.5    0.001   
ref|XP_007153682.1|  hypothetical protein PHAVU_003G056000g           48.5    0.001   



>ref|XP_004249238.1| PREDICTED: two-component response regulator ARR9 [Solanum lycopersicum]
Length=227

 Score = 75.9 bits (185),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKTK K P+
Sbjct  114  RISRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTKCKSPQ  152


 Score = 45.8 bits (107),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRISR
Sbjct  93   KESASLRNIPVVIMSSENVPSRISR  117



>ref|XP_006351272.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=226

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKP  18
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K P
Sbjct  117  RISRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCKSP  154


 Score = 45.4 bits (106),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRISR
Sbjct  96   KESASLRNIPVVIMSSENVPSRISR  120



>ref|XP_004249241.1| PREDICTED: two-component response regulator ARR8 [Solanum lycopersicum]
Length=239

 Score = 74.7 bits (182),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKP  18
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKTK K P
Sbjct  116  RISRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTKCKSP  153


 Score = 45.4 bits (106),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRISR
Sbjct  95   KESASLRNIPVVIMSSENVPSRISR  119



>ref|XP_009606673.1| PREDICTED: two-component response regulator ARR9 isoform X1 [Nicotiana 
tomentosiformis]
Length=222

 Score = 73.6 bits (179),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K
Sbjct  112  RISRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCK  147


 Score = 46.2 bits (108),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRISR
Sbjct  91   KESSSLRNIPVVIMSSENVPSRISR  115



>ref|XP_009606674.1| PREDICTED: two-component response regulator ARR9 isoform X2 [Nicotiana 
tomentosiformis]
Length=218

 Score = 73.2 bits (178),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K
Sbjct  108  RISRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCK  143


 Score = 46.2 bits (108),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRISR
Sbjct  87   KESSSLRNIPVVIMSSENVPSRISR  111



>ref|XP_009776026.1| PREDICTED: two-component response regulator ARR9-like isoform 
X3 [Nicotiana sylvestris]
Length=227

 Score = 73.2 bits (178),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK-PENNA  6
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K  P+  A
Sbjct  114  RISRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCKSLPQQEA  156


 Score = 46.2 bits (108),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRISR
Sbjct  93   KESSSLRNIPVVIMSSENVPSRISR  117



>ref|XP_006351276.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=226

 Score = 74.3 bits (181),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKP  18
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKTK K P
Sbjct  116  RISRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTKCKSP  153


 Score = 45.1 bits (105),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRISR
Sbjct  95   KESASLRNIPVVIMSSENVPSRISR  119



>ref|XP_009594904.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=225

 Score = 73.9 bits (180),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKT+SK  +  A
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTRSKSQQQEA  158


 Score = 45.4 bits (106),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  96   KESSSLRNIPVVIMSSENVPSRINR  120



>ref|XP_009788178.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
sylvestris]
Length=210

 Score = 73.6 bits (179),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLE GAEEFFLKPVRLSDVNKLRPHMMKT+SK  + +A
Sbjct  106  RINRCLEGGAEEFFLKPVRLSDVNKLRPHMMKTRSKSQQQDA  147


 Score = 45.1 bits (105),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  85   KESSSLRNIPVVIMSSENVPSRINR  109



>dbj|BAL43557.1| type-A response regulator [Petunia x hybrida]
Length=227

 Score = 70.9 bits (172),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMK+K K
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDVNKLRPHMMKSKCK  152


 Score = 45.1 bits (105),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  96   KESSSLRNIPVVIMSSENVPSRINR  120



>ref|XP_011075407.1| PREDICTED: two-component response regulator ARR8 [Sesamum indicum]
Length=231

 Score = 69.3 bits (168),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 6/46 (13%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS------KKPEN  12
            +I RCLEEGAEEF LKPVRLSDVNKLRPH+MK+KS      +KPEN
Sbjct  128  RINRCLEEGAEEFILKPVRLSDVNKLRPHIMKSKSICKDIIQKPEN  173


 Score = 46.2 bits (108),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES++LRNIPVVIMSSENVPSRI+R
Sbjct  107  KESAFLRNIPVVIMSSENVPSRINR  131



>ref|XP_009776023.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009776024.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Nicotiana sylvestris]
Length=246

 Score = 71.6 bits (174),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -1

Query  128  ICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK-PENNA  6
            + RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K  P+  A
Sbjct  134  VTRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCKSLPQQEA  175


 Score = 44.3 bits (103),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ESS LRNIPVVIMSSENVPSRIS
Sbjct  93   KESSSLRNIPVVIMSSENVPSRIS  116



>ref|XP_004136644.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 gb|KGN59458.1| hypothetical protein Csa_3G822100 [Cucumis sativus]
Length=226

 Score = 70.9 bits (172),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPVRL DVNKL+PHMMKTK K+ +N
Sbjct  122  RINRCLEEGAEEFFLKPVRLCDVNKLKPHMMKTKVKEDQN  161


 Score = 44.7 bits (104),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRI+R
Sbjct  101  KESTSLRNIPVVIMSSENVPSRINR  125



>ref|XP_009776025.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Nicotiana sylvestris]
Length=242

 Score = 71.2 bits (173),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -1

Query  128  ICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK-PENNA  6
            + RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K  P+  A
Sbjct  130  VTRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCKSLPQQEA  171


 Score = 44.3 bits (103),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ESS LRNIPVVIMSSENVPSRIS
Sbjct  89   KESSSLRNIPVVIMSSENVPSRIS  112



>ref|XP_004170407.1| PREDICTED: two-component response regulator ARR9-like, partial 
[Cucumis sativus]
Length=194

 Score = 70.1 bits (170),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPVRL DVNKL+PHMMKTK K+ +N
Sbjct  90   RINRCLEEGAEEFFLKPVRLCDVNKLKPHMMKTKVKEDQN  129


 Score = 44.3 bits (103),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRI+R
Sbjct  69   KESTSLRNIPVVIMSSENVPSRINR  93



>ref|XP_011078970.1| PREDICTED: two-component response regulator ARR9 [Sesamum indicum]
Length=227

 Score = 69.7 bits (169),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 11/51 (22%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK-----------SKKPEN  12
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMM+TK           ++KPEN
Sbjct  119  RITRCLEEGAEEFFLKPVRLSDVNKLKPHMMRTKCCNKDDDDDIQNQKPEN  169


 Score = 45.1 bits (105),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  98   KESSSLRNIPVVIMSSENVPSRITR  122



>ref|XP_009626718.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Nicotiana tomentosiformis]
Length=229

 Score = 70.9 bits (172),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K
Sbjct  119  RINRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCK  154


 Score = 43.5 bits (101),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  RNIPVVIMSSENVPSRI+R
Sbjct  98   KESSSFRNIPVVIMSSENVPSRINR  122



>ref|XP_009626719.1| PREDICTED: two-component response regulator ARR8-like isoform 
X2 [Nicotiana tomentosiformis]
Length=226

 Score = 70.9 bits (172),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK K
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKCK  151


 Score = 43.1 bits (100),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  RNIPVVIMSSENVPSRI+R
Sbjct  95   KESSSFRNIPVVIMSSENVPSRINR  119



>ref|XP_010525479.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Tarenaya hassleriana]
Length=245

 Score = 66.6 bits (161),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D++KL+PHMMKTK K
Sbjct  124  RISRCLEEGAEEFFLKPVRLADLSKLKPHMMKTKVK  159


 Score = 46.6 bits (109),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  339  LINSYIYFVVL*QESSYLRNIPVVIMSSENVPSRISR  229
            L+      V++ QESS  +NIPVVIMSSENVPSRISR
Sbjct  91   LLKKIKKNVLVLQESSAFKNIPVVIMSSENVPSRISR  127



>gb|EYU18643.1| hypothetical protein MIMGU_mgv1a012918mg [Erythranthe guttata]
Length=236

 Score = 65.5 bits (158),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHM+K
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDVNKLRPHMVK  148


 Score = 47.8 bits (112),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS+LRNIPVVIMSSENVPSRI+R
Sbjct  96   KESSFLRNIPVVIMSSENVPSRINR  120



>gb|ABG35777.1| SRR217 [Striga asiatica]
Length=220

 Score = 67.8 bits (164),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPVRLSDVNKLRPHMMK K
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDVNKLRPHMMKAK  149


 Score = 45.1 bits (105),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES++LR+IPVVIMSSENVPSRI+R
Sbjct  95   KESTFLRDIPVVIMSSENVPSRINR  119



>ref|XP_009803217.1| PREDICTED: two-component response regulator ARR9 [Nicotiana sylvestris]
Length=227

 Score = 69.3 bits (168),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKTK K
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTKCK  152


 Score = 43.1 bits (100),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  RNIPVVIMSSENVPSRI+R
Sbjct  96   KESSSFRNIPVVIMSSENVPSRINR  120



>ref|XP_009604813.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=228

 Score = 68.9 bits (167),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVNKL+PHMMKTK K
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDVNKLKPHMMKTKCK  152


 Score = 43.1 bits (100),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  RNIPVVIMSSENVPSRI+R
Sbjct  96   KESSSFRNIPVVIMSSENVPSRINR  120



>ref|XP_006402918.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
 gb|ESQ44371.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
Length=241

 Score = 68.9 bits (167),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADINKLKPHMMKTKLK  152


 Score = 43.5 bits (101),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +NIPVVIMSSENVP+RISR
Sbjct  96   KESSAFKNIPVVIMSSENVPARISR  120



>ref|XP_010554778.1| PREDICTED: two-component response regulator ARR9-like [Tarenaya 
hassleriana]
Length=233

 Score = 68.9 bits (167),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMK KSK
Sbjct  119  RITRCLEEGAEEFFLKPVRLADLNKLKPHMMKAKSK  154


 Score = 43.1 bits (100),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +N+PVVIMSSENVPSRI+R
Sbjct  98   KESSAFKNVPVVIMSSENVPSRITR  122



>ref|XP_008443275.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Cucumis melo]
Length=235

 Score = 70.5 bits (171),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPVRL DVNKL+PHMMKTK K+ +N
Sbjct  122  RINRCLEEGAEEFFLKPVRLCDVNKLKPHMMKTKVKEDQN  161


 Score = 41.6 bits (96),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  RNIPVVIMSSENVPSRI+R
Sbjct  101  KESTSRRNIPVVIMSSENVPSRINR  125



>ref|XP_008443276.1| PREDICTED: two-component response regulator ARR8-like isoform 
X2 [Cucumis melo]
Length=225

 Score = 70.5 bits (171),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPVRL DVNKL+PHMMKTK K+ +N
Sbjct  122  RINRCLEEGAEEFFLKPVRLCDVNKLKPHMMKTKVKEDQN  161


 Score = 41.6 bits (96),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  RNIPVVIMSSENVPSRI+R
Sbjct  101  KESTSRRNIPVVIMSSENVPSRINR  125



>ref|XP_006603749.1| PREDICTED: uncharacterized protein LOC100814494 isoform X1 [Glycine 
max]
Length=220

 Score = 65.1 bits (157),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PHM KTK K
Sbjct  90   RINRCLEEGAEEFFLKPVRLSDLNKLKPHMKKTKLK  125


 Score = 46.2 bits (108),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            QESS LRNIPVVIMSSENVPSRI+R
Sbjct  69   QESSSLRNIPVVIMSSENVPSRINR  93



>gb|ABG35781.1| SRR197 [Striga asiatica]
Length=211

 Score = 66.2 bits (160),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEG EEFFLKPVRLSDVNKLRPHMMK K
Sbjct  107  RINRCLEEGTEEFFLKPVRLSDVNKLRPHMMKAK  140


 Score = 44.7 bits (104),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS+LR+IPVVI+SSENVPSRI+R
Sbjct  86   KESSFLRDIPVVILSSENVPSRINR  110



>gb|KEH23599.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=239

 Score = 65.5 bits (158),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+L+PHM KTK K
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDLNRLKPHMKKTKLK  151


 Score = 45.1 bits (105),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  95   KESSSLRNIPVVIMSSENVPSRINR  119



>emb|CDP09526.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 64.7 bits (156),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK---PEN  12
            +I RCL+EGAEEFFLKPVRLSD+NKL+ HMMK+K K    PEN
Sbjct  118  RISRCLQEGAEEFFLKPVRLSDLNKLKTHMMKSKCKNHQMPEN  160


 Score = 45.8 bits (107),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRISR
Sbjct  97   KESSSLRNIPVVIMSSENVPSRISR  121



>ref|XP_009139049.1| PREDICTED: two-component response regulator ARR9-like [Brassica 
rapa]
Length=234

 Score = 67.0 bits (162),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPVR++D+NKL+PHMMKTK
Sbjct  111  RISRCLEEGAEEFFLKPVRMADLNKLKPHMMKTK  144


 Score = 43.5 bits (101),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +NIPVVIMSSENVP+RISR
Sbjct  90   KESSAFKNIPVVIMSSENVPARISR  114



>emb|CDX76036.1| BnaA04g03000D [Brassica napus]
Length=225

 Score = 66.6 bits (161),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPVR++D+NKL+PHMMKTK
Sbjct  111  RISRCLEEGAEEFFLKPVRMADLNKLKPHMMKTK  144


 Score = 43.5 bits (101),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +NIPVVIMSSENVP+RISR
Sbjct  90   KESSAFKNIPVVIMSSENVPARISR  114



>gb|KHN14915.1| Two-component response regulator ARR9 [Glycine soja]
Length=246

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PHM KTK K
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDLNKLKPHMKKTKLK  151


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  95   KESSSLRNIPVVIMSSENVPSRINR  119



>ref|NP_001241095.1| uncharacterized protein LOC100814494 [Glycine max]
 gb|ACU24338.1| unknown [Glycine max]
Length=244

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PHM KTK K
Sbjct  114  RINRCLEEGAEEFFLKPVRLSDLNKLKPHMKKTKLK  149


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  93   KESSSLRNIPVVIMSSENVPSRINR  117



>gb|AFK36913.1| unknown [Medicago truncatula]
Length=239

 Score = 64.3 bits (155),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+L+PHM KT+ K
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDLNRLKPHMKKTQLK  151


 Score = 45.1 bits (105),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LRNIPVVIMSSENVPSRI+R
Sbjct  95   KESSSLRNIPVVIMSSENVPSRINR  119



>emb|CDY06142.1| BnaA09g36380D [Brassica napus]
Length=236

 Score = 67.8 bits (164),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  113  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  148


 Score = 41.2 bits (95),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES   +NIPVVIMSSENVP+RISR
Sbjct  92   KESPAFKNIPVVIMSSENVPARISR  116



>emb|CDY65526.1| BnaCnng47460D [Brassica napus]
Length=158

 Score = 67.4 bits (163),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152


 Score = 42.0 bits (97),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +NIPVVIMSSENVP+RISR
Sbjct  96   KESSARKNIPVVIMSSENVPARISR  120



>ref|XP_006291782.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
 gb|EOA24680.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
Length=234

 Score = 63.5 bits (153),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGA EFF+KPVRL+D+NKL+PHMMKTK
Sbjct  117  RISRCLEEGALEFFVKPVRLADLNKLKPHMMKTK  150


 Score = 45.1 bits (105),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L+NIPVVIMSSENVP+RISR
Sbjct  96   KESSALKNIPVVIMSSENVPARISR  120



>ref|XP_004493425.1| PREDICTED: two-component response regulator ARR9-like [Cicer 
arietinum]
Length=219

 Score = 64.7 bits (156),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+L+PHM KTK K
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDLNRLKPHMKKTKLK  152


 Score = 43.9 bits (102),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ LRNIPVVIMSSENVPSRI+R
Sbjct  96   KESTSLRNIPVVIMSSENVPSRINR  120



>emb|CDY30966.1| BnaC04g24580D [Brassica napus]
Length=232

 Score = 66.2 bits (160),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPVR+ D+NKL+PHMMKTK
Sbjct  111  RISRCLEEGAEEFFLKPVRMDDLNKLKPHMMKTK  144


 Score = 41.2 bits (95),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES   +NIPVVIMSSENVP+RISR
Sbjct  90   KESPAFKNIPVVIMSSENVPARISR  114



>ref|XP_006662727.1| PREDICTED: two-component response regulator ARR9-like [Oryza 
brachyantha]
Length=200

 Score = 60.5 bits (145),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 47.0 bits (110),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSSEN+PSRI+R
Sbjct  91   KESSYLRDIPVVIMSSENIPSRINR  115



>emb|CBX25288.1| hypothetical_protein [Oryza brachyantha]
Length=200

 Score = 60.5 bits (145),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 47.0 bits (110),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSSEN+PSRI+R
Sbjct  91   KESSYLRDIPVVIMSSENIPSRINR  115



>ref|XP_002513063.1| Two-component response regulator ARR8, putative [Ricinus communis]
 gb|EEF49566.1| Two-component response regulator ARR8, putative [Ricinus communis]
Length=197

 Score = 67.4 bits (163),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+LSDVNKL+PHMMK K+++ E N
Sbjct  126  RINRCLEEGAEEFFLKPVQLSDVNKLKPHMMKGKTRENEPN  166


 Score = 39.3 bits (90),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES   ++IPVVIMSSENVPSRI+R
Sbjct  105  KESKSFKDIPVVIMSSENVPSRINR  129



>gb|EYU20798.1| hypothetical protein MIMGU_mgv1a013608mg [Erythranthe guttata]
Length=215

 Score = 63.2 bits (152),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPH---MMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPVRL+DVNKL+PH   MMK K+   EN
Sbjct  112  RITRCLEEGAEEFFLKPVRLTDVNKLKPHMIMMMKNKNHFQEN  154


 Score = 43.5 bits (101),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +E SYL+NIPVVIMSSENV SRI+R
Sbjct  91   KECSYLKNIPVVIMSSENVQSRITR  115



>ref|XP_006854776.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
 gb|ERN16243.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
Length=196

 Score = 59.3 bits (142),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKT  33
            +I RCLEEGAEEFFLKPV+LSD+ KL+PH+MK+
Sbjct  115  RITRCLEEGAEEFFLKPVQLSDMIKLKPHLMKS  147


 Score = 47.4 bits (111),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYL+NIPVVIMSSENVPSRI+R
Sbjct  94   KESSYLKNIPVVIMSSENVPSRITR  118



>ref|XP_003545839.1| PREDICTED: two-component response regulator ARR8-like [Glycine 
max]
 gb|KHN27335.1| Two-component response regulator ARR8 [Glycine soja]
Length=179

 Score = 63.5 bits (153),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+ +DVNKL+PH+MK+++K+ ++ 
Sbjct  115  RINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQ  155


 Score = 42.7 bits (99),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+NIPVVIMSSENVPSRI+R
Sbjct  94   KESKSLKNIPVVIMSSENVPSRINR  118



>ref|XP_003541594.1| PREDICTED: two-component response regulator ARR8-like [Glycine 
max]
Length=179

 Score = 63.5 bits (153),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+ +DVNKL+PH+MK+++K+ ++ 
Sbjct  115  RINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQ  155


 Score = 42.7 bits (99),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+NIPVVIMSSENVPSRI+R
Sbjct  94   KESKSLKNIPVVIMSSENVPSRINR  118



>emb|CBX24427.1| hypothetical_protein [Oryza glaberrima]
Length=207

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  118  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  154


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSS+N+PSRI+R
Sbjct  97   KESSYLRDIPVVIMSSDNIPSRINR  121



>emb|CBX25471.1| hypothetical_protein [Oryza glaberrima]
Length=201

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSS+N+PSRI+R
Sbjct  91   KESSYLRDIPVVIMSSDNIPSRINR  115



>ref|NP_001065722.1| Os11g0143300 [Oryza sativa Japonica Group]
 emb|CAI79413.1| Type A response regulator 9 [Oryza sativa Indica Group]
 dbj|BAE79353.1| typeA response regulator 9 [Oryza sativa Japonica Group]
 gb|ABA91415.2| Two-component response regulator ARR8, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27567.1| Os11g0143300 [Oryza sativa Japonica Group]
 tpd|FAA00260.1| TPA: A-type response regulator [Oryza sativa Japonica Group]
 dbj|BAG86743.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67658.1| hypothetical protein OsI_35072 [Oryza sativa Indica Group]
 gb|EEE51634.1| hypothetical protein OsJ_32929 [Oryza sativa Japonica Group]
Length=201

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSS+N+PSRI+R
Sbjct  91   KESSYLRDIPVVIMSSDNIPSRINR  115



>ref|NP_001066118.2| Os12g0139400 [Oryza sativa Japonica Group]
 dbj|BAE79354.1| typeA response regulator 10 [Oryza sativa Japonica Group]
 gb|ABA96406.2| Two-component response regulator ARR8, putative, expressed [Oryza 
sativa Japonica Group]
 tpd|FAA00261.1| TPA: A-type response regulator [Oryza sativa Japonica Group]
 gb|EEC68836.1| hypothetical protein OsI_37415 [Oryza sativa Indica Group]
 gb|EEE52746.1| hypothetical protein OsJ_35177 [Oryza sativa Japonica Group]
 dbj|BAF29137.2| Os12g0139400 [Oryza sativa Japonica Group]
Length=201

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSS+N+PSRI+R
Sbjct  91   KESSYLRDIPVVIMSSDNIPSRINR  115



>ref|XP_007133766.1| hypothetical protein PHAVU_011G207200g [Phaseolus vulgaris]
 gb|ESW05760.1| hypothetical protein PHAVU_011G207200g [Phaseolus vulgaris]
Length=230

 Score = 63.5 bits (153),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPV+ +DVNKL+PH+MK+++K+ +   L
Sbjct  165  RINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRTKEEQEQPL  207


 Score = 42.4 bits (98),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+NIPVVIMSSENVPSRI+R
Sbjct  144  KESKSLKNIPVVIMSSENVPSRINR  168



>gb|ABA91414.2| Two-component response regulator ARR8, putative, expressed [Oryza 
sativa Japonica Group]
Length=208

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  119  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  155


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYLR+IPVVIMSS+N+PSRI+R
Sbjct  98   KESSYLRDIPVVIMSSDNIPSRINR  122



>ref|XP_006591196.1| PREDICTED: two-component response regulator ARR9-like [Glycine 
max]
 gb|KHN21312.1| Two-component response regulator ARR9 [Glycine soja]
Length=187

 Score = 65.5 bits (158),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGA+EFFLKPV+ SDVNKLRPH+MK+K K  E+  +
Sbjct  116  RINRCLEEGADEFFLKPVQQSDVNKLRPHLMKSKVKDGEDQQI  158


 Score = 40.0 bits (92),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L++IPVVIMSSENVP+RI+R
Sbjct  95   KESKSLKDIPVVIMSSENVPARINR  119



>ref|XP_006340119.1| PREDICTED: two-component response regulator ARR8-like [Solanum 
tuberosum]
Length=289

 Score = 66.2 bits (160),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAE+F LKPVRL+DVNKL+PHMMKTK K
Sbjct  190  RISRCLEEGAEDFILKPVRLADVNKLKPHMMKTKCK  225


 Score = 39.3 bits (90),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+NIPVVIMSS NVPSRISR
Sbjct  169  KESPSLKNIPVVIMSSVNVPSRISR  193



>gb|ACF81303.1| unknown [Zea mays]
Length=235

 Score = 62.0 bits (149),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGA+EFFLKPVRLSD+NKL+PH++K++
Sbjct  151  RINRCLEEGADEFFLKPVRLSDMNKLKPHILKSR  184


 Score = 43.1 bits (100),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  130  KESSSLRDIPVVIMSSENIPSRINR  154



>gb|ACG32848.1| RR10 - Corn type-A response regulator [Zea mays]
Length=204

 Score = 62.0 bits (149),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGA+EFFLKPVRLSD+NKL+PH++K++
Sbjct  119  RINRCLEEGADEFFLKPVRLSDMNKLKPHILKSR  152


 Score = 43.1 bits (100),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  98   KESSSLRDIPVVIMSSENIPSRINR  122



>gb|AFK41171.1| unknown [Lotus japonicus]
Length=174

 Score = 63.5 bits (153),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPV+LSDV+KL+PH+MK++ K+ ++
Sbjct  109  RINRCLEEGAEEFFLKPVQLSDVHKLKPHLMKSRVKEEQD  148


 Score = 41.2 bits (95),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L++IPVVIMSSENVPSRI+R
Sbjct  88   KESKSLKDIPVVIMSSENVPSRINR  112



>gb|ACN35670.1| unknown [Zea mays]
 gb|AFW55821.1| response regulator 6 [Zea mays]
 gb|AIB05409.1| orphans transcription factor, partial [Zea mays]
Length=262

 Score = 61.6 bits (148),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGA+EFFLKPVRLSD+NKL+PH++K++
Sbjct  178  RINRCLEEGADEFFLKPVRLSDMNKLKPHILKSR  211


 Score = 43.1 bits (100),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  157  KESSSLRDIPVVIMSSENIPSRINR  181



>gb|KHN37666.1| Two-component response regulator ARR8 [Glycine soja]
Length=179

 Score = 62.0 bits (149),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+ +DVNKL+PH+MK++ K+ ++ 
Sbjct  115  RINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRPKEEQDQ  155


 Score = 42.7 bits (99),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+NIPVVIMSSENVPSRI+R
Sbjct  94   KESKSLKNIPVVIMSSENVPSRINR  118



>ref|NP_001104857.1| LOC541632 [Zea mays]
 dbj|BAB20581.1| response regulator 6 [Zea mays]
Length=235

 Score = 61.6 bits (148),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGA+EFFLKPVRLSD+NKL+PH++K++
Sbjct  151  RINRCLEEGADEFFLKPVRLSDMNKLKPHILKSR  184


 Score = 42.7 bits (99),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  130  KESSSLRDIPVVIMSSENIPSRINR  154



>ref|XP_002442679.1| hypothetical protein SORBIDRAFT_08g001140 [Sorghum bicolor]
 gb|EES16517.1| hypothetical protein SORBIDRAFT_08g001140 [Sorghum bicolor]
Length=236

 Score = 61.6 bits (148),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD+NKL+PH++K++ ++
Sbjct  147  RINRCLEEGADEFFLKPVRLSDMNKLKPHILKSRCRE  183


 Score = 42.7 bits (99),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  126  KESSSLRDIPVVIMSSENIPSRINR  150



>ref|XP_002267404.1| PREDICTED: two-component response regulator ARR8 [Vitis vinifera]
Length=220

 Score = 63.5 bits (153),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++K K++
Sbjct  114  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLLKGKAR  149


 Score = 40.8 bits (94),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ L++IPVVIMSSEN+PSRI+R
Sbjct  93   KESTSLKDIPVVIMSSENIPSRINR  117



>ref|XP_003606051.1| Two-component response regulator ARR9 [Medicago truncatula]
 gb|AES88248.1| response regulator, putative [Medicago truncatula]
Length=153

 Score = 63.9 bits (154),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPV+ SDVNKL+PH++KTK K  ++
Sbjct  97   RINRCLEEGAEEFFLKPVQQSDVNKLKPHLLKTKVKNEDD  136


 Score = 40.0 bits (92),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRISR  229
            ES+ L++IPVVIMSSENVPSRI+R
Sbjct  77   ESNSLKDIPVVIMSSENVPSRINR  100



>emb|CBI40161.3| unnamed protein product [Vitis vinifera]
Length=161

 Score = 61.6 bits (148),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++ +++
Sbjct  123  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLLGSRT  157


 Score = 42.0 bits (97),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L++IPVVIMSSEN+PSRI+R
Sbjct  102  KESSSLKDIPVVIMSSENIPSRINR  126



>emb|CBX25376.1| hypothetical_protein [Oryza brachyantha]
Length=215

 Score = 60.5 bits (145),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  119  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  155


 Score = 43.1 bits (100),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  98   KESSCLRDIPVVIMSSENIPSRINR  122



>ref|XP_006663809.1| PREDICTED: two-component response regulator ARR8-like [Oryza 
brachyantha]
Length=208

 Score = 60.5 bits (145),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 43.1 bits (100),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  91   KESSCLRDIPVVIMSSENIPSRINR  115



>ref|XP_002267932.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=146

 Score = 61.6 bits (148),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++ +++
Sbjct  108  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLLGSRT  142


 Score = 42.0 bits (97),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L++IPVVIMSSEN+PSRI+R
Sbjct  87   KESSSLKDIPVVIMSSENIPSRINR  111



>ref|XP_004978644.1| PREDICTED: two-component response regulator ARR9-like [Setaria 
italica]
Length=199

 Score = 60.5 bits (145),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  91   KESSSLRDIPVVIMSSENIPSRINR  115



>ref|XP_004977508.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Setaria italica]
Length=202

 Score = 60.5 bits (145),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  112  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  148


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  91   KESSSLRDIPVVIMSSENIPSRINR  115



>gb|AFK34510.1| unknown [Medicago truncatula]
Length=167

 Score = 64.3 bits (155),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPV+ SDVNKL+PH++KTK K  ++
Sbjct  111  RINRCLEEGAEEFFLKPVQQSDVNKLKPHLLKTKVKNEDD  150


 Score = 38.5 bits (88),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ L++IPVVI SSENVPSRI+R
Sbjct  90   KESNSLKDIPVVITSSENVPSRINR  114



>ref|XP_004977507.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Setaria italica]
Length=217

 Score = 60.1 bits (144),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA+EFFLKPVRLSD++KL+PH++K++ K+
Sbjct  127  RINRCLEEGADEFFLKPVRLSDMSKLKPHILKSRCKE  163


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR+IPVVIMSSEN+PSRI+R
Sbjct  106  KESSSLRDIPVVIMSSENIPSRINR  130



>ref|XP_011091843.1| PREDICTED: two-component response regulator ARR8-like [Sesamum 
indicum]
Length=187

 Score = 62.8 bits (151),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I  CLE+GAEEFFLKPVR SDVNKLRPH+M+   K+ E++
Sbjct  120  RINSCLEQGAEEFFLKPVRQSDVNKLRPHLMRKSGKRKEDH  160


 Score = 40.0 bits (92),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ES+ L++IPVVIMSSENVPSRI+
Sbjct  99   KESTLLKDIPVVIMSSENVPSRIN  122



>ref|XP_002268352.1| PREDICTED: two-component response regulator ARR17 [Vitis vinifera]
 emb|CBI40163.3| unnamed protein product [Vitis vinifera]
Length=197

 Score = 60.5 bits (145),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 4/45 (9%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS----KKPENN  9
            +I RCLEEGAE+FFLKPV+LSDV+KLRPH+++ K+    +KP+ N
Sbjct  108  RINRCLEEGAEDFFLKPVQLSDVSKLRPHLLRRKAEEEEEKPKRN  152


 Score = 42.0 bits (97),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L++IPVVIMSSEN+PSRI+R
Sbjct  87   KESSSLKDIPVVIMSSENIPSRINR  111



>emb|CBI40157.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 61.2 bits (147),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++K
Sbjct  114  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLLK  145


 Score = 40.8 bits (94),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+ L++IPVVIMSSEN+PSRI+R
Sbjct  93   KESTSLKDIPVVIMSSENIPSRINR  117



>emb|CDP21047.1| unnamed protein product [Coffea canephora]
Length=200

 Score = 57.8 bits (138),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLE+GA +FFLKPV+ SDVNKLRPH+++ K+++
Sbjct  129  RISRCLEDGAYDFFLKPVKQSDVNKLRPHLLRGKARE  165


 Score = 43.5 bits (101),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L++IPVVIMSSENVPSRISR
Sbjct  108  KESSSLKDIPVVIMSSENVPSRISR  132



>ref|XP_006355595.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=163

 Score = 58.2 bits (139),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPV+ SDVN+++PH+M+ K
Sbjct  94   RINRCLEEGAEEFFLKPVQQSDVNRIKPHLMREK  127


 Score = 42.4 bits (98),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -3

Query  297  SSYLRNIPVVIMSSENVPSRISR  229
            SSYL++IPV+IMSSENVPSRI+R
Sbjct  75   SSYLKDIPVIIMSSENVPSRINR  97



>gb|EYU34521.1| hypothetical protein MIMGU_mgv1a018237mg [Erythranthe guttata]
 gb|EYU42941.1| hypothetical protein MIMGU_mgv1a020458mg [Erythranthe guttata]
Length=178

 Score = 58.5 bits (140),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I  CLE+GAEEFFLKPV+ SDVNKL+PH+M+ K K+ + N
Sbjct  113  RINNCLEQGAEEFFLKPVKQSDVNKLKPHLMRGKGKENQPN  153


 Score = 40.4 bits (93),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ES+ L+NIPVVIMSSEN+PSRI+
Sbjct  92   KESTTLKNIPVVIMSSENIPSRIN  115



>ref|XP_010670482.1| PREDICTED: two-component response regulator ARR9-like [Beta vulgaris 
subsp. vulgaris]
Length=165

 Score = 57.8 bits (138),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCL +GAEEFFLKPV+LSDV+KL+PH++++K K
Sbjct  104  RINRCLADGAEEFFLKPVQLSDVDKLKPHLLRSKVK  139


 Score = 40.8 bits (94),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  LR+IPVVIMSSEN+P+RI+R
Sbjct  83   KESERLRDIPVVIMSSENIPARINR  107



>ref|XP_007028513.1| Type-a response regulator [Theobroma cacao]
 gb|EOY09015.1| Type-a response regulator [Theobroma cacao]
Length=213

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKLRPH+MKTKSK
Sbjct  116  RISRCLEEGAEEFFLKPVRLSDLNKLRPHLMKTKSK  151



>ref|XP_002532588.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
 gb|EEF29785.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
Length=221

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+LSD+N+LRPHMMKTKSK
Sbjct  116  RITRCLEEGAEEFFLKPVQLSDLNRLRPHMMKTKSK  151



>ref|XP_007162123.1| hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris]
 gb|ESW34117.1| hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris]
Length=241

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PHM KTKSK
Sbjct  117  RISRCLEEGAEEFFLKPVRLSDLNKLKPHMKKTKSK  152



>ref|XP_011088585.1| PREDICTED: two-component response regulator ARR9-like [Sesamum 
indicum]
Length=183

 Score = 58.2 bits (139),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I  C+E+GAEEFFLKPV+ SDVNKLRPH+M+ + K  +N+A
Sbjct  114  RINSCMEQGAEEFFLKPVQQSDVNKLRPHLMRGR-KSSQNHA  154


 Score = 37.7 bits (86),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ES   ++IPVVIMSSENVPSRI+
Sbjct  93   KESRLFKDIPVVIMSSENVPSRIN  116



>gb|AAQ10677.1| type-A response regulator [Catharanthus roseus]
Length=188

 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGA++FFLKPV+ SDVNKL P +  + + KP  N
Sbjct  112  RINRCLEEGADDFFLKPVKQSDVNKLIPLVPNSFTGKPIKN  152


 Score = 45.4 bits (106),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESSYL++IPVVIMSSEN+PSRI+R
Sbjct  91   KESSYLKDIPVVIMSSENIPSRINR  115



>ref|XP_004308594.1| PREDICTED: two-component response regulator ARR9-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+LSDVNKLRPHMMK  S + E N
Sbjct  120  RINRCLEEGAEEFFLKPVKLSDVNKLRPHMMKGTSMEDEAN  160



>ref|XP_010504624.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Camelina sativa]
Length=150

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  32   RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  67



>ref|XP_007202538.1| hypothetical protein PRUPE_ppa011054mg [Prunus persica]
 gb|EMJ03737.1| hypothetical protein PRUPE_ppa011054mg [Prunus persica]
Length=225

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MKTKSK
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDLSRLRPHIMKTKSK  152



>ref|XP_008244835.1| PREDICTED: two-component response regulator ARR8 [Prunus mume]
Length=225

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MKTKSK
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDLSRLRPHIMKTKSK  152



>ref|XP_002322625.1| hypothetical protein POPTR_0016s03750g [Populus trichocarpa]
 gb|EEF04386.1| hypothetical protein POPTR_0016s03750g [Populus trichocarpa]
Length=227

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+L+PHMMKTK K
Sbjct  118  RITRCLEEGAEEFFLKPVRLSDLNRLKPHMMKTKIK  153



>emb|CBX43989.1| putative A-type response regulator 7 [Populus x canadensis]
Length=227

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+L+PHMMKTK K
Sbjct  118  RITRCLEEGAEEFFLKPVRLSDLNRLKPHMMKTKIK  153



>ref|XP_007011051.1| Two-component response regulator ARR8 [Theobroma cacao]
 gb|EOY19861.1| Two-component response regulator ARR8 [Theobroma cacao]
Length=188

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLE+GAEEFFLKPV+LSDVNKLRPH+MK +SK+ + N
Sbjct  122  RINRCLEDGAEEFFLKPVQLSDVNKLRPHLMKGRSKEMQQN  162



>ref|XP_008392405.1| PREDICTED: two-component response regulator ARR9-like [Malus 
domestica]
Length=215

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MKTKS
Sbjct  117  RITRCLEEGAEEFFLKPVRLSDLSRLRPHLMKTKS  151



>ref|XP_003618307.1| Two-component response regulator ARR9 [Medicago truncatula]
 gb|AES74525.1| response regulator receiver domain protein [Medicago truncatula]
Length=207

 Score = 60.8 bits (146),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  152  YIGLMGLKICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            Y GL+     +C EEGAEEFFLKPV+ SDVNKL+PH++K++ K+ +   
Sbjct  155  YYGLIVCNCIKCFEEGAEEFFLKPVQQSDVNKLKPHLLKSRVKEEQEQT  203


 Score = 33.1 bits (74),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  288  LRNIPVVIMSSENVPSRIS  232
             ++IPVVIMSSENV SRIS
Sbjct  133  FKDIPVVIMSSENVSSRIS  151



>ref|XP_009141979.1| PREDICTED: two-component response regulator ARR8 [Brassica rapa]
Length=140

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK   N+
Sbjct  35   RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKKESENS  76



>gb|KJB73094.1| hypothetical protein B456_011G214300 [Gossypium raimondii]
Length=185

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLE+GAEEFFLKPV+LSDVNKLRPH+MK +SK  +++
Sbjct  132  RINRCLEDGAEEFFLKPVQLSDVNKLRPHLMKGRSKDIDSS  172



>ref|XP_004144338.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
Length=261

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK--KPENNA  6
            +I RCLEEGAEEFFLKPV+LSDVN+LRPHM+KTK K  KPE   
Sbjct  123  RINRCLEEGAEEFFLKPVQLSDVNRLRPHMLKTKLKCDKPERTT  166



>ref|XP_010504623.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Camelina sativa]
Length=235

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152



>ref|XP_006492506.1| PREDICTED: two-component response regulator ARR9-like [Citrus 
sinensis]
Length=238

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PH+MKTK K
Sbjct  116  RISRCLEEGAEEFFLKPVRLSDLNKLKPHLMKTKIK  151



>ref|XP_002876392.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52651.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  115  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  150



>ref|XP_002273990.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=218

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV++SDVN+L+PHMMK KSK
Sbjct  113  RITRCLEEGAEEFFLKPVQISDVNRLKPHMMKAKSK  148



>gb|KHG15156.1| Two-component response regulator ARR9 -like protein [Gossypium 
arboreum]
Length=185

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLE+GAEEFFLKPV+LSDVNKLRPH+MK +SK  +++
Sbjct  132  RINRCLEDGAEEFFLKPVQLSDVNKLRPHLMKGRSKDIDSS  172



>ref|NP_191263.1| two-component response regulator ARR9 [Arabidopsis thaliana]
 sp|O80366.1|ARR9_ARATH RecName: Full=Two-component response regulator ARR9; AltName: 
Full=Response reactor 4 [Arabidopsis thaliana]
 dbj|BAA31146.1| responce reactor4 [Arabidopsis thaliana]
 emb|CAB72174.1| responce reactor 4 [Arabidopsis thaliana]
 gb|AAL90898.1| AT3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AAM91401.1| At3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AEE79602.1| two-component response regulator ARR9 [Arabidopsis thaliana]
Length=234

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152



>ref|XP_004173818.1| PREDICTED: two-component response regulator ARR9-like, partial 
[Cucumis sativus]
Length=255

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK--KPENNA  6
            +I RCLEEGAEEFFLKPV+LSDVN+LRPHM+KTK K  KPE   
Sbjct  123  RINRCLEEGAEEFFLKPVQLSDVNRLRPHMLKTKLKCDKPERTT  166



>ref|XP_009116409.1| PREDICTED: two-component response regulator ARR9 [Brassica rapa]
Length=236

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  113  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  148



>emb|CDY14761.1| BnaC04g47580D [Brassica napus]
Length=222

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK----SKKP--ENNAL  3
            +I RCLEEGAEEFFLKPV+L+DV KL+PHMMKTK    S+KP  E+NA+
Sbjct  117  RISRCLEEGAEEFFLKPVKLADVTKLKPHMMKTKLKKESEKPSIEDNAV  165



>gb|AHM24030.1| two-component response regulator [Rosa canina]
Length=233

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLE+GAEEFFLKPVRLSD+N+LRPH++KTKSK
Sbjct  116  RINRCLEQGAEEFFLKPVRLSDLNRLRPHIIKTKSK  151



>ref|XP_006442056.1| hypothetical protein CICLE_v10021937mg [Citrus clementina]
 gb|ESR55296.1| hypothetical protein CICLE_v10021937mg [Citrus clementina]
Length=242

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PH+MKTK K
Sbjct  118  RISRCLEEGAEEFFLKPVRLSDLNKLKPHLMKTKIK  153



>gb|KFK34943.1| hypothetical protein AALP_AA5G214000 [Arabis alpina]
Length=242

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  114  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  149



>ref|XP_008245632.1| PREDICTED: two-component response regulator ARR9-like [Prunus 
mume]
Length=185

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+LSDVNKLRPHM+K K+ + ++N
Sbjct  118  RINRCLEEGAEEFFLKPVQLSDVNKLRPHMLKGKAMEDQSN  158



>emb|CDY06934.1| BnaA04g23810D [Brassica napus]
Length=222

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK   N+
Sbjct  117  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKKESENS  158



>gb|KDO39649.1| hypothetical protein CISIN_1g026239mg [Citrus sinensis]
Length=241

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PH+MKTK K
Sbjct  121  RISRCLEEGAEEFFLKPVRLSDLNKLKPHLMKTKIK  156



>ref|XP_009142738.1| PREDICTED: two-component response regulator ARR8-like [Brassica 
rapa]
Length=214

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+DV KL+PHMMKTK KK
Sbjct  110  RISRCLEEGAEEFFLKPVKLADVTKLKPHMMKTKLKK  146



>ref|XP_010516309.1| PREDICTED: two-component response regulator ARR9 [Camelina sativa]
Length=236

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152



>emb|CDX67674.1| BnaA07g17140D [Brassica napus]
Length=234

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152



>ref|XP_011000439.1| PREDICTED: two-component response regulator ARR8 [Populus euphratica]
Length=229

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGA+EFFLKPVRLSD+N+L+PHMMKTK K
Sbjct  118  RITRCLEEGADEFFLKPVRLSDLNRLKPHMMKTKIK  153



>ref|XP_008455700.1| PREDICTED: two-component response regulator ARR8-like [Cucumis 
melo]
Length=320

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSDVN+LRPHM+KTK K
Sbjct  183  RINRCLEEGAEEFFLKPVRLSDVNRLRPHMLKTKLK  218



>emb|CDY23856.1| BnaC04g01810D [Brassica napus]
Length=215

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+DV KL+PHMMKTK KK
Sbjct  111  RISRCLEEGAEEFFLKPVKLADVTKLKPHMMKTKLKK  147



>ref|XP_010427564.1| PREDICTED: two-component response regulator ARR9-like [Camelina 
sativa]
Length=235

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  128  ICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            I RCLEEGAEEFFLKPVRL+D+NKL+PHMMKTK K
Sbjct  118  ISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLK  152



>ref|XP_008387409.1| PREDICTED: two-component response regulator ARR9 [Malus domestica]
Length=223

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MKTKS
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDLSRLRPHLMKTKS  151



>ref|XP_009350930.1| PREDICTED: two-component response regulator ARR9-like [Pyrus 
x bretschneideri]
Length=215

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MK+KS
Sbjct  117  RITRCLEEGAEEFFLKPVRLSDLSRLRPHLMKSKS  151



>ref|XP_009339571.1| PREDICTED: two-component response regulator ARR9-like [Pyrus 
x bretschneideri]
Length=215

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MK+KS
Sbjct  117  RITRCLEEGAEEFFLKPVRLSDLSRLRPHLMKSKS  151



>ref|XP_010670479.1| PREDICTED: two-component response regulator ARR9-like [Beta vulgaris 
subsp. vulgaris]
Length=193

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKP  18
            +I RCLEEGAEEF LKPV+LSDV+KL+PH+M+++SK+P
Sbjct  116  RISRCLEEGAEEFLLKPVQLSDVDKLKPHIMRSRSKEP  153



>ref|XP_011027272.1| PREDICTED: two-component response regulator ARR8-like [Populus 
euphratica]
Length=229

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+N+L+PHMMKTK K
Sbjct  120  RITRCLEEGAEEFFLKPVRLADLNRLKPHMMKTKIK  155



>ref|XP_002307983.2| Two-component response regulator ARR8 family protein [Populus 
trichocarpa]
 gb|EEE91506.2| Two-component response regulator ARR8 family protein [Populus 
trichocarpa]
Length=235

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+N+L+PHMMKTK K
Sbjct  120  RITRCLEEGAEEFFLKPVRLADLNRLKPHMMKTKIK  155



>gb|KDP40526.1| hypothetical protein JCGZ_24525 [Jatropha curcas]
Length=185

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLEEGAEEFFLKPV+LSDVNKL+PH+MK K+K+ E
Sbjct  118  RINRCLEEGAEEFFLKPVQLSDVNKLKPHLMKGKAKEDE  156



>emb|CBX43988.1| putative A-type response regulator 6 [Populus x canadensis]
Length=230

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+N+L+PHMMKTK K
Sbjct  120  RITRCLEEGAEEFFLKPVRLADLNRLKPHMMKTKIK  155



>gb|EYU38278.1| hypothetical protein MIMGU_mgv1a019913mg [Erythranthe guttata]
Length=147

 Score = 55.5 bits (132),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I  C+E+GAEEFFLKPV+ SDVNKLRPH+++
Sbjct  111  RINSCMEQGAEEFFLKPVQQSDVNKLRPHLLR  142


 Score = 36.2 bits (82),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRIS  232
            +ES  L++IPVVIMSSENV SRI+
Sbjct  90   KESRLLKDIPVVIMSSENVASRIN  113



>gb|EPS61460.1| hypothetical protein M569_13338, partial [Genlisea aurea]
Length=65

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKP  18
            ++ RCLEEGAEEF LKPVRLSDV KL+PH+MK+K+++P
Sbjct  23   RVNRCLEEGAEEFLLKPVRLSDVKKLKPHIMKSKNEQP  60


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR*DCCKNN-EQFL  196
            QESSYLR+IPVVIMSSENVPSR++R  C +   E+FL
Sbjct  2    QESSYLRDIPVVIMSSENVPSRVNR--CLEEGAEEFL  36



>ref|XP_009133480.1| PREDICTED: two-component response regulator ARR8 [Brassica rapa]
 emb|CDY35419.1| BnaA03g19410D [Brassica napus]
Length=216

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK
Sbjct  113  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKK  149



>ref|XP_010525480.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Tarenaya hassleriana]
Length=238

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D++KL+PHMMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLSKLKPHMMKTKVK  152



>ref|NP_181663.1| response regulator 3 [Arabidopsis thaliana]
 sp|O80365.1|ARR8_ARATH RecName: Full=Two-component response regulator ARR8; AltName: 
Full=Response reactor 3 [Arabidopsis thaliana]
 dbj|BAA31145.1| responce reactor3 [Arabidopsis thaliana]
 gb|AAC78541.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AAL69459.1| At2g41310/F13H10.14 [Arabidopsis thaliana]
 dbj|BAF00286.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AEC09959.1| response regulator 3 [Arabidopsis thaliana]
Length=225

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKK  151



>ref|XP_010505899.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=224

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKK  151



>ref|XP_010508734.1| PREDICTED: two-component response regulator ARR8 [Camelina sativa]
Length=226

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKK  151



>emb|CDX79942.1| BnaA05g02140D [Brassica napus]
Length=215

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPV+L+DV KL+PHMMKTK
Sbjct  111  RISRCLEEGAEEFFLKPVKLADVTKLKPHMMKTK  144



>ref|XP_004303597.1| PREDICTED: two-component response regulator ARR8-like [Fragaria 
vesca subsp. vesca]
Length=225

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+N+LRP ++KTKSK
Sbjct  116  RINRCLEEGAEEFFLKPVRLSDLNRLRPRIIKTKSK  151



>ref|XP_006294950.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
 gb|EOA27848.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
Length=225

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK KK
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKK  151



>ref|XP_010672987.1| PREDICTED: two-component response regulator ARR8 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=249

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPVRLSDVN LRPHM++ K  + + + L
Sbjct  107  RITRCLEEGAEEFFLKPVRLSDVNSLRPHMLRAKYGQQQQDML  149



>emb|CBX43986.1| putative A-type response regulator 4 [Populus x canadensis]
Length=193

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAEEFFLKPV+LSDVNKLRPH+MK + K+ + 
Sbjct  122  RINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEDQ  161



>ref|XP_008231573.1| PREDICTED: two-component response regulator ARR9-like [Prunus 
mume]
Length=185

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+LSDVNKL+PHM+K ++ + ++N
Sbjct  118  RINRCLEEGAEEFFLKPVQLSDVNKLKPHMLKGRAMEDQSN  158



>ref|XP_010672986.1| PREDICTED: two-component response regulator ARR9 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=257

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPVRLSDVN LRPHM++ K  + + + L
Sbjct  115  RITRCLEEGAEEFFLKPVRLSDVNSLRPHMLRAKYGQQQQDML  157



>ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
 gb|EEE79774.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
Length=193

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLEEGAEEFFLKPV+LSDVNKLRPH+MK + K+ +
Sbjct  122  RINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEED  160



>ref|XP_007220067.1| hypothetical protein PRUPE_ppa025335mg [Prunus persica]
 gb|EMJ21266.1| hypothetical protein PRUPE_ppa025335mg [Prunus persica]
Length=185

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCLEEGAEEFFLKPV+LSDVNKL+PHM+K ++ + ++N
Sbjct  118  RINRCLEEGAEEFFLKPVQLSDVNKLKPHMLKGRAMEDQSN  158



>ref|XP_009361964.1| PREDICTED: two-component response regulator ARR9-like [Pyrus 
x bretschneideri]
Length=175

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGA+EFFLKPV+LSDVNKLRPHM+K +S
Sbjct  120  RINRCLEEGAQEFFLKPVQLSDVNKLRPHMLKGRS  154



>ref|XP_011020390.1| PREDICTED: two-component response regulator ARR8-like [Populus 
euphratica]
Length=193

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLEEGAEEFFLKPV+LSDVNKLRPH+MK + K+ +
Sbjct  122  RINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEED  160



>gb|KJB74992.1| hypothetical protein B456_012G017600 [Gossypium raimondii]
Length=189

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLE+GAEEFFLKPV+LSDVNKLRPH+MK  + K E
Sbjct  121  RINRCLEDGAEEFFLKPVKLSDVNKLRPHLMKGITTKNE  159



>ref|XP_009339985.1| PREDICTED: two-component response regulator ARR8-like [Pyrus 
x bretschneideri]
Length=224

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPVRLSD+++LRPH+MK KS
Sbjct  117  RINRCLEEGAEEFFLKPVRLSDLSRLRPHLMKAKS  151



>ref|XP_011000562.1| PREDICTED: two-component response regulator ARR8-like [Populus 
euphratica]
Length=192

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I RCL+EGAEEFFLKPV+LSDVNKLRPH+MK + K+ E +
Sbjct  122  RINRCLKEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEEED  162



>ref|XP_010095706.1| Two-component response regulator [Morus notabilis]
 gb|EXB61900.1| Two-component response regulator [Morus notabilis]
Length=217

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+LSD+ +LRPHM+KTK K
Sbjct  117  RITRCLEEGAEEFFLKPVQLSDLKRLRPHMVKTKVK  152



>gb|KFK36982.1| hypothetical protein AALP_AA4G197100 [Arabis alpina]
Length=231

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK K
Sbjct  119  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLK  154



>ref|XP_002879919.1| hypothetical protein ARALYDRAFT_483202 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56178.1| hypothetical protein ARALYDRAFT_483202 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 4/42 (10%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK----SKKP  18
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK    S+KP
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTKLKNESEKP  156



>ref|XP_004511028.1| PREDICTED: two-component response regulator ARR9-like [Cicer 
arietinum]
Length=179

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPV+ SDVNKL+PH++K++ K+ E  ++
Sbjct  115  RINRCLEEGAEEFFLKPVQQSDVNKLKPHLLKSRVKEEEEQSI  157



>ref|NP_001240226.1| uncharacterized protein LOC100788079 [Glycine max]
 gb|ACU21117.1| unknown [Glycine max]
 gb|KHN30383.1| Two-component response regulator ARR9 [Glycine soja]
Length=248

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRLSD+NKL+PHM KTK K
Sbjct  119  RINRCLEEGAEEFFLKPVRLSDLNKLKPHMKKTKFK  154



>emb|CDX72077.1| BnaC08g27970D [Brassica napus]
Length=235

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLE+GAEEFFLKPVRL+D+N L+PHMMKTK K
Sbjct  115  RISRCLEQGAEEFFLKPVRLADLNNLKPHMMKTKLK  150



>ref|XP_004140290.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 ref|XP_004170846.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 gb|KGN51089.1| hypothetical protein Csa_5G434550 [Cucumis sativus]
Length=156

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPV+LSDV KLRPH++K KS
Sbjct  119  RINRCLEEGAEEFFLKPVQLSDVRKLRPHLIKEKS  153



>ref|XP_010517619.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=223

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPV+L+D+ KL+PHMMKTK
Sbjct  115  RISRCLEEGAEEFFLKPVKLADLTKLKPHMMKTK  148



>ref|XP_008465907.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
melo]
Length=155

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLEEGAEEFFLKPV+LSDV KLRPH++K KS
Sbjct  118  RINRCLEEGAEEFFLKPVQLSDVRKLRPHLIKEKS  152



>ref|XP_010036352.1| PREDICTED: two-component response regulator ARR9-like [Eucalyptus 
grandis]
 gb|KCW47897.1| hypothetical protein EUGRSUZ_K01639 [Eucalyptus grandis]
Length=220

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVR SD+N+LRPH+MK  SK
Sbjct  118  RISRCLEEGAEEFFLKPVRKSDLNRLRPHVMKAVSK  153



>ref|XP_010276614.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Nelumbo nucifera]
Length=208

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+LSDVN+LRPH++K K K
Sbjct  115  RISRCLEEGAEEFFLKPVQLSDVNRLRPHLLKGKLK  150



>gb|KDO49056.1| hypothetical protein CISIN_1g046192mg [Citrus sinensis]
Length=187

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+DVNKL+PH+MK  SK+
Sbjct  107  RINRCLEEGAEEFFLKPVQLADVNKLKPHLMKGISKE  143



>ref|XP_006420721.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
 gb|ESR33961.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
Length=187

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+DVNKL+PH+MK  SK+
Sbjct  107  RINRCLEEGAEEFFLKPVQLADVNKLKPHLMKGISKE  143



>ref|XP_010095966.1| Two-component response regulator [Morus notabilis]
 gb|EXB62659.1| Two-component response regulator [Morus notabilis]
Length=195

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLE+GA+EFFLKPV+LSDVNKLRPH++K  SK
Sbjct  118  RINRCLEDGAQEFFLKPVQLSDVNKLRPHLLKGSSK  153



>ref|XP_006470938.1| PREDICTED: two-component response regulator ARR9-like [Citrus 
sinensis]
Length=187

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+L+DVNKL+PH+MK  SK
Sbjct  107  RINRCLEEGAEEFFLKPVQLADVNKLKPHLMKGISK  142



>ref|XP_003627814.1| Two-component response regulator ARR8 [Medicago truncatula]
 gb|ABE87636.1| Response regulator receiver [Medicago truncatula]
 gb|AET02290.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
 gb|AFK46256.1| unknown [Medicago truncatula]
Length=177

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+LSDV+KL+PH++K+K K+
Sbjct  115  RINRCLEEGAEEFFLKPVQLSDVSKLKPHLLKSKVKE  151



>ref|XP_010100530.1| Two-component response regulator [Morus notabilis]
 gb|EXB82664.1| Two-component response regulator [Morus notabilis]
Length=239

 Score = 50.4 bits (119),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F +KPV+LSDV +LR +M K
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLRDYMTK  159


 Score = 37.4 bits (85),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSENV +RI R
Sbjct  107  KESSTFRQIPVVIMSSENVLARIDR  131



>ref|XP_004135221.1| PREDICTED: two-component response regulator ARR3-like [Cucumis 
sativus]
 ref|XP_004155339.1| PREDICTED: two-component response regulator ARR3-like [Cucumis 
sativus]
 gb|KGN51845.1| hypothetical protein Csa_5G603910 [Cucumis sativus]
Length=233

 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAE+F +KPV+LSDV +LR +M+  +    E + +
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLREYMVGDEKTGNERSGI  170


 Score = 38.5 bits (88),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR IPVVIMSSENV +RI R
Sbjct  107  KESSTLREIPVVIMSSENVVARIDR  131



>ref|XP_010670481.1| PREDICTED: two-component response regulator ARR9-like [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGA+EF LKPVRLSDV+KL+PH+M+++ K  +N
Sbjct  111  RINRCLEEGADEFLLKPVRLSDVDKLKPHLMRSRYKGQKN  150



>ref|XP_008446266.1| PREDICTED: two-component response regulator ARR5-like [Cucumis 
melo]
Length=233

 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAE+F +KPV+LSDV +LR +M+  +    E + +
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLREYMVGDEKTGNERSGI  170


 Score = 38.5 bits (88),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR IPVVIMSSENV +RI R
Sbjct  107  KESSTLREIPVVIMSSENVVARIDR  131



>ref|XP_009104039.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Brassica rapa]
Length=240

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+P MMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPLMMKTKLK  152



>gb|KDP37824.1| hypothetical protein JCGZ_06726 [Jatropha curcas]
Length=226

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPV+LSD+ KL PHM+KTK K
Sbjct  116  RITRCLEEGAEEFFLKPVQLSDLKKLTPHMLKTKIK  151



>emb|CBX43987.1| putative A-type response regulator 5 [Populus x canadensis]
Length=198

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCL+EGAEEFFLKPV+LSDVNKLRPH+MK + K
Sbjct  126  RINRCLKEGAEEFFLKPVQLSDVNKLRPHLMKGRCK  161



>gb|ACU24220.1| unknown [Glycine max]
Length=191

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLE+GA+EFFLKPV+ SDVNKLRPH++K+K K  E
Sbjct  116  RINRCLEDGADEFFLKPVQQSDVNKLRPHLLKSKVKDEE  154



>ref|NP_001242179.1| uncharacterized protein LOC100818762 [Glycine max]
 gb|ACU16961.1| unknown [Glycine max]
Length=172

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLE+GA+EFFLKPV+ SDVNKLRPH++K+K K  E
Sbjct  116  RINRCLEDGADEFFLKPVQQSDVNKLRPHLLKSKVKDEE  154



>ref|NP_178754.1| putative two-component response regulator protein [Arabidopsis 
thaliana]
 gb|AAD15535.1| putative two-component response regulator protein [Arabidopsis 
thaliana]
 gb|AEC06053.1| putative two-component response regulator protein [Arabidopsis 
thaliana]
Length=136

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = -1

Query  164  FLAGYIGLMG-----LKICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            F + ++ +M       +I RCLE+GAEEFFLKPV+L D  KL+PHMMKTK KK
Sbjct  13   FRSIHVVIMSSENVPTRISRCLEKGAEEFFLKPVKLVDHTKLKPHMMKTKLKK  65



>gb|KHN45795.1| Two-component response regulator ARR9 [Glycine soja]
Length=151

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLE+GA+EFFLKPV+ SDVNKLRPH++K+K K  E
Sbjct  95   RINRCLEDGADEFFLKPVQQSDVNKLRPHLLKSKVKDEE  133



>ref|XP_006847932.1| hypothetical protein AMTR_s00029p00125630 [Amborella trichopoda]
 gb|ERN09513.1| hypothetical protein AMTR_s00029p00125630 [Amborella trichopoda]
Length=166

 Score = 47.8 bits (112),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCL EGAE+F LKP++LSDV +LR HM+
Sbjct  126  RINRCLAEGAEDFILKPLKLSDVKRLRNHMI  156


 Score = 39.3 bits (90),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES  L+ IPVVIMSSENVP+RI+R
Sbjct  105  KESKTLKEIPVVIMSSENVPTRINR  129



>ref|XP_009104038.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Brassica rapa]
Length=262

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAEEFFLKPVRL+D+NKL+P MMKTK K
Sbjct  117  RISRCLEEGAEEFFLKPVRLADLNKLKPLMMKTKLK  152



>emb|CBI30106.3| unnamed protein product [Vitis vinifera]
Length=157

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEEFFLKPV++SDVN+L+PHMM
Sbjct  113  RITRCLEEGAEEFFLKPVQISDVNRLKPHMM  143



>ref|XP_007148939.1| hypothetical protein PHAVU_005G027100g [Phaseolus vulgaris]
 gb|ESW20933.1| hypothetical protein PHAVU_005G027100g [Phaseolus vulgaris]
Length=187

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLE+GA+EFFLKPV+ SDVN+LRPH++K+K K  E   +
Sbjct  116  RINRCLEDGADEFFLKPVQQSDVNRLRPHLLKSKVKDEEEQQI  158



>ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
 gb|EMJ10109.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
Length=164

 Score = 50.8 bits (120),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDVN+L+  MM
Sbjct  127  RIDRCLEEGAEEYILKPVKLSDVNRLKHFMM  157


 Score = 36.2 bits (82),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R +PVVIMSSEN+ +RI R
Sbjct  106  KESSAFREVPVVIMSSENILTRIDR  130



>ref|XP_008239693.1| PREDICTED: two-component response regulator ARR5-like [Prunus 
mume]
Length=227

 Score = 50.4 bits (119),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDVN+L+  MM
Sbjct  127  RIDRCLEEGAEEYILKPVKLSDVNRLKHFMM  157


 Score = 36.2 bits (82),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R +PVVIMSSEN+ +RI R
Sbjct  106  KESSAFREVPVVIMSSENILTRIDR  130



>emb|CDY22518.1| BnaC03g23280D [Brassica napus]
Length=217

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+L+D+ KL+ HMMKTK KK
Sbjct  113  RISRCLEEGAEEFFLKPVKLADLTKLKLHMMKTKLKK  149



>ref|XP_008466725.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Cucumis melo]
Length=243

 Score = 50.4 bits (119),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I  CLEEGAEEF LKP++LSDV KL PH+ K+ ++
Sbjct  128  RINMCLEEGAEEFLLKPLQLSDVKKLEPHLQKSITR  163


 Score = 35.8 bits (81),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + SY ++IPVV+MSSEN PSRI+
Sbjct  108  KGSYWKDIPVVVMSSENEPSRIN  130



>gb|KJB78543.1| hypothetical protein B456_013G004700 [Gossypium raimondii]
Length=166

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLE GAEEFFLKPV+LSDVNKLRPH+MK
Sbjct  104  RINRCLEGGAEEFFLKPVQLSDVNKLRPHLMK  135



>ref|XP_010067733.1| PREDICTED: two-component response regulator ARR9-like [Eucalyptus 
grandis]
 gb|KCW65920.1| hypothetical protein EUGRSUZ_G03236 [Eucalyptus grandis]
Length=183

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I +CLE+GAEEFFLKPV+L+DVNKL+PH+++ +SK+   N+
Sbjct  117  RISQCLEDGAEEFFLKPVQLADVNKLKPHLLRGRSKEHHPNS  158



>ref|XP_004149797.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 gb|KGN47716.1| hypothetical protein Csa_6G383530 [Cucumis sativus]
Length=236

 Score = 50.4 bits (119),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I  CLEEGAEEF LKP++LSDV KL PH+ K+ ++
Sbjct  129  RINMCLEEGAEEFLLKPLQLSDVKKLEPHLQKSLTR  164


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + SY ++IPVV+MSSEN PSRI+
Sbjct  109  KGSYWKDIPVVVMSSENEPSRIN  131



>ref|XP_010044665.1| PREDICTED: two-component response regulator ARR5-like [Eucalyptus 
grandis]
Length=251

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAE+F +KPV+LSDV +LR  M +    +  ++ 
Sbjct  126  RIDRCLEEGAEDFIVKPVKLSDVKRLRDFMTRDVGDRVRSDG  167


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR IPVVIMSSENV +RI R
Sbjct  105  KESSALREIPVVIMSSENVLARIDR  129



>ref|XP_004171546.1| PREDICTED: two-component response regulator ARR9-like, partial 
[Cucumis sativus]
Length=127

 Score = 50.4 bits (119),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKT  33
            +I  CLEEGAEEF LKP++LSDV KL PH+ K+
Sbjct  20   RINMCLEEGAEEFLLKPLQLSDVKKLEPHLQKS  52


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  297  SSYLRNIPVVIMSSENVPSRI  235
             SY ++IPVV+MSSEN PSRI
Sbjct  1    GSYWKDIPVVVMSSENEPSRI  21



>ref|XP_011034187.1| PREDICTED: two-component response regulator ARR5-like [Populus 
euphratica]
Length=248

 Score = 49.3 bits (116),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAE+F  KPV+LSDV +LR + M T+
Sbjct  145  RIDRCLEEGAEDFIAKPVKLSDVKRLRDYYMATR  178


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSENV +RI R
Sbjct  124  KESSSFREIPVVIMSSENVMARIDR  148



>gb|ABG35780.1| SRR198 [Striga asiatica]
Length=238

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 4/44 (9%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK----KPEN  12
            +I RCLEEGAEEFFLKP++L+DVNKL P+M++TK +    KPEN
Sbjct  117  RITRCLEEGAEEFFLKPMKLTDVNKLWPYMLRTKGQNNVLKPEN  160



>gb|ABQ95670.1| type A response regulator, partial [Malus domestica]
Length=194

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEE+ +KPV+LSDVN+L+  MM    +K
Sbjct  98   RIDRCLEEGAEEYIVKPVKLSDVNRLKNFMMGGGERK  134


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R +PVVIMSSEN+ +RI R
Sbjct  77   KESSAFREVPVVIMSSENILTRIDR  101



>ref|XP_010931988.1| PREDICTED: two-component response regulator ARR8-like [Elaeis 
guineensis]
Length=193

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+LSD+N+L+PH++K K K+
Sbjct  112  RINRCLEEGAEEFFLKPVQLSDMNRLKPHILKGKYKE  148



>emb|CBX43983.1| putative A-type response regulator 1b [Populus x canadensis]
Length=257

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAE+F +KPV+LSDV ++R +M   + +  +N
Sbjct  139  RIDRCLEEGAEDFIVKPVKLSDVKRIRDYMASREVRSVQN  178


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  R IPVVIMSSENV +RI R
Sbjct  118  KESTTFREIPVVIMSSENVVARIDR  142



>emb|CBX43982.1| putative A-type response regulator 1a [Populus x canadensis]
Length=255

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAE+F +KPV+LSDV ++R +M   + +  +N
Sbjct  141  RIDRCLEEGAEDFIVKPVKLSDVKRIRDYMASREVRSVQN  180


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  R IPVVIMSSENV +RI R
Sbjct  120  KESTTFREIPVVIMSSENVVARIDR  144



>ref|XP_008786946.1| PREDICTED: two-component response regulator ARR9-like [Phoenix 
dactylifera]
Length=209

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAEEFFLKPV+LSD+N+L+PH++K K K+
Sbjct  113  RIHRCLEEGAEEFFLKPVQLSDMNRLKPHILKGKYKE  149



>gb|EMT09801.1| Two-component response regulator ARR8 [Aegilops tauschii]
Length=231

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA EFFLKPVRLSD++KL+PH+MK++ K+
Sbjct  115  RINRCLEEGANEFFLKPVRLSDMSKLKPHIMKSRCKE  151



>gb|KDP21284.1| hypothetical protein JCGZ_21755 [Jatropha curcas]
Length=252

 Score = 48.1 bits (113),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHM  42
            +I RCLEEGAE+F +KPV+LSDV +LR +M
Sbjct  129  RIDRCLEEGAEDFIVKPVKLSDVKRLRDYM  158


 Score = 37.0 bits (84),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSENV +RI R
Sbjct  108  KESSTFREIPVVIMSSENVMTRIDR  132



>ref|XP_009622543.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=187

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKP++ SDVN+++PH+M+ K +K   N+L
Sbjct  115  RINRCLEEGAEEFFLKPLQQSDVNRIKPHLMREKRQKVTPNSL  157



>emb|CBI40158.3| unnamed protein product [Vitis vinifera]
Length=140

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++
Sbjct  102  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLL  132



>ref|XP_006378200.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa]
 gb|ERP55997.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa]
Length=258

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAE+F +KPV+LSDV ++R +M   + +  +N
Sbjct  141  RIDRCLEEGAEDFIVKPVKLSDVKRIRDYMASREVRSVQN  180


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  R IPVVIMSSENV +RI R
Sbjct  120  KESTTFREIPVVIMSSENVVARIDR  144



>ref|XP_010645611.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=140

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAE+FFLKPV+LSDVNKLRPH++
Sbjct  102  RINRCLEEGAEDFFLKPVQLSDVNKLRPHLL  132



>gb|EMS50922.1| Two-component response regulator ARR8 [Triticum urartu]
Length=230

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA EFFLKPVRLSD++KL+PH+MK++ K+
Sbjct  115  RINRCLEEGANEFFLKPVRLSDMSKLKPHIMKSRCKE  151



>ref|XP_009765982.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Nicotiana sylvestris]
Length=187

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPV+ SD+N+++PH+M+ K +K   N+L
Sbjct  115  RINRCLEEGAEEFFLKPVQQSDMNRIKPHLMREKRQKVTPNSL  157



>ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica]
 gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica]
Length=232

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F +KPV+LSDV +L+ +M +
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTR  159


 Score = 37.4 bits (85),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L+ IPVVIMSSENV +RI R
Sbjct  107  KESSALKEIPVVIMSSENVLARIDR  131



>ref|XP_010044664.1| PREDICTED: two-component response regulator ARR6-like [Eucalyptus 
grandis]
 gb|KCW86764.1| hypothetical protein EUGRSUZ_B03374 [Eucalyptus grandis]
Length=263

 Score = 46.6 bits (109),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RC+EEGAE+F +KPV+LSDV +LR  M +
Sbjct  128  RIDRCMEEGAEDFIVKPVKLSDVKRLRDFMTR  159


 Score = 38.5 bits (88),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS LR IPVVIMSSENV +RI R
Sbjct  107  KESSALREIPVVIMSSENVLARIDR  131



>dbj|BAJ88185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA EFFLKPVRLSD++KL+PH+MK++ K+
Sbjct  159  RINRCLEEGANEFFLKPVRLSDMSKLKPHIMKSRCKE  195



>ref|XP_006378201.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa]
 gb|ERP55998.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa]
Length=256

 Score = 48.9 bits (115),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAE+F +KPV+LSDV ++R +M   + +  +N
Sbjct  139  RIDRCLEEGAEDFIVKPVKLSDVKRIRDYMASREVRSVQN  178


 Score = 36.2 bits (82),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES+  R IPVVIMSSENV +RI R
Sbjct  118  KESTTFREIPVVIMSSENVVARIDR  142



>ref|XP_009765983.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Nicotiana sylvestris]
Length=181

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPV+ SD+N+++PH+M+ K +K   N+L
Sbjct  109  RINRCLEEGAEEFFLKPVQQSDMNRIKPHLMREKRQKVTPNSL  151



>ref|XP_003578944.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Brachypodium distachyon]
Length=225

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA EFFLKPVRLSD++KL+PH+MK++ K+
Sbjct  114  RINRCLEEGANEFFLKPVRLSDMSKLKPHIMKSRCKE  150



>ref|XP_010238744.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Brachypodium distachyon]
Length=226

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGA EFFLKPVRLSD++KL+PH+MK++ K+
Sbjct  115  RINRCLEEGANEFFLKPVRLSDMSKLKPHIMKSRCKE  151



>ref|XP_008244969.1| PREDICTED: two-component response regulator ARR5 [Prunus mume]
Length=232

 Score = 47.4 bits (111),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F +KPV+LSDV +L+ +M +
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTR  159


 Score = 37.4 bits (85),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS L+ IPVVIMSSENV +RI R
Sbjct  107  KESSALKEIPVVIMSSENVLARIDR  131



>ref|XP_009386845.1| PREDICTED: two-component response regulator ARR8 [Musa acuminata 
subsp. malaccensis]
Length=200

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLEEGAEEFFLKPV+LSD+ +LRPH++K K K+ +
Sbjct  112  RINRCLEEGAEEFFLKPVQLSDMRRLRPHILKGKHKEQQ  150



>ref|XP_010269353.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Nelumbo nucifera]
Length=210

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEF LKPV+LSDVN+LRPH++K K
Sbjct  116  RINRCLEEGAEEFLLKPVQLSDVNRLRPHLLKGK  149



>ref|XP_010269354.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Nelumbo nucifera]
Length=209

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEF LKPV+LSDVN+LRPH++K K
Sbjct  115  RINRCLEEGAEEFLLKPVQLSDVNRLRPHLLKGK  148



>ref|XP_002322145.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06272.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
Length=224

 Score = 46.6 bits (109),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDV +++  +M
Sbjct  128  RIDRCLEEGAEEYILKPVKLSDVKRIKDVIM  158


 Score = 37.7 bits (86),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            QESS  R IPVVIMSSEN+ +RI R
Sbjct  107  QESSAFREIPVVIMSSENILARIDR  131



>ref|XP_002284504.2| PREDICTED: two-component response regulator ARR5-like isoform 
X2 [Vitis vinifera]
Length=240

 Score = 50.8 bits (120),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I  CLE GAE+F LKPV+LSD+ KL+PH++K+ S+ P  N
Sbjct  152  RINMCLEGGAEDFLLKPVQLSDLEKLQPHLLKSLSQYPCEN  192


 Score = 33.5 bits (75),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + S  +++PVV+MSSENVPSRI+
Sbjct  132  KGSSWKDVPVVVMSSENVPSRIN  154



>ref|XP_010664202.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Vitis vinifera]
Length=242

 Score = 50.8 bits (120),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I  CLE GAE+F LKPV+LSD+ KL+PH++K+ S+ P  N
Sbjct  154  RINMCLEGGAEDFLLKPVQLSDLEKLQPHLLKSLSQYPCEN  194


 Score = 33.5 bits (75),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + S  +++PVV+MSSENVPSRI+
Sbjct  134  KGSSWKDVPVVVMSSENVPSRIN  156



>emb|CBI19004.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 50.8 bits (120),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENN  9
            +I  CLE GAE+F LKPV+LSD+ KL+PH++K+ S+ P  N
Sbjct  144  RINMCLEGGAEDFLLKPVQLSDLEKLQPHLLKSLSQYPCEN  184


 Score = 33.5 bits (75),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + S  +++PVV+MSSENVPSRI+
Sbjct  124  KGSSWKDVPVVVMSSENVPSRIN  146



>ref|XP_006411396.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
 gb|ESQ52849.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
Length=228

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEEFFLKPV+L+DV KL+PHMM
Sbjct  118  RISRCLEEGAEEFFLKPVKLADVTKLKPHMM  148



>ref|XP_011028649.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
 ref|XP_011028650.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
 ref|XP_011028651.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
Length=229

 Score = 46.2 bits (108),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDV +++  +M
Sbjct  133  RIDRCLEEGAEEYILKPVKLSDVKRIKDVIM  163


 Score = 37.7 bits (86),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            QESS  R IPVVIMSSEN+ +RI R
Sbjct  112  QESSAFREIPVVIMSSENILARIDR  136



>ref|XP_008374475.1| PREDICTED: two-component response regulator ARR5-like [Malus 
domestica]
Length=227

 Score = 48.1 bits (113),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKK  21
            +I RCLEEGAE++ +KPV+LSDVN+L+  MM    +K
Sbjct  127  RIDRCLEEGAEDYIVKPVKLSDVNRLKNVMMGGGERK  163


 Score = 35.8 bits (81),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R +PVVIMSSEN+ +RI R
Sbjct  106  KESSXFREVPVVIMSSENILTRIDR  130



>ref|XP_010683319.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=277

 Score = 48.9 bits (115),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F LKPV+LSDV +L+ +M K
Sbjct  132  RIDRCLEEGAEDFILKPVKLSDVKRLKNYMSK  163


 Score = 35.0 bits (79),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  336  INSYIYFVVL*QESSYLRNIPVVIMSSENVPSRISR  229
            +  Y     + QESS  +  PVVIMSSENV +RI R
Sbjct  100  MTGYELLKKIKQESSSFKETPVVIMSSENVLARIDR  135



>gb|AAK14395.1|AF339732_1 response regulator protein [Dianthus caryophyllus]
Length=264

 Score = 50.1 bits (118),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHM  42
            +I RCLEEGAE+F LKPV+LSDV +LR +M
Sbjct  133  RIDRCLEEGAEDFILKPVKLSDVKRLRDYM  162


 Score = 33.9 bits (76),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +  PVVIMSSENV +RI R
Sbjct  112  KESSTFKETPVVIMSSENVIARIDR  136



>ref|XP_009391546.1| PREDICTED: two-component response regulator ARR8-like [Musa acuminata 
subsp. malaccensis]
Length=189

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLE GAEEFFLKPV+LSD+ +LRPH++K KSK
Sbjct  112  RINRCLEGGAEEFFLKPVQLSDMKRLRPHILKGKSK  147



>ref|XP_008388361.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Malus domestica]
Length=156

 Score = 45.8 bits (107),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I +CLEEGA+ F LKP+R SD+ KLR H+M   S
Sbjct  122  RIDKCLEEGAQMFMLKPLRQSDIKKLRYHLMNCNS  156


 Score = 38.1 bits (87),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS ++ +PVVIMSSENVP+RI +
Sbjct  101  KESSIMKEVPVVIMSSENVPNRIDK  125



>ref|XP_006856915.1| hypothetical protein AMTR_s00055p00222350 [Amborella trichopoda]
 gb|ERN18382.1| hypothetical protein AMTR_s00055p00222350 [Amborella trichopoda]
Length=181

 Score = 48.9 bits (115),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAE+F +KPV+LSDV +LR ++ + + K   N+ 
Sbjct  112  RIDRCLEEGAEDFIVKPVKLSDVKRLREYVERKREKNNHNHT  153


 Score = 34.3 bits (77),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R +PVV+MSSEN+ +RI R
Sbjct  91   KESSTFREVPVVVMSSENILARIDR  115



>ref|XP_007044474.1| Two-component response regulator ARR4 [Theobroma cacao]
 gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao]
Length=394

 Score = 46.2 bits (108),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F +KPV+LSDV +++ +M +
Sbjct  284  RIDRCLEEGAEDFIVKPVKLSDVKRIKDYMTR  315


 Score = 36.6 bits (83),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSENV +RI R
Sbjct  263  KESSAFREIPVVIMSSENVLARIDR  287



>ref|XP_010547354.1| PREDICTED: two-component response regulator ARR9-like [Tarenaya 
hassleriana]
Length=198

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAEEF LKPV++SD++K++PH+MK K K    N 
Sbjct  125  RINRCLEEGAEEFLLKPVQMSDMDKIKPHIMKQKPKDAAQNT  166



>ref|XP_010922156.1| PREDICTED: two-component response regulator ARR9-like [Elaeis 
guineensis]
Length=192

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAEEFFLKPV+LSD+ +L+PH++K K K+ +   +
Sbjct  111  RINRCLEEGAEEFFLKPVQLSDMKRLKPHILKGKYKEQQQQEV  153



>ref|XP_002322144.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06271.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 emb|CBX43991.1| putative A-type response regulator 10 [Populus x canadensis]
Length=223

 Score = 46.6 bits (109),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDV +++  +M
Sbjct  127  RIDRCLEEGAEEYILKPVKLSDVKRIKDVIM  157


 Score = 36.2 bits (82),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSEN+ +RI R
Sbjct  106  KESSAFREIPVVIMSSENILARIDR  130



>gb|AFG52076.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52077.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52079.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52084.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
Length=66

 Score = 46.6 bits (109),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  122  RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            RCL+EGAEEF LKPV++SDV +LR +M + + +
Sbjct  24   RCLDEGAEEFILKPVQISDVKRLREYMSRVQEE  56


 Score = 36.2 bits (82),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRISR  229
            ESS L+ IPVV+MSSENVPSR  R
Sbjct  1    ESSKLKEIPVVVMSSENVPSRKRR  24



>ref|XP_010063402.1| PREDICTED: two-component response regulator ARR8-like [Eucalyptus 
grandis]
 gb|KCW70620.1| hypothetical protein EUGRSUZ_F03797 [Eucalyptus grandis]
Length=266

 Score = 45.4 bits (106),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKT  33
            +I  CLE GA+EF LKPV+LSD+ KL+P+++K+
Sbjct  161  RINMCLEGGADEFLLKPVQLSDLEKLQPYILKS  193


 Score = 37.4 bits (85),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + SY +++PVV+MSSENVPSRI+
Sbjct  141  KGSYWKDVPVVVMSSENVPSRIN  163



>ref|XP_010652890.1| PREDICTED: two-component response regulator ARR6 [Vitis vinifera]
 emb|CBI32076.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 47.4 bits (111),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAE+F +KPV+LSDV +L+ +M +      E   +
Sbjct  128  RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTREDRDGNEGRGI  170


 Score = 35.0 bits (79),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R  PVVIMSSEN+ +RI R
Sbjct  107  KESSTFRETPVVIMSSENILTRIDR  131



>emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera]
Length=210

 Score = 47.4 bits (111),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNAL  3
            +I RCLEEGAE+F +KPV+LSDV +L+ +M +      E   +
Sbjct  117  RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTREDRDGNEGRGI  159


 Score = 35.0 bits (79),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R  PVVIMSSEN+ +RI R
Sbjct  96   KESSTFRETPVVIMSSENILTRIDR  120



>gb|ACO88941.1| cytokinin A-type response regulator 1 [Vitis vinifera]
Length=65

 Score = 48.1 bits (113),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            +I RCLEEGAE+F +KPV+LSDV +L+ +M + + +
Sbjct  28   RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTRERQR  63


 Score = 34.7 bits (78),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R  PVVIMSSEN+ +RI R
Sbjct  7    KESSTFRETPVVIMSSENILTRIDR  31



>gb|AFG52083.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
Length=66

 Score = 46.2 bits (108),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  122  RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            RCL+EGAEEF LKPV++SDV +LR +M + + +
Sbjct  24   RCLDEGAEEFILKPVQISDVKRLREYMSRVQEE  56


 Score = 36.6 bits (83),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRISR  229
            ESS L+ IPVV+MSSENVPSR  R
Sbjct  1    ESSKLKEIPVVVMSSENVPSRKRR  24



>ref|XP_004233018.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
lycopersicum]
Length=166

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTK  30
            +I RCLEEGAEEFFLKPV+ SDVN+++PH+M+ K
Sbjct  94   RINRCLEEGAEEFFLKPVQQSDVNRIKPHLMREK  127



>ref|XP_009399982.1| PREDICTED: two-component response regulator ARR9-like [Musa acuminata 
subsp. malaccensis]
Length=193

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPE  15
            +I RCLE GAEEFFLKPV+LSD+ +LRPH++K +SK  +
Sbjct  112  RINRCLEGGAEEFFLKPVQLSDMKRLRPHILKGRSKDQQ  150



>ref|XP_011028652.1| PREDICTED: two-component response regulator ARR5-like isoform 
X2 [Populus euphratica]
Length=228

 Score = 46.2 bits (108),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMM  39
            +I RCLEEGAEE+ LKPV+LSDV +++  +M
Sbjct  132  RIDRCLEEGAEEYILKPVKLSDVKRIKDVIM  162


 Score = 36.2 bits (82),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  R IPVVIMSSEN+ +RI R
Sbjct  111  KESSAFREIPVVIMSSENILARIDR  135



>ref|XP_004504496.1| PREDICTED: two-component response regulator ARR4-like isoform 
X1 [Cicer arietinum]
Length=229

 Score = 46.6 bits (109),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPEN  12
            +I RCLEEGAE++ +KPV+LSDV +L+ +M   K  +  N
Sbjct  119  RIDRCLEEGAEDYIVKPVKLSDVKRLKGYMTTLKEVREVN  158


 Score = 35.4 bits (80),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            QESS  + IPVVIMSSEN+  RI R
Sbjct  98   QESSTFKEIPVVIMSSENILPRIDR  122



>ref|XP_010926969.1| PREDICTED: two-component response regulator ARR8-like [Elaeis 
guineensis]
Length=208

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I RCLE GAEEFFLKPV+LSD+ +LRPH++K KS
Sbjct  112  RISRCLEGGAEEFFLKPVQLSDLKRLRPHILKGKS  146



>ref|XP_010683320.1| PREDICTED: two-component response regulator ARR5-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=276

 Score = 48.9 bits (115),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I RCLEEGAE+F LKPV+LSDV +L+ +M K
Sbjct  131  RIDRCLEEGAEDFILKPVKLSDVKRLKNYMSK  162


 Score = 33.5 bits (75),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  +  PVVIMSSENV +RI R
Sbjct  110  KESSSFKETPVVIMSSENVLARIDR  134



>gb|AEW07642.1| hypothetical protein 0_7819_01, partial [Pinus radiata]
 gb|AFG52078.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52080.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52082.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52085.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52086.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52087.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52088.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
 gb|AFG52089.1| hypothetical protein 0_7819_01, partial [Pinus taeda]
Length=66

 Score = 46.2 bits (108),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  122  RCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSK  24
            RCL+EGAEEF LKPV++SDV +LR +M + + +
Sbjct  24   RCLDEGAEEFILKPVQISDVKRLREYMSRVQEE  56


 Score = 36.2 bits (82),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRISR  229
            ESS L+ IPVV+MSSENVPSR  R
Sbjct  1    ESSKLKEIPVVVMSSENVPSRKRR  24



>ref|XP_009349081.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=156

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I +CLEEGA+ F LKP++ SD+ KLR H+M   S
Sbjct  122  RIDKCLEEGAQMFMLKPLKQSDIKKLRYHLMNCNS  156


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS ++ +PVVIMSSENVP+RI +
Sbjct  101  KESSIMKEVPVVIMSSENVPNRIDK  125



>ref|XP_009362787.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=155

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I +CLEEGA+ F LKP++ SD+ KLR H+M   S
Sbjct  121  RIDKCLEEGAQMFMLKPLKQSDIKKLRYHLMNCNS  155


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS ++ +PVVIMSSENVP+RI +
Sbjct  100  KESSIMKEVPVVIMSSENVPNRIDK  124



>ref|XP_008389572.1| PREDICTED: two-component response regulator ARR5-like [Malus 
domestica]
Length=236

 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKSKKPENNA  6
            +I RCLEEGAE+F +KPV+L+DV +L+ +M   +    E + 
Sbjct  126  RIDRCLEEGAEDFIVKPVKLADVKRLKDYMTTARDVGVEESG  167


 Score = 36.2 bits (82),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS  + IPVVIMSSENV +RI R
Sbjct  105  KESSAFKEIPVVIMSSENVLARIDR  129



>gb|KHN47005.1| Two-component response regulator ARR9 [Glycine soja]
Length=232

 Score = 47.0 bits (110),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKT  33
            +I  CLEEGA+EF LKP++LSD++KL+P+ +K+
Sbjct  137  RISMCLEEGAQEFLLKPLQLSDLDKLQPYFLKS  169


 Score = 35.0 bits (79),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + S  +++PVVIMSSENVPSRIS
Sbjct  117  KGSSWKDVPVVIMSSENVPSRIS  139



>ref|XP_003526642.1| PREDICTED: two-component response regulator ARR9-like [Glycine 
max]
Length=232

 Score = 47.0 bits (110),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKT  33
            +I  CLEEGA+EF LKP++LSD++KL+P+ +K+
Sbjct  137  RISMCLEEGAQEFLLKPLQLSDLDKLQPYFLKS  169


 Score = 35.0 bits (79),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  300  ESSYLRNIPVVIMSSENVPSRIS  232
            + S  +++PVVIMSSENVPSRIS
Sbjct  117  KGSSWKDVPVVIMSSENVPSRIS  139



>ref|XP_008245269.1| PREDICTED: two-component response regulator ARR17-like [Prunus 
mume]
Length=172

 Score = 51.6 bits (122),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMK  36
            +I +CLEEGA+EF LKP+R SDVN+LR H+MK
Sbjct  127  RIEKCLEEGAKEFLLKPLRQSDVNQLRSHLMK  158


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ES   + IPVVI+SSE++P+RI +
Sbjct  106  KESPTGKEIPVVIVSSEHIPTRIEK  130



>ref|XP_008369375.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Malus domestica]
Length=152

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  131  KICRCLEEGAEEFFLKPVRLSDVNKLRPHMMKTKS  27
            +I +CLEEGA+ F LKP++ SD+ KLR H+M   S
Sbjct  118  RINKCLEEGAQMFMLKPLKQSDMKKLRYHLMNCSS  152


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  303  QESSYLRNIPVVIMSSENVPSRISR  229
            +ESS ++ +PVVIMSSENVP+RI++
Sbjct  97   KESSIMKEVPVVIMSSENVPTRINK  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370