BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003F11 645 bp,

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008782697.1|  PREDICTED: probable LRR receptor-like serine...    102   2e-21   Phoenix dactylifera
ref|XP_008782698.1|  PREDICTED: probable LRR receptor-like serine...    102   3e-21   
dbj|BAD87127.1|  receptor protein kinase-like                         98.6    6e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KGN63923.1|  hypothetical protein Csa_1G027520                     97.4    7e-21   Cucumis sativus [cucumbers]
ref|XP_002323098.2|  hypothetical protein POPTR_0016s14720g             100   1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011001645.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-20   Populus euphratica
ref|XP_011001644.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-20   Populus euphratica
ref|XP_011006277.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-20   Populus euphratica
ref|XP_010098597.1|  putative LRR receptor-like serine/threonine-...  94.4    2e-20   Morus notabilis
ref|XP_010921201.1|  PREDICTED: probable LRR receptor-like serine...  99.8    2e-20   Elaeis guineensis
gb|AFW78405.1|  putative leucine-rich repeat receptor-like protei...  95.5    3e-20   Zea mays [maize]
gb|EEC72206.1|  hypothetical protein OsI_05294                        95.1    4e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_002447392.1|  hypothetical protein SORBIDRAFT_06g000230        95.1    4e-20   Sorghum bicolor [broomcorn]
emb|CAN75549.1|  hypothetical protein VITISV_043541                   98.6    4e-20   Vitis vinifera
emb|CBI15799.3|  unnamed protein product                              98.6    5e-20   Vitis vinifera
ref|XP_002276020.1|  PREDICTED: probable LRR receptor-like serine...  98.6    5e-20   Vitis vinifera
ref|XP_009355132.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_008354331.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   
ref|XP_009355137.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   Pyrus x bretschneideri [bai li]
emb|CDP04034.1|  unnamed protein product                              98.6    6e-20   Coffea canephora [robusta coffee]
ref|XP_011461391.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   Fragaria vesca subsp. vesca
ref|XP_004500393.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   Cicer arietinum [garbanzo]
ref|XP_011461389.1|  PREDICTED: probable LRR receptor-like serine...  98.6    6e-20   Fragaria vesca subsp. vesca
ref|XP_011089544.1|  PREDICTED: probable LRR receptor-like serine...  98.2    7e-20   Sesamum indicum [beniseed]
ref|XP_008649785.1|  PREDICTED: probable LRR receptor-like serine...  95.1    7e-20   Zea mays [maize]
ref|XP_010457834.1|  PREDICTED: probable LRR receptor-like serine...  98.2    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010457836.1|  PREDICTED: probable LRR receptor-like serine...  98.2    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010094444.1|  putative LRR receptor-like serine/threonine-...  98.2    8e-20   Morus notabilis
gb|KJB83922.1|  hypothetical protein B456_013G271600                  97.8    9e-20   Gossypium raimondii
ref|XP_011011783.1|  PREDICTED: probable LRR receptor-like serine...  97.8    9e-20   Populus euphratica
ref|XP_003537371.1|  PREDICTED: probable LRR receptor-like serine...  97.8    9e-20   Glycine max [soybeans]
ref|XP_003600556.1|  hypothetical protein MTR_3g062590                97.8    9e-20   Medicago truncatula
ref|NP_001045466.1|  Os01g0960400                                     97.8    9e-20   
ref|XP_008344795.1|  PREDICTED: probable LRR receptor-like serine...  93.2    9e-20   
ref|XP_011011778.1|  PREDICTED: probable LRR receptor-like serine...  97.8    9e-20   Populus euphratica
ref|XP_002533344.1|  protein with unknown function                    97.8    9e-20   
ref|XP_011006276.1|  PREDICTED: probable LRR receptor-like serine...  97.8    1e-19   Populus euphratica
ref|XP_002319433.2|  hypothetical protein POPTR_0013s15520g           97.8    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_003565200.1|  PREDICTED: probable LRR receptor-like serine...  97.8    1e-19   Brachypodium distachyon [annual false brome]
gb|KDO54923.1|  hypothetical protein CISIN_1g002174mg                 97.4    1e-19   Citrus sinensis [Valencia orange]
ref|XP_010098600.1|  putative LRR receptor-like serine/threonine-...  97.4    1e-19   Morus notabilis
ref|XP_004137372.1|  PREDICTED: probable LRR receptor-like serine...  97.4    1e-19   Cucumis sativus [cucumbers]
ref|XP_010424012.1|  PREDICTED: probable LRR receptor-like serine...  96.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004974947.1|  PREDICTED: probable LRR receptor-like serine...  97.4    1e-19   Setaria italica
dbj|BAF01740.1|  hypothetical protein                                 96.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278952.1|  PREDICTED: probable LRR receptor-like serine...  97.4    1e-19   Nelumbo nucifera [Indian lotus]
dbj|BAG94134.1|  unnamed protein product                              94.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF46308.1|  leucine-rich repeat transmembrane protein kinase     94.4    2e-19   Ipomoea nil [qian niu]
ref|XP_008354310.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   Malus domestica [apple tree]
gb|EEC72208.1|  hypothetical protein OsI_05296                        97.1    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002531806.1|  ATP binding protein, putative                    97.1    2e-19   Ricinus communis
gb|KJB27626.1|  hypothetical protein B456_005G002700                  96.3    2e-19   Gossypium raimondii
ref|XP_008669743.1|  PREDICTED: probable LRR receptor-like serine...  97.1    2e-19   Zea mays [maize]
ref|XP_004163829.1|  PREDICTED: probable LRR receptor-like serine...  95.9    2e-19   
ref|XP_006645416.1|  PREDICTED: probable LRR receptor-like serine...  96.7    2e-19   Oryza brachyantha
ref|XP_004961725.1|  PREDICTED: probable LRR receptor-like serine...  96.7    2e-19   Setaria italica
ref|XP_002870890.1|  ATP binding protein                              96.7    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_002439970.1|  hypothetical protein SORBIDRAFT_09g023620        96.7    2e-19   Sorghum bicolor [broomcorn]
emb|CAB82765.1|  putative protein                                     96.7    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDO54930.1|  hypothetical protein CISIN_1g002174mg                 96.3    3e-19   Citrus sinensis [Valencia orange]
ref|XP_002326064.2|  leucine-rich repeat transmembrane protein ki...  96.3    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006417874.1|  hypothetical protein EUTSA_v10006712mg           96.3    3e-19   Eutrema salsugineum
ref|XP_008239253.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Prunus mume [ume]
gb|KGN54467.1|  hypothetical protein Csa_4G336750                     96.3    3e-19   Cucumis sativus [cucumbers]
ref|XP_006464963.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Citrus sinensis [Valencia orange]
ref|XP_004142673.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  96.3    3e-19   
ref|XP_011011784.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Populus euphratica
ref|XP_008463289.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Cucumis melo [Oriental melon]
ref|XP_008463287.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Cucumis melo [Oriental melon]
ref|XP_009130611.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Brassica rapa
gb|EMT18733.1|  Putative LRR receptor-like serine/threonine-prote...  94.7    3e-19   Aegilops tauschii
gb|KJB27625.1|  hypothetical protein B456_005G002700                  96.3    3e-19   Gossypium raimondii
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-19   Eucalyptus grandis [rose gum]
ref|XP_007206440.1|  hypothetical protein PRUPE_ppa000952mg           96.3    3e-19   Prunus persica
ref|XP_010278958.1|  PREDICTED: probable LRR receptor-like serine...  95.9    3e-19   Nelumbo nucifera [Indian lotus]
gb|KHG06096.1|  hypothetical protein F383_05597                       95.9    3e-19   Gossypium arboreum [tree cotton]
ref|XP_010043866.1|  PREDICTED: probable LRR receptor-like serine...  96.3    4e-19   Eucalyptus grandis [rose gum]
ref|XP_006432044.1|  hypothetical protein CICLE_v10000174mg           96.3    4e-19   Citrus clementina
ref|XP_010043852.1|  PREDICTED: probable LRR receptor-like serine...  96.3    4e-19   Eucalyptus grandis [rose gum]
ref|XP_007017104.1|  Leucine-rich repeat protein kinase family pr...  96.3    4e-19   Theobroma cacao [chocolate]
gb|KDO54922.1|  hypothetical protein CISIN_1g002174mg                 96.3    4e-19   Citrus sinensis [Valencia orange]
ref|XP_008366212.1|  PREDICTED: probable LRR receptor-like serine...  96.3    4e-19   
ref|XP_007017105.1|  Leucine-rich repeat protein kinase family pr...  96.3    4e-19   Theobroma cacao [chocolate]
ref|XP_010675301.1|  PREDICTED: probable LRR receptor-like serine...  96.3    4e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010675302.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009374400.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_009374406.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Pyrus x bretschneideri [bai li]
gb|KDP45677.1|  hypothetical protein JCGZ_17284                       95.9    4e-19   Jatropha curcas
ref|XP_011041757.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Populus euphratica
ref|XP_009621388.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Nicotiana tomentosiformis
ref|XP_004247017.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Solanum lycopersicum
gb|EMT12400.1|  Putative LRR receptor-like serine/threonine-prote...  95.9    4e-19   Aegilops tauschii
gb|KHG15448.1|  hypothetical protein F383_00176                       95.9    4e-19   Gossypium arboreum [tree cotton]
ref|XP_010326255.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Solanum lycopersicum
ref|XP_010032944.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Eucalyptus grandis [rose gum]
ref|XP_008457284.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   Cucumis melo [Oriental melon]
gb|AFW78404.1|  putative leucine-rich repeat receptor-like protei...  95.5    4e-19   Zea mays [maize]
ref|XP_006359984.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-19   
ref|XP_006344368.1|  PREDICTED: probable LRR receptor-like serine...  95.9    5e-19   Solanum tuberosum [potatoes]
ref|XP_006842576.1|  hypothetical protein AMTR_s00077p00154750        95.9    5e-19   Amborella trichopoda
ref|XP_007146906.1|  hypothetical protein PHAVU_006G080500g           95.9    5e-19   Phaseolus vulgaris [French bean]
ref|XP_010326251.1|  PREDICTED: probable LRR receptor-like serine...  95.9    5e-19   Solanum lycopersicum
gb|AFW78402.1|  putative leucine-rich repeat receptor-like protei...  95.9    5e-19   Zea mays [maize]
ref|XP_011018958.1|  PREDICTED: probable LRR receptor-like serine...  95.9    5e-19   Populus euphratica
ref|XP_009768306.1|  PREDICTED: probable LRR receptor-like serine...  95.9    5e-19   Nicotiana sylvestris
ref|XP_003552905.1|  PREDICTED: probable LRR receptor-like serine...  95.5    5e-19   Glycine max [soybeans]
ref|XP_009628064.1|  PREDICTED: probable LRR receptor-like serine...  95.5    5e-19   Nicotiana tomentosiformis
ref|XP_006306699.1|  hypothetical protein CARUB_v10008222mg           95.5    5e-19   Capsella rubella
ref|XP_010486760.1|  PREDICTED: probable LRR receptor-like serine...  95.5    5e-19   Camelina sativa [gold-of-pleasure]
tpg|DAA38792.1|  TPA: putative leucine-rich repeat receptor-like ...  94.4    6e-19   Zea mays [maize]
gb|KFK42998.1|  hypothetical protein AALP_AA1G066200                  95.5    6e-19   Arabis alpina [alpine rockcress]
ref|XP_004247008.1|  PREDICTED: probable LRR receptor-like serine...  95.5    6e-19   Solanum lycopersicum
gb|KHN18646.1|  Putative LRR receptor-like serine/threonine-prote...  95.5    6e-19   Glycine soja [wild soybean]
ref|XP_004500392.1|  PREDICTED: probable LRR receptor-like serine...  95.5    6e-19   Cicer arietinum [garbanzo]
ref|XP_011018957.1|  PREDICTED: probable LRR receptor-like serine...  95.5    6e-19   Populus euphratica
ref|XP_008803012.1|  PREDICTED: probable LRR receptor-like serine...  95.5    6e-19   Phoenix dactylifera
gb|EEC79410.1|  hypothetical protein OsI_20362                        95.5    6e-19   Oryza sativa Indica Group [Indian rice]
gb|AFW78415.1|  putative leucine-rich repeat receptor-like protei...  95.5    6e-19   Zea mays [maize]
ref|NP_001174468.1|  Os05g0481100                                     95.5    6e-19   
ref|XP_006381260.1|  hypothetical protein POPTR_0006s11180g           95.5    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007033464.1|  Leucine-rich repeat protein kinase family pr...  95.5    7e-19   Theobroma cacao [chocolate]
emb|CDY10230.1|  BnaC05g04730D                                        95.5    7e-19   Brassica napus [oilseed rape]
gb|AFW78403.1|  putative leucine-rich repeat receptor-like protei...  95.1    7e-19   Zea mays [maize]
ref|XP_006842574.1|  hypothetical protein AMTR_s00077p00152440        95.1    7e-19   
ref|XP_008649789.1|  PREDICTED: probable LRR receptor-like serine...  95.1    7e-19   Zea mays [maize]
ref|XP_010486768.1|  PREDICTED: probable LRR receptor-like serine...  95.1    7e-19   Camelina sativa [gold-of-pleasure]
gb|EEE64118.1|  hypothetical protein OsJ_18950                        95.1    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649777.1|  PREDICTED: probable LRR receptor-like serine...  95.1    8e-19   Zea mays [maize]
ref|XP_002892361.1|  predicted protein                                95.1    8e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_010475436.1|  PREDICTED: probable LRR receptor-like serine...  95.1    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010475435.1|  PREDICTED: probable LRR receptor-like serine...  95.1    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008649788.1|  PREDICTED: probable LRR receptor-like serine...  95.1    9e-19   Zea mays [maize]
ref|XP_010496824.1|  PREDICTED: probable LRR receptor-like serine...  94.7    9e-19   Camelina sativa [gold-of-pleasure]
gb|KCW52448.1|  hypothetical protein EUGRSUZ_J01846                   95.1    9e-19   Eucalyptus grandis [rose gum]
ref|XP_007033468.1|  LRR receptor-like serine/threonine-protein k...  94.7    9e-19   Theobroma cacao [chocolate]
gb|KJB71495.1|  hypothetical protein B456_011G125500                  94.7    1e-18   Gossypium raimondii
emb|CDY61604.1|  BnaC03g71330D                                        94.7    1e-18   Brassica napus [oilseed rape]
ref|XP_006654549.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   Oryza brachyantha
ref|XP_009119026.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   Brassica rapa
ref|XP_006644909.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   
gb|EEC71706.1|  hypothetical protein OsI_04218                        94.7    1e-18   Oryza sativa Indica Group [Indian rice]
emb|CDY54882.1|  BnaA10g27950D                                        94.7    1e-18   Brassica napus [oilseed rape]
ref|NP_195815.3|  leucine-rich repeat protein kinase-like protein     94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57828.1|  BnaCnng32490D                                        94.7    1e-18   Brassica napus [oilseed rape]
ref|XP_009783324.1|  PREDICTED: probable LRR receptor-like serine...  94.4    1e-18   Nicotiana sylvestris
ref|XP_010490488.1|  PREDICTED: probable LRR receptor-like serine...  94.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009406863.1|  PREDICTED: probable LRR receptor-like serine...  94.4    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG26417.1|  hypothetical protein F383_04408                       94.4    1e-18   Gossypium arboreum [tree cotton]
gb|EEE55585.1|  hypothetical protein OsJ_03881                        94.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009621385.1|  PREDICTED: probable LRR receptor-like serine...  94.4    2e-18   Nicotiana tomentosiformis
gb|KHG26416.1|  hypothetical protein F383_04408                       94.4    2e-18   Gossypium arboreum [tree cotton]
ref|XP_009783320.1|  PREDICTED: probable LRR receptor-like serine...  94.4    2e-18   Nicotiana sylvestris
ref|XP_009783321.1|  PREDICTED: probable LRR receptor-like serine...  94.4    2e-18   Nicotiana sylvestris
gb|KEH34525.1|  LRR receptor-like kinase                              93.6    2e-18   Medicago truncatula
ref|XP_006842575.1|  hypothetical protein AMTR_s00077p00153450        94.0    2e-18   
ref|XP_010244582.1|  PREDICTED: probable LRR receptor-like serine...  94.0    2e-18   Nelumbo nucifera [Indian lotus]
gb|KJB29851.1|  hypothetical protein B456_005G121200                  94.0    2e-18   Gossypium raimondii
gb|KEH34526.1|  LRR receptor-like kinase                              93.6    2e-18   Medicago truncatula
dbj|BAD73350.1|  protein kinase-like                                  92.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006481245.1|  PREDICTED: probable LRR receptor-like serine...  93.6    2e-18   Citrus sinensis [Valencia orange]
dbj|BAK03216.1|  predicted protein                                    92.8    2e-18   Hordeum vulgare subsp. vulgare [barley]
gb|KDO64177.1|  hypothetical protein CISIN_1g002158mg                 93.6    2e-18   Citrus sinensis [Valencia orange]
ref|XP_006481243.1|  PREDICTED: probable LRR receptor-like serine...  93.6    2e-18   Citrus sinensis [Valencia orange]
ref|XP_006481242.1|  PREDICTED: probable LRR receptor-like serine...  93.6    2e-18   Citrus sinensis [Valencia orange]
ref|XP_011095176.1|  PREDICTED: probable LRR receptor-like serine...  93.6    2e-18   Sesamum indicum [beniseed]
ref|XP_006429640.1|  hypothetical protein CICLE_v10013792mg           93.6    3e-18   Citrus clementina
gb|AES70805.2|  LRR receptor-like kinase                              93.6    3e-18   Medicago truncatula
ref|XP_003600554.1|  hypothetical protein MTR_3g062570                93.6    3e-18   
ref|XP_010522021.1|  PREDICTED: probable LRR receptor-like serine...  93.6    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_010244581.1|  PREDICTED: probable LRR receptor-like serine...  93.2    3e-18   Nelumbo nucifera [Indian lotus]
gb|EMT05020.1|  Putative LRR receptor-like serine/threonine-prote...  93.2    3e-18   Aegilops tauschii
tpg|DAA57081.1|  TPA: putative leucine-rich repeat receptor-like ...  93.2    3e-18   Zea mays [maize]
ref|XP_008652663.1|  PREDICTED: probable LRR receptor-like serine...  93.2    3e-18   Zea mays [maize]
ref|XP_010244577.1|  PREDICTED: probable LRR receptor-like serine...  93.2    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009614147.1|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   Nicotiana tomentosiformis
ref|XP_008652670.1|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   Zea mays [maize]
ref|XP_003568234.2|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   
ref|XP_010231258.1|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   Brachypodium distachyon [annual false brome]
ref|XP_009370883.1|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009395171.1|  PREDICTED: probable LRR receptor-like serine...  92.8    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395172.1|  PREDICTED: probable LRR receptor-like serine...  92.8    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004249029.1|  PREDICTED: probable LRR receptor-like serine...  92.8    6e-18   Solanum lycopersicum
ref|XP_010542705.1|  PREDICTED: probable LRR receptor-like serine...  92.8    6e-18   Tarenaya hassleriana [spider flower]
ref|XP_011080636.1|  PREDICTED: probable LRR receptor-like serine...  92.4    6e-18   Sesamum indicum [beniseed]
ref|XP_006646231.1|  PREDICTED: probable LRR receptor-like serine...  89.0    6e-18   
gb|KDP21843.1|  hypothetical protein JCGZ_00630                       92.4    6e-18   Jatropha curcas
ref|XP_006362336.1|  PREDICTED: probable LRR receptor-like serine...  92.4    6e-18   Solanum tuberosum [potatoes]
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...  92.4    7e-18   Vitis vinifera
ref|XP_010522022.1|  PREDICTED: probable LRR receptor-like serine...  92.4    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...  92.4    7e-18   Vitis vinifera
gb|EPS60654.1|  hypothetical protein M569_14148                       92.0    7e-18   Genlisea aurea
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...  92.4    8e-18   Vitis vinifera
emb|CBI31162.3|  unnamed protein product                              92.4    8e-18   Vitis vinifera
emb|CDP01074.1|  unnamed protein product                              91.3    9e-18   Coffea canephora [robusta coffee]
gb|KEH23301.1|  LRR receptor-like kinase                              91.7    9e-18   Medicago truncatula
ref|XP_009780438.1|  PREDICTED: probable LRR receptor-like serine...  92.0    9e-18   Nicotiana sylvestris
ref|XP_006360628.1|  PREDICTED: probable LRR receptor-like serine...  92.0    1e-17   Solanum tuberosum [potatoes]
ref|XP_002458681.1|  hypothetical protein SORBIDRAFT_03g038090        92.0    1e-17   Sorghum bicolor [broomcorn]
ref|XP_003533651.1|  PREDICTED: probable LRR receptor-like serine...  92.0    1e-17   Glycine max [soybeans]
ref|XP_003623645.1|  Leucine-rich repeat protein kinase               92.0    1e-17   
ref|XP_009614146.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   Nicotiana tomentosiformis
gb|AES79863.2|  LRR receptor-like kinase                              91.7    1e-17   Medicago truncatula
ref|XP_009780439.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   Nicotiana sylvestris
ref|XP_010922797.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   Elaeis guineensis
gb|KEH23302.1|  LRR receptor-like kinase                              91.7    1e-17   Medicago truncatula
gb|AAF63151.1|AC011001_21  Hypothetical protein                       91.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922796.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   Elaeis guineensis
ref|XP_002319436.2|  hypothetical protein POPTR_0013s15550g           91.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003567224.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_008366925.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-17   Malus domestica [apple tree]
ref|XP_010553166.1|  PREDICTED: probable LRR receptor-like serine...  91.3    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_006587902.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-17   Glycine max [soybeans]
ref|NP_172169.2|  probable LRR receptor-like serine/threonine-pro...  91.3    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHN29480.1|  Putative LRR receptor-like serine/threonine-prote...  91.3    2e-17   Glycine soja [wild soybean]
ref|XP_006360624.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-17   
gb|KHN40602.1|  Putative LRR receptor-like serine/threonine-prote...  91.3    2e-17   Glycine soja [wild soybean]
ref|XP_006376568.1|  hypothetical protein POPTR_0013s15550g           90.9    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003552328.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-17   Glycine max [soybeans]
ref|XP_006376567.1|  hypothetical protein POPTR_0013s15550g           90.9    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004970379.1|  PREDICTED: probable LRR receptor-like serine...  90.9    2e-17   Setaria italica
ref|XP_011466400.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-17   Fragaria vesca subsp. vesca
ref|XP_007140045.1|  hypothetical protein PHAVU_008G079800g           90.5    3e-17   Phaseolus vulgaris [French bean]
gb|EYU42054.1|  hypothetical protein MIMGU_mgv1a000864mg              90.5    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_008244520.1|  PREDICTED: probable LRR receptor-like serine...  90.5    3e-17   Prunus mume [ume]
ref|XP_007205469.1|  hypothetical protein PRUPE_ppa008002mg           87.8    3e-17   Prunus persica
gb|EPS66864.1|  hypothetical protein M569_07912                       89.0    3e-17   Genlisea aurea
ref|XP_010543142.1|  PREDICTED: probable LRR receptor-like serine...  90.5    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_002323095.2|  hypothetical protein POPTR_0016s14690g           90.5    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008244528.1|  PREDICTED: probable LRR receptor-like serine...  90.1    3e-17   Prunus mume [ume]
gb|KCW88415.1|  hypothetical protein EUGRSUZ_A00802                   90.5    3e-17   Eucalyptus grandis [rose gum]
ref|XP_010043804.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   Eucalyptus grandis [rose gum]
ref|XP_002987562.1|  hypothetical protein SELMODRAFT_10265            90.1    4e-17   Selaginella moellendorffii
ref|XP_003632548.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   Vitis vinifera
ref|XP_010653123.1|  PREDICTED: probable LRR receptor-like serine...  90.1    5e-17   Vitis vinifera
ref|XP_011001647.1|  PREDICTED: probable LRR receptor-like serine...  89.7    5e-17   Populus euphratica
ref|XP_009337807.1|  PREDICTED: probable LRR receptor-like serine...  89.7    6e-17   Pyrus x bretschneideri [bai li]
gb|EYU46036.1|  hypothetical protein MIMGU_mgv1a021178mg              89.4    7e-17   Erythranthe guttata [common monkey flower]
ref|XP_002992827.1|  hypothetical protein SELMODRAFT_136038           89.4    7e-17   Selaginella moellendorffii
ref|XP_010327702.1|  PREDICTED: probable LRR receptor-like serine...  89.4    7e-17   Solanum lycopersicum
gb|EPS63348.1|  hypothetical protein M569_11437                       89.4    7e-17   Genlisea aurea
ref|XP_004249703.1|  PREDICTED: probable LRR receptor-like serine...  89.4    7e-17   Solanum lycopersicum
ref|XP_001782094.1|  predicted protein                                89.0    7e-17   Physcomitrella patens
ref|XP_008350579.1|  PREDICTED: probable LRR receptor-like serine...  89.0    9e-17   
ref|XP_008350578.1|  PREDICTED: probable LRR receptor-like serine...  89.0    9e-17   Malus domestica [apple tree]
emb|CAN80670.1|  hypothetical protein VITISV_025635                   88.6    1e-16   Vitis vinifera
ref|XP_010683435.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010683436.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008388895.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-16   
ref|XP_002323097.2|  hypothetical protein POPTR_0016s14710g           88.2    1e-16   Populus trichocarpa [western balsam poplar]
dbj|BAJ98336.1|  predicted protein                                    88.6    1e-16   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK06660.1|  predicted protein                                    88.6    1e-16   Hordeum vulgare subsp. vulgare [barley]
gb|EMT31232.1|  Putative LRR receptor-like serine/threonine-prote...  88.6    1e-16   Aegilops tauschii
emb|CDP06372.1|  unnamed protein product                              87.8    2e-16   Coffea canephora [robusta coffee]
ref|XP_006398557.1|  hypothetical protein EUTSA_v10012735mg           87.8    2e-16   Eutrema salsugineum
ref|XP_010067119.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-16   Eucalyptus grandis [rose gum]
ref|XP_007206541.1|  hypothetical protein PRUPE_ppa018820mg           87.8    2e-16   Prunus persica
ref|XP_002870531.1|  hypothetical protein ARALYDRAFT_493720           87.4    3e-16   Arabidopsis lyrata subsp. lyrata
emb|CDM84746.1|  unnamed protein product                              87.4    3e-16   Triticum aestivum [Canadian hard winter wheat]
ref|NP_198561.1|  probable LRR receptor-like serine/threonine-pro...  87.4    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398558.1|  hypothetical protein EUTSA_v10012735mg           87.0    4e-16   Eutrema salsugineum
sp|C0LGU1.1|Y5374_ARATH  RecName: Full=Probable LRR receptor-like...  87.4    4e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10966.1|  receptor protein kinase-like protein                 87.0    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286080.1|  hypothetical protein CARUB_v10007617mg           87.0    4e-16   Capsella rubella
ref|XP_010450496.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  87.0    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011001639.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-16   Populus euphratica
ref|XP_011001640.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-16   Populus euphratica
ref|XP_007208638.1|  hypothetical protein PRUPE_ppa020089mg           86.7    5e-16   Prunus persica
ref|XP_011001641.1|  PREDICTED: probable LRR receptor-like serine...  86.7    5e-16   Populus euphratica
ref|XP_008244509.1|  PREDICTED: probable LRR receptor-like serine...  86.7    6e-16   
ref|XP_001773507.1|  predicted protein                                86.7    6e-16   Physcomitrella patens
ref|XP_006362355.1|  PREDICTED: probable LRR receptor-like serine...  86.3    7e-16   
ref|XP_011001642.1|  PREDICTED: probable LRR receptor-like serine...  86.3    8e-16   Populus euphratica
emb|CDY11169.1|  BnaA03g00050D                                        85.9    1e-15   Brassica napus [oilseed rape]
ref|XP_009130612.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  85.9    1e-15   Brassica rapa
emb|CDY61605.1|  BnaC03g71340D                                        85.9    1e-15   Brassica napus [oilseed rape]
dbj|BAJ97393.1|  predicted protein                                    85.5    1e-15   Hordeum vulgare subsp. vulgare [barley]
gb|EMT31233.1|  Putative LRR receptor-like serine/threonine-prote...  85.5    1e-15   Aegilops tauschii
ref|XP_003621675.1|  Receptor protein kinase-like protein             85.1    2e-15   
ref|XP_001783836.1|  predicted protein                                85.1    2e-15   
gb|AES77893.2|  LRR receptor-like kinase                              85.1    2e-15   
gb|KHN40999.1|  Putative LRR receptor-like serine/threonine-prote...  85.1    2e-15   
ref|XP_006575460.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-15   
emb|CDM84748.1|  unnamed protein product                              84.7    2e-15   
ref|XP_006575461.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-15   
gb|KFK24692.1|  hypothetical protein AALP_AA8G012400                  84.3    3e-15   
ref|XP_003616057.1|  Protein kinase-like protein                      84.3    4e-15   
ref|XP_001770712.1|  predicted protein                                84.0    4e-15   
ref|XP_007142004.1|  hypothetical protein PHAVU_008G244400g           84.0    4e-15   
gb|KHN30616.1|  Putative LRR receptor-like serine/threonine-prote...  83.2    7e-15   
emb|CDM81589.1|  unnamed protein product                              82.8    9e-15   
ref|XP_004490733.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-14   
ref|XP_007142017.1|  hypothetical protein PHAVU_008G245600g           82.0    2e-14   
ref|XP_002968204.1|  hypothetical protein SELMODRAFT_90019            81.6    2e-14   
ref|XP_004490730.1|  PREDICTED: probable LRR receptor-like serine...  81.6    2e-14   
ref|XP_002976173.1|  hypothetical protein SELMODRAFT_104181           81.6    3e-14   
ref|XP_003551621.1|  PREDICTED: probable LRR receptor-like serine...  81.3    4e-14   
ref|XP_006596482.1|  PREDICTED: probable LRR receptor-like serine...  80.9    5e-14   
ref|XP_006596480.1|  PREDICTED: probable LRR receptor-like serine...  80.9    5e-14   
ref|XP_007142008.1|  hypothetical protein PHAVU_008G2448001g          76.6    7e-14   
ref|XP_007142011.1|  hypothetical protein PHAVU_008G245000g           80.1    9e-14   
ref|XP_007142006.1|  hypothetical protein PHAVU_008G244600g           78.6    1e-13   
ref|XP_007140047.1|  hypothetical protein PHAVU_008G080000g           79.3    1e-13   
ref|NP_001240130.1|  probable LRR receptor-like serine/threonine-...  79.0    2e-13   
ref|XP_006595541.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   
gb|KHN30615.1|  Putative LRR receptor-like serine/threonine-prote...  79.3    2e-13   
gb|AFW78431.1|  putative leucine-rich repeat receptor-like protei...  73.6    6e-13   
emb|CDX73538.1|  BnaC08g24650D                                        77.0    1e-12   
emb|CDX78191.1|  BnaA09g33860D                                        76.6    1e-12   
ref|XP_009116056.1|  PREDICTED: putative leucine-rich repeat rece...  76.3    2e-12   
ref|XP_001780578.1|  predicted protein                                75.1    4e-12   
ref|XP_006385116.1|  leucine-rich repeat family protein               74.7    4e-12   
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g           74.7    5e-12   
ref|XP_009365992.1|  PREDICTED: probable leucine-rich repeat rece...  74.7    5e-12   
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...  74.7    5e-12   
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258           74.3    6e-12   
gb|EYU46037.1|  hypothetical protein MIMGU_mgv1a026096mg              73.9    7e-12   
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...  74.3    7e-12   
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...  74.3    8e-12   
ref|XP_002962583.1|  hypothetical protein SELMODRAFT_438263           73.9    8e-12   
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    9e-12   
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...  73.9    1e-11   
gb|EPS73566.1|  hypothetical protein M569_01190                       73.6    1e-11   
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_010427010.1|  PREDICTED: putative leucine-rich repeat rece...  73.6    1e-11   
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_010504126.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...  73.6    1e-11   
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...  73.6    1e-11   
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative   73.6    1e-11   
emb|CDY70266.1|  BnaCnng67530D                                        73.2    1e-11   
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    1e-11   
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    1e-11   
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    2e-11   
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    2e-11   
ref|XP_008442305.1|  PREDICTED: probable leucine-rich repeat rece...  73.2    2e-11   
ref|XP_002877928.1|  hypothetical protein ARALYDRAFT_906749           72.8    2e-11   
emb|CDY21453.1|  BnaC03g27440D                                        72.0    2e-11   
gb|KDP32456.1|  hypothetical protein JCGZ_13381                       72.8    2e-11   
ref|XP_004137665.1|  PREDICTED: probable leucine-rich repeat rece...  72.8    2e-11   
ref|XP_009417854.1|  PREDICTED: probable leucine-rich repeat rece...  72.8    2e-11   
gb|KJB68014.1|  hypothetical protein B456_010G221900                  72.8    2e-11   
gb|KJB68016.1|  hypothetical protein B456_010G221900                  72.8    2e-11   
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800        72.8    2e-11   
ref|XP_008245810.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    2e-11   
ref|XP_006403671.1|  hypothetical protein EUTSA_v10010104mg           72.8    2e-11   
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    3e-11   
gb|EEE52939.1|  hypothetical protein OsJ_35571                        68.6    3e-11   
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    3e-11   
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    3e-11   
sp|Q9LFG1.2|Y3359_ARATH  RecName: Full=Putative leucine-rich repe...  72.4    3e-11   
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...  72.4    3e-11   
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg           72.8    3e-11   
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                   72.4    3e-11   
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  72.4    3e-11   
ref|XP_006429976.1|  hypothetical protein CICLE_v100110351mg          72.0    3e-11   
ref|NP_190927.1|  putative leucine-rich repeat receptor-like seri...  72.0    3e-11   
ref|XP_009781542.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-11   
gb|AFW78432.1|  putative leucine-rich repeat receptor-like protei...  72.0    3e-11   
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                   72.0    3e-11   
emb|CDY49740.1|  BnaA02g19320D                                        72.4    4e-11   
emb|CDY12940.1|  BnaA09g13340D                                        72.0    4e-11   
gb|EPS73565.1|  hypothetical protein M569_01189                       72.0    4e-11   
emb|CDY61244.1|  BnaCnng37500D                                        72.0    4e-11   
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                 72.0    4e-11   
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g           72.0    4e-11   
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
emb|CDM84720.1|  unnamed protein product                              72.0    4e-11   
dbj|BAA98164.1|  receptor protein kinase-like                         72.0    4e-11   
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    4e-11   
ref|XP_009365988.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg           72.0    4e-11   
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein     72.0    4e-11   
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
ref|XP_007207226.1|  hypothetical protein PRUPE_ppa000992mg           72.0    4e-11   
emb|CDY21455.1|  BnaC03g27420D                                        72.0    4e-11   
emb|CDY21452.1|  BnaC03g27450D                                        72.0    4e-11   
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...  72.0    4e-11   
emb|CDX83184.1|  BnaA03g23220D                                        72.0    4e-11   
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    4e-11   
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...  71.6    4e-11   
ref|XP_002864014.1|  leucine-rich repeat family protein               71.6    4e-11   
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg           71.6    4e-11   
ref|XP_006290609.1|  hypothetical protein CARUB_v10016698mg           71.6    5e-11   
emb|CDP08081.1|  unnamed protein product                              71.6    5e-11   
ref|XP_009337850.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg              71.6    5e-11   
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                  71.6    5e-11   
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg           71.6    5e-11   
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
gb|EMT20930.1|  Putative LRR receptor-like serine/threonine-prote...  71.6    5e-11   
ref|XP_007208371.1|  hypothetical protein PRUPE_ppa000921mg           71.6    5e-11   
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                 71.6    5e-11   
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    5e-11   
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                 71.6    6e-11   
ref|XP_008245573.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    6e-11   
gb|KCW62546.1|  hypothetical protein EUGRSUZ_G00038                   71.2    6e-11   
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    6e-11   
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...  71.6    6e-11   
ref|XP_002303228.2|  hypothetical protein POPTR_0003s03690g           70.9    6e-11   
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...  71.2    6e-11   
gb|KEH20271.1|  receptor-like kinase                                  70.9    6e-11   
ref|XP_008813720.1|  PREDICTED: probable LRR receptor-like serine...  67.4    6e-11   
gb|KJB29747.1|  hypothetical protein B456_005G116800                  71.2    7e-11   
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...  71.2    7e-11   
gb|KCW88496.1|  hypothetical protein EUGRSUZ_A00883                   71.2    7e-11   
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...  71.2    7e-11   
ref|XP_002519985.1|  receptor protein kinase, putative                71.2    7e-11   
ref|XP_001760085.1|  predicted protein                                71.2    8e-11   
ref|XP_009419865.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    8e-11   
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg           70.9    9e-11   
gb|KDP21809.1|  hypothetical protein JCGZ_00596                       70.5    9e-11   
ref|XP_009391654.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    9e-11   
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    9e-11   
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg              70.5    1e-10   
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_008782792.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                   70.5    1e-10   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                   70.5    1e-10   
ref|XP_008370575.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-10   
gb|EEC79425.1|  hypothetical protein OsI_20397                        70.5    1e-10   
ref|XP_006655431.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    1e-10   
ref|XP_007019716.1|  Leucine-rich repeat protein kinase family pr...  70.5    1e-10   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                   70.5    1e-10   
ref|NP_001055877.1|  Os05g0486100                                     70.5    1e-10   
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-10   
ref|XP_002456530.1|  hypothetical protein SORBIDRAFT_03g037960        70.1    1e-10   
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-10   
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g           70.1    1e-10   
ref|XP_003547844.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-10   
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-10   
emb|CDY19539.1|  BnaC09g13640D                                        70.1    2e-10   
ref|XP_011461103.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
ref|XP_009365989.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
ref|XP_011088110.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...  70.1    2e-10   
gb|EMT14100.1|  Putative LRR receptor-like serine/threonine-prote...  70.1    2e-10   
emb|CDY22287.1|  BnaC02g25910D                                        70.1    2e-10   
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g           70.1    2e-10   
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                  70.1    2e-10   
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
tpg|DAA57113.1|  TPA: putative transmembrane protein kinase famil...  70.1    2e-10   
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    2e-10   
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_004249557.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_004485853.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
gb|AAT01330.1|  putative receptor protein kinase                      69.7    2e-10   
ref|XP_008465342.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...  69.3    2e-10   
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...  69.7    2e-10   
ref|XP_011461109.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-10   
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...  69.7    2e-10   
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase       69.3    2e-10   
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-10   
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg           69.7    2e-10   
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-10   
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...  69.3    2e-10   
ref|XP_007023751.1|  Leucine-rich repeat family protein / protein...  68.2    3e-10   
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    3e-10   
gb|KEH20269.1|  LRR receptor-like kinase                              69.3    3e-10   
ref|XP_007023746.1|  Leucine-rich repeat protein kinase family pr...  68.9    3e-10   
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase       69.3    3e-10   
gb|AAF68126.1|AC010793_21  F20B17.5                                   69.3    3e-10   



>ref|XP_008782697.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Phoenix dactylifera]
Length=945

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS+
Sbjct  787  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVST  834


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+ AY SGM+FSVID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  829  VREVSTAYQSGMMFSVIDSRMGSYPSECIEKFVSLALRCCQDETD  873



>ref|XP_008782698.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Phoenix dactylifera]
Length=841

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS+
Sbjct  683  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVST  730


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+ AY SGM+FSVID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  725  VREVSTAYQSGMMFSVIDSRMGSYPSECIEKFVSLALRCCQDETD  769



>dbj|BAD87127.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=361

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = -2

Query  581  RASNLLMSS*YV----------FVWRTESSHMLRSHKNMAF--LQGYLDPEYFLTHKLTD  438
            +ASN+L+ S +V               ES  +   H +       GYLDPEYFLTHKLTD
Sbjct  147  KASNILLDSKFVAKVADFGLSRLAPEPESEGIAPGHVSTVIKGTPGYLDPEYFLTHKLTD  206

Query  437  KSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            KSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  207  KSDVYSLGVVFLELLTGMQPISHGRNIVREV  237


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  234  VREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  278



>gb|KGN63923.1| hypothetical protein Csa_1G027520 [Cucumis sativus]
Length=258

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTG HPISHGKNIVREV+S
Sbjct  102  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHPISHGKNIVREVNS  149


 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  144  VREVNSAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  188



>ref|XP_002323098.2| hypothetical protein POPTR_0016s14720g [Populus trichocarpa]
 gb|EEF04859.2| hypothetical protein POPTR_0016s14720g [Populus trichocarpa]
Length=961

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPISHGKNIVREV+
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPISHGKNIVREVN  842


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMG+YPSECVE+F+ LAL CC D  +
Sbjct  838  VREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCHDKQE  882



>ref|XP_011001645.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=961

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPISHGKNIVREV+
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPISHGKNIVREVN  842


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  838  VREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  882



>ref|XP_011001644.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=971

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPISHGKNIVREV+
Sbjct  806  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPISHGKNIVREVN  852


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  848  VREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  892



>ref|XP_011006277.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=961

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPISHGKNIVREV+
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPISHGKNIVREVN  842


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  838  VREVNMAHQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  882



>ref|XP_010098597.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB75308.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=164

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  488  LQGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            +QGYLDPEY LTHKLTDKSDVYSLG+VFLELLTGM PISHG+NIVREV
Sbjct  1    MQGYLDPEYLLTHKLTDKSDVYSLGIVFLELLTGMPPISHGRNIVREV  48


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V+ A  SG + SVID  MG+Y +ECV+KF+ LALKCC D+T
Sbjct  45   VREVHAACESGTMLSVIDRDMGTYDTECVKKFMQLALKCCHDET  88



>ref|XP_010921201.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Elaeis guineensis]
Length=944

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV++
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVTT  833


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SGM+FSVID  MGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  828  VREVTTAYQSGMMFSVIDSLMGSYPSECIEKFVSLALRCCQDETD  872



>gb|AFW78405.1| putative leucine-rich repeat receptor-like protein kinase family 
protein, partial [Zea mays]
Length=245

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  86   GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  133


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  128  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  172



>gb|EEC72206.1| hypothetical protein OsI_05294 [Oryza sativa Indica Group]
Length=241

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  72   GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  117


 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  114  VREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  158



>ref|XP_002447392.1| hypothetical protein SORBIDRAFT_06g000230 [Sorghum bicolor]
 gb|EES11720.1| hypothetical protein SORBIDRAFT_06g000230 [Sorghum bicolor]
Length=243

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  75   GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  120


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMIFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  117  VREVLAANQSGMIFSVVDNRMGSYPAECVEKFSALALRCCQDETD  161



>emb|CAN75549.1| hypothetical protein VITISV_043541 [Vitis vinifera]
Length=782

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  624  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  670


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNV+Y SGMIFSVID RMGSYPSECVEKF+ LALKCCQ+DTD
Sbjct  666  VREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLALKCCQEDTD  710



>emb|CBI15799.3| unnamed protein product [Vitis vinifera]
Length=960

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  802  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  848


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNV+Y SGMIFSVID RMGSYPSECVEKF+ LALKCCQ+DTD
Sbjct  844  VREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLALKCCQEDTD  888



>ref|XP_002276020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650802.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650804.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
Length=959

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  801  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  847


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNV+Y SGMIFSVID RMGSYPSECVEKF+ LALKCCQ+DTD
Sbjct  843  VREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLALKCCQEDTD  887



>ref|XP_009355132.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
Length=952

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  839


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCC+++TD
Sbjct  835  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKEETD  879



>ref|XP_008354331.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=953

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  840


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCC+++TD
Sbjct  836  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKEETD  880



>ref|XP_009355137.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Pyrus x bretschneideri]
Length=951

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  792  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  838


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCC+++TD
Sbjct  834  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKEETD  878



>emb|CDP04034.1| unnamed protein product [Coffea canephora]
Length=955

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  841


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIFSVID+ MGSYPSECVEKFI LALKCC ++ D
Sbjct  837  VREVNIAYRSGMIFSVIDDSMGSYPSECVEKFINLALKCCLEEPD  881



>ref|XP_011461391.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Fragaria vesca subsp. vesca]
Length=958

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  798  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  844


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPS+CVEKF++LALKCCQD+TD
Sbjct  840  VREVNIAFQSGMIFSVIDARMGSYPSDCVEKFLSLALKCCQDETD  884



>ref|XP_004500393.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Cicer arietinum]
 ref|XP_004500394.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Cicer arietinum]
Length=948

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  788  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  834


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN++Y SG+IFS+ID RMGSYPSE VEKF++LALKCC D+ D
Sbjct  830  VREVNLSYQSGVIFSIIDARMGSYPSEHVEKFLSLALKCCNDEPD  874



>ref|XP_011461389.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011461390.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Fragaria vesca subsp. vesca]
Length=959

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  799  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  845


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPS+CVEKF++LALKCCQD+TD
Sbjct  841  VREVNIAFQSGMIFSVIDARMGSYPSDCVEKFLSLALKCCQDETD  885



>ref|XP_011089544.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=957

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV++
Sbjct  799  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMHPISHGKNIVREVNN  846


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SGMIFS+IDE MGSYPSECVEKF+ LALKCCQ++TD
Sbjct  841  VREVNNAYRSGMIFSIIDEHMGSYPSECVEKFVNLALKCCQEETD  885



>ref|XP_008649785.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=338

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  179  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  226


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  221  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  265



>ref|XP_010457834.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=1036

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGMHPI+HGKNIVRE++
Sbjct  879  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMHPITHGKNIVREIN  925


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  921  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  965



>ref|XP_010457836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGMHPI+HGKNIVRE++
Sbjct  714  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMHPITHGKNIVREIN  760


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  756  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  800



>ref|XP_010094444.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB56025.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=983

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI+HGKN+VREV+S
Sbjct  824  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPITHGKNLVREVNS  871


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A+ SG IFSVIDERMGSYPS+CVEKF++LALKCC DD D
Sbjct  866  VREVNSAFQSGTIFSVIDERMGSYPSDCVEKFLSLALKCCHDDPD  910



>gb|KJB83922.1| hypothetical protein B456_013G271600 [Gossypium raimondii]
 gb|KJB83923.1| hypothetical protein B456_013G271600 [Gossypium raimondii]
Length=959

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  799  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  845


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SGMIFSVID RMGSYPSECVEKF+TLALKC  D+TD
Sbjct  841  VREVNVAYHSGMIFSVIDGRMGSYPSECVEKFVTLALKCSHDETD  885



>ref|XP_011011783.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=945

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  787  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  833


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +GMIFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  829  VREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  873



>ref|XP_003537371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006591270.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
 gb|KHN24716.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=954

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  790  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  836


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SG+IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  832  VREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  876



>ref|XP_003600556.1| hypothetical protein MTR_3g062590 [Medicago truncatula]
 gb|AES70807.1| LRR receptor-like kinase [Medicago truncatula]
Length=955

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  839


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN++Y SG+IFS+IDERMGSYPSE VEKF+TLALKC  D+ D
Sbjct  835  VREVNLSYQSGVIFSIIDERMGSYPSEHVEKFLTLALKCVNDEPD  879



>ref|NP_001045466.1| Os01g0960400 [Oryza sativa Japonica Group]
 dbj|BAD87126.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF07380.1| Os01g0960400 [Oryza sativa Japonica Group]
 dbj|BAG99288.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56045.1| hypothetical protein OsJ_04842 [Oryza sativa Japonica Group]
Length=952

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = -2

Query  581  RASNLLMSS*YV----------FVWRTESSHMLRSHKNMAF--LQGYLDPEYFLTHKLTD  438
            +ASN+L+ S +V               ES  +   H +       GYLDPEYFLTHKLTD
Sbjct  738  KASNILLDSKFVAKVADFGLSRLAPEPESEGIAPGHVSTVIKGTPGYLDPEYFLTHKLTD  797

Query  437  KSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            KSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  798  KSDVYSLGVVFLELLTGMQPISHGRNIVREV  828


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  825  VREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  869



>ref|XP_008344795.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=203

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVRE  348
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVRE
Sbjct  121  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVRE  165



>ref|XP_011011778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=964

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  806  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  852


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +GMIFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  848  VREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  892



>ref|XP_002533344.1| protein with unknown function [Ricinus communis]
 gb|EEF29043.1| protein with unknown function [Ricinus communis]
Length=844

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  685  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  731


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNV+Y SGMIFSVIDERMGSYPS+CVEKF+ LAL+CCQD+TD
Sbjct  727  VREVNVSYQSGMIFSVIDERMGSYPSDCVEKFLNLALRCCQDETD  771



>ref|XP_011006276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=971

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPISHGKNIVREV+
Sbjct  806  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPISHGKNIVREVN  852


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  848  VREVNMAHQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  892



>ref|XP_002319433.2| hypothetical protein POPTR_0013s15520g [Populus trichocarpa]
 gb|EEE95356.2| hypothetical protein POPTR_0013s15520g [Populus trichocarpa]
Length=965

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  807  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  853


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +GMIFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  849  VREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  893



>ref|XP_003565200.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
Length=946

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKN+VREV
Sbjct  785  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNLVREV  830


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMG  P ECVE+F  LAL+CC+D+TD
Sbjct  827  VREVVAANQSGMILSVVDRRMGPCPGECVERFAALALRCCRDETD  871



>gb|KDO54923.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=845

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREV  842



>ref|XP_010098600.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB75311.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=945

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV
Sbjct  788  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  833


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SG +FSVID RMGSYPSEC+E+F  LAL CC + T+
Sbjct  830  VREVMTANHSGTMFSVIDSRMGSYPSECLERFAALALSCCDEKTE  874



>ref|XP_004137372.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cucumis sativus]
Length=952

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTG HPISHGKNIVREV+S
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHPISHGKNIVREVNS  843


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  838  VREVNSAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  882



>ref|XP_010424012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Camelina sativa]
Length=631

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  477  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  524



>ref|XP_004974947.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Setaria italica]
Length=968

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  799  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  844


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMIFSV+D RMGSYP+ECVE+F  LAL+CCQD+TD
Sbjct  841  VREVLAANQSGMIFSVVDNRMGSYPAECVERFAALALRCCQDETD  885



>dbj|BAF01740.1| hypothetical protein [Arabidopsis thaliana]
Length=631

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  477  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  524



>ref|XP_010278952.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nelumbo nucifera]
Length=951

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREVS
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVS  839


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V++AY SGMI SV+D RMGSYPSEC+EKF+TLALKCCQD+T+
Sbjct  835  VREVSMAYQSGMILSVVDGRMGSYPSECIEKFLTLALKCCQDETE  879



>dbj|BAG94134.1| unnamed protein product [Oryza sativa Japonica Group]
Length=285

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREV
Sbjct  119  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREV  164



>dbj|BAF46308.1| leucine-rich repeat transmembrane protein kinase [Ipomoea nil]
Length=377

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTG HPISHGKNIVREV+
Sbjct  221  GYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGKHPISHGKNIVREVN  267



>ref|XP_008354310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=597

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  438  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  484


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCC+ +TD
Sbjct  480  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKXETD  524



>gb|EEC72208.1| hypothetical protein OsI_05296 [Oryza sativa Indica Group]
Length=906

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  737  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  782


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  779  VREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  823



>ref|XP_002531806.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF30563.1| ATP binding protein, putative [Ricinus communis]
Length=961

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PI+HGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPITHGKNIVREVT  841


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A+ SG++FS+ID RMG+YPSECVE+FI LAL CC D+ +
Sbjct  837  VREVTMAHQSGIMFSIIDSRMGAYPSECVERFIALALGCCHDNPE  881



>gb|KJB27626.1| hypothetical protein B456_005G002700 [Gossypium raimondii]
Length=639

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV +
Sbjct  477  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKT  524


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SGM+ S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  519  VREVKTAYESGMVLSIIDSRMGWYPAECMERMVSLALSCCNDEPE  563



>ref|XP_008669743.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008669744.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=952

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  790  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  835


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMIFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  832  VREVLAANQSGMIFSVVDNRMGSYPAECVEKFAALALRCCQDETD  876



>ref|XP_004163829.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like, partial [Cucumis sativus]
Length=581

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV
Sbjct  421  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNIVREV  466



>ref|XP_006645416.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Oryza brachyantha]
 ref|XP_006645417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Oryza brachyantha]
 ref|XP_006645418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Oryza brachyantha]
Length=949

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  784  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  829


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGSYP+E VEKF  LAL+CC+D+TD
Sbjct  826  VREVVAANQSGMILSVVDNRMGSYPAESVEKFAALALRCCRDETD  870



>ref|XP_004961725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Setaria italica]
 ref|XP_004961726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Setaria italica]
Length=945

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  833


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I  +ID RMG  P ECV +F++LA KCCQD+TD
Sbjct  828  VREVNSACQSGNISGIIDGRMGLCPPECVSRFLSLATKCCQDETD  872



>ref|XP_002870890.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47149.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=951

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  844



>ref|XP_002439970.1| hypothetical protein SORBIDRAFT_09g023620 [Sorghum bicolor]
 gb|EES18400.1| hypothetical protein SORBIDRAFT_09g023620 [Sorghum bicolor]
Length=943

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  784  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  831


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+ +F++LA KCCQD+TD
Sbjct  826  VREVNSACQSGSVSEIIDGRMGLYPPECIRRFLSLATKCCQDETD  870



>emb|CAB82765.1| putative protein [Arabidopsis thaliana]
Length=984

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  830  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  877



>gb|KDO54930.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54931.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=707

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  548  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  594


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY S M+FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  590  VREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  634



>ref|XP_002326064.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00446.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=902

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTG  PISHGKNIVREV
Sbjct  744  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGKQPISHGKNIVREV  789


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +AY SGMIFS+IDERMGSYPS+C++KF+TLA+KCC ++TD
Sbjct  786  VREVKIAYQSGMIFSIIDERMGSYPSDCIDKFLTLAMKCCNEETD  830



>ref|XP_006417874.1| hypothetical protein EUTSA_v10006712mg [Eutrema salsugineum]
 gb|ESQ36227.1| hypothetical protein EUTSA_v10006712mg [Eutrema salsugineum]
Length=950

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVREV+
Sbjct  791  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREVN  837


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG I S +D+RM S P+EC+EKF TLAL+ C+++TD
Sbjct  833  VREVNIAYQSGSILSAVDKRMSSVPAECIEKFATLALRSCREETD  877



>ref|XP_008239253.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239390.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
Length=952

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  839


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCCQD+TD
Sbjct  835  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCQDETD  879



>gb|KGN54467.1| hypothetical protein Csa_4G336750 [Cucumis sativus]
Length=953

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNIVREV  838


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/45 (36%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A+  G + S++D  +GS+  +C+E+F+ LA+ CC D+ D
Sbjct  835  VREVKLAHQMGTVLSIVDSTLGSFAPDCLERFVALAISCCHDNPD  879



>ref|XP_006464963.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Citrus sinensis]
 gb|KDO54929.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=843

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  684  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  730


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY S M+FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  726  VREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  770



>ref|XP_004142673.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cucumis sativus]
Length=905

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV
Sbjct  746  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNIVREV  791


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/45 (36%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A+  G + S++D  +GS+  +C+E+F+ LA+ CC D+ D
Sbjct  788  VREVKLAHQMGTVLSIVDSTLGSFAPDCLERFVALAISCCHDNPD  832



>ref|XP_011011784.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Populus euphratica]
Length=862

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  704  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  750


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +GMIFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  746  VREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  790



>ref|XP_008463289.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Cucumis melo]
Length=957

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNIVREV  842


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/45 (38%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A+ +G I S++D  +GS+  EC+E+F+ LA+ CC D+ +
Sbjct  839  VREVKLAHQTGTILSIVDTTLGSFTPECLERFVALAISCCHDNPE  883



>ref|XP_008463287.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Cucumis melo]
Length=958

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV
Sbjct  798  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNIVREV  843


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/45 (38%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A+ +G I S++D  +GS+  EC+E+F+ LA+ CC D+ +
Sbjct  840  VREVKLAHQTGTILSIVDTTLGSFTPECLERFVALAISCCHDNPE  884



>ref|XP_009130611.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brassica rapa]
Length=944

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  843



>gb|EMT18733.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=461

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKN+VREV
Sbjct  298  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNLVREV  343


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMGS P ECVE+F  L L+CC+D+TD
Sbjct  340  VREVVAANQSGMILSVVDLRMGSVPGECVERFAALGLRCCRDETD  384



>gb|KJB27625.1| hypothetical protein B456_005G002700 [Gossypium raimondii]
Length=959

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV +
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKT  844


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SGM+ S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  839  VREVKTAYESGMVLSIIDSRMGWYPAECMERMVSLALSCCNDEPE  883



>ref|XP_010043840.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
 gb|KCW88418.1| hypothetical protein EUGRSUZ_A00805 [Eucalyptus grandis]
Length=946

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  789  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  835


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +GM+FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  831  VREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  875



>ref|XP_010043831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
Length=952

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  841


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +GM+FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  837  VREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  881



>ref|XP_007206440.1| hypothetical protein PRUPE_ppa000952mg [Prunus persica]
 gb|EMJ07639.1| hypothetical protein PRUPE_ppa000952mg [Prunus persica]
Length=952

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  839


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCCQD+TD
Sbjct  835  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCQDETD  879



>ref|XP_010278958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nelumbo nucifera]
Length=837

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV++
Sbjct  667  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMPPISHGKNIVREVNA  714


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN AY S M  S++D RMGSYPSECVEKF+ LAL+CCQD
Sbjct  709  VREVNAAYRSDMTHSILDNRMGSYPSECVEKFVVLALRCCQD  750



>gb|KHG06096.1| hypothetical protein F383_05597 [Gossypium arboreum]
Length=777

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNIVREV +
Sbjct  615  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKT  662


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A+ SGM+ S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  657  VREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPE  701



>ref|XP_010043866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
 gb|KCW88416.1| hypothetical protein EUGRSUZ_A00803 [Eucalyptus grandis]
Length=948

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  791  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  837


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +GM+FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  833  VREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  877



>ref|XP_006432044.1| hypothetical protein CICLE_v10000174mg [Citrus clementina]
 ref|XP_006464961.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Citrus sinensis]
 ref|XP_006464962.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Citrus sinensis]
 gb|ESR45284.1| hypothetical protein CICLE_v10000174mg [Citrus clementina]
 gb|KDO54919.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54920.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54921.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=956

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  843


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY S M+FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  839  VREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  883



>ref|XP_010043852.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
 ref|XP_010043858.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
Length=959

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  802  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  848


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +GM+FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  844  VREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  888



>ref|XP_007017104.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34723.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=967

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  810  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  856


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SGMIFSV+D RMGSYPSECVEKF+TLALKCCQD+TD
Sbjct  852  VREVNVAYHSGMIFSVVDGRMGSYPSECVEKFVTLALKCCQDETD  896



>gb|KDO54922.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=941

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  782  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  828


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY S M+FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  824  VREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  868



>ref|XP_008366212.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Malus domestica]
Length=953

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  840


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LALKCC+DDTD
Sbjct  836  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCEDDTD  880



>ref|XP_007017105.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34724.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=944

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  787  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  833


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SGMIFSV+D RMGSYPSECVEKF+TLALKCCQD+TD
Sbjct  829  VREVNVAYHSGMIFSVVDGRMGSYPSECVEKFVTLALKCCQDETD  873



>ref|XP_010675301.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=960

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  803  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  849


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G+ FSV DERMGSYPSEC EKF+ LALKCCQD+TD
Sbjct  845  VREVNMAYQAGITFSVFDERMGSYPSECAEKFLNLALKCCQDETD  889



>ref|XP_010675302.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=959

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  802  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  848


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G+ FSV DERMGSYPSEC EKF+ LALKCCQD+TD
Sbjct  844  VREVNMAYQAGITFSVFDERMGSYPSECAEKFLNLALKCCQDETD  888



>ref|XP_009374400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374403.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374404.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374405.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  841


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LAL+CC+DDTD
Sbjct  837  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALRCCEDDTD  881



>ref|XP_009374406.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Pyrus x bretschneideri]
Length=953

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  840


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SGMIFSVID RMGSYPSECVEKF++LAL+CC+DDTD
Sbjct  836  VREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALRCCEDDTD  880



>gb|KDP45677.1| hypothetical protein JCGZ_17284 [Jatropha curcas]
Length=955

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  843


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNV+Y SGMIFSVID RMGSYPS+CVEKF+ LA+KCCQ++TD
Sbjct  839  VREVNVSYQSGMIFSVIDGRMGSYPSDCVEKFLNLAIKCCQEETD  883



>ref|XP_011041757.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Populus euphratica]
 ref|XP_011041758.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Populus euphratica]
Length=964

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTG  PISHGKNIVREV
Sbjct  806  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGKQPISHGKNIVREV  851


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V VAY SGMIFSVIDERMGSYPS+C++KF+TLA+KCC ++T+
Sbjct  848  VREVKVAYQSGMIFSVIDERMGSYPSDCIDKFLTLAMKCCNEETN  892



>ref|XP_009621388.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana tomentosiformis]
Length=878

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  720  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  766


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A+ SG +FS++D RMGSYP+E VEKF+ LALKCCQD
Sbjct  762  VREVNMAHKSGTVFSIMDNRMGSYPAEWVEKFVALALKCCQD  803



>ref|XP_004247017.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Solanum lycopersicum]
Length=953

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  841


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIF+VID++MGSYPSECVEKFI LALKCCQ++T+
Sbjct  837  VREVNLAYRSGMIFNVIDDQMGSYPSECVEKFINLALKCCQEETE  881



>gb|EMT12400.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=995

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTH LTDKSDVYSLGVVFLELLTGM PISHGKN+VREV
Sbjct  828  GYLDPEYFLTHNLTDKSDVYSLGVVFLELLTGMQPISHGKNLVREV  873


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMI SV+D RMG  P EC+E+F  L L+CC+D+TD
Sbjct  870  VREVVAANQSGMILSVVDTRMGPCPGECLERFAALGLRCCRDETD  914



>gb|KHG15448.1| hypothetical protein F383_00176 [Gossypium arboreum]
Length=960

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  800  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  846


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SGMIFSVID RMGSYPSECVEKF+TLALKC QD+TD
Sbjct  842  VREVNVAYHSGMIFSVIDGRMGSYPSECVEKFVTLALKCSQDETD  886



>ref|XP_010326255.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
Length=928

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  770  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  816


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIF+VID++MGSYPSECVEKFI LALKCCQ++T+
Sbjct  812  VREVNLAYRSGMIFNVIDDQMGSYPSECVEKFINLALKCCQEETE  856



>ref|XP_010032944.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
 ref|XP_010032945.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
 gb|KCW52449.1| hypothetical protein EUGRSUZ_J01846 [Eucalyptus grandis]
Length=963

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  805  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  851


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SG  FS++D  MGSYPSEC+EKF+ LALKCCQD+TD
Sbjct  847  VREVNVAYQSGTTFSIVDGSMGSYPSECIEKFLMLALKCCQDETD  891



>ref|XP_008457284.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Cucumis melo]
Length=952

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTG HPISHGKNIVREV+
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHPISHGKNIVREVN  842


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  838  VREVNGAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  882



>gb|AFW78404.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=724

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV +
Sbjct  560  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVCT  607


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  VNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  610  VNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  651



>ref|XP_006359984.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Solanum tuberosum]
 ref|XP_006359985.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Solanum tuberosum]
 ref|XP_006359986.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Solanum tuberosum]
Length=951

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV
Sbjct  792  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREV  837


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V +A+ SG++FS++D+ MGSYPSEC EK + LALKCCQD
Sbjct  834  VREVKMAHKSGVMFSIMDKNMGSYPSECAEKMVELALKCCQD  875



>ref|XP_006344368.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=953

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  841


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIF+VID+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  837  VREVNLAYRSGMIFNVIDDRMGSYPSECVEKFINLALKCCQEETE  881



>ref|XP_006842576.1| hypothetical protein AMTR_s00077p00154750 [Amborella trichopoda]
 gb|ERN04251.1| hypothetical protein AMTR_s00077p00154750 [Amborella trichopoda]
Length=948

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVF ELLTGMHPISHGKNIVREV++
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGVVFHELLTGMHPISHGKNIVREVNN  840


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SGM+ S++D  MGSYPSEC+E+F  LA +CC DDT+
Sbjct  835  VREVNNAYQSGMLCSIVDPHMGSYPSECIEQFARLAFRCCLDDTE  879



>ref|XP_007146906.1| hypothetical protein PHAVU_006G080500g [Phaseolus vulgaris]
 gb|ESW18900.1| hypothetical protein PHAVU_006G080500g [Phaseolus vulgaris]
Length=951

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGMHPISHGKNIVREV+
Sbjct  789  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMHPISHGKNIVREVN  835


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY  G+IFS+ID RMGSYPSE VEKF+TLALKCC+D+ +
Sbjct  831  VREVNIAYQRGVIFSIIDGRMGSYPSEQVEKFLTLALKCCEDEPE  875



>ref|XP_010326251.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
 ref|XP_010326252.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
Length=933

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV
Sbjct  774  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREV  819


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V +A+ SG++FS++D+ MGSYPSEC E+ + LALKCCQD
Sbjct  816  VREVKIAHKSGVMFSIMDKSMGSYPSECAERLMELALKCCQD  857



>gb|AFW78402.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=948

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV +
Sbjct  784  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVCT  831


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  VNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  834  VNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  875



>ref|XP_011018958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=939

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PISHGKNIVREV+
Sbjct  793  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPISHGKNIVREVN  839


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG++FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  835  VREVNMAYKSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  879



>ref|XP_009768306.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=952

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  840


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIF+VID+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  836  VREVNLAYRSGMIFNVIDDRMGSYPSECVEKFINLALKCCQEETE  880



>ref|XP_003552905.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Glycine max]
Length=953

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  789  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  835


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SG+IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  831  VREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  875



>ref|XP_009628064.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=952

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVREVN  840


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SGMIF+V D+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  836  VREVNLAYRSGMIFNVFDDRMGSYPSECVEKFINLALKCCQEETE  880



>ref|XP_006306699.1| hypothetical protein CARUB_v10008222mg [Capsella rubella]
 gb|EOA39597.1| hypothetical protein CARUB_v10008222mg [Capsella rubella]
Length=951

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  794  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  840


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P+EC+EKF TLAL CC+++TD
Sbjct  836  VREINIAYESGSILSAVDKRMSSVPAECLEKFATLALGCCREETD  880



>ref|XP_010486760.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=954

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  797  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  843


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  839  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  883



>tpg|DAA38792.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=523

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  361  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  406


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A  SGMIFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  403  VREVLAANQSGMIFSVVDNRMGSYPAECVEKFAALALRCCQDETD  447



>gb|KFK42998.1| hypothetical protein AALP_AA1G066200 [Arabis alpina]
Length=950

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGMHPI+ GKNIVREV+
Sbjct  792  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMHPITRGKNIVREVN  838


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG I SV+D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  834  VREVNIAYQSGSILSVVDKRMSSVPDECLEKFATLALRCCREETD  878



>ref|XP_004247008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Solanum lycopersicum]
Length=951

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV
Sbjct  792  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREV  837


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V +A+ SG++FS++D+ MGSYPSEC E+ + LALKCCQD
Sbjct  834  VREVKIAHKSGVMFSIMDKSMGSYPSECAERLMELALKCCQD  875



>gb|KHN18646.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=953

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV+
Sbjct  789  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVN  835


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VNVAY SG+IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  831  VREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  875



>ref|XP_004500392.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cicer arietinum]
Length=933

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH LTDKSDVYS+GVVFLELLTGMHPISHGKNIVREV+
Sbjct  787  GYLDPEYFLTHTLTDKSDVYSIGVVFLELLTGMHPISHGKNIVREVN  833


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A  SG I SV DE MGSYP +  +KF TLALKCC+D+ +
Sbjct  829  VREVNLACQSGDISSVTDEHMGSYPFDHADKFFTLALKCCEDEPE  873



>ref|XP_011018957.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=951

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PISHGKNIVREV+
Sbjct  805  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPISHGKNIVREVN  851


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG++FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  847  VREVNMAYKSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  891



>ref|XP_008803012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Phoenix dactylifera]
Length=949

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 45/47 (96%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREVS
Sbjct  792  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMRPILHGKNIVREVS  838


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V++A  SGM+FS+ID  MGSYPSEC+E F++LA +CC+D+ D
Sbjct  834  VREVSMACQSGMMFSIIDNHMGSYPSECIENFVSLARRCCRDEPD  878



>gb|EEC79410.1| hypothetical protein OsI_20362 [Oryza sativa Indica Group]
Length=952

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREV
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREV  831


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  828  VREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>gb|AFW78415.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=835

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  676  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  723


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  718  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  762



>ref|NP_001174468.1| Os05g0481100 [Oryza sativa Japonica Group]
 gb|AAW56867.1| unkown protein [Oryza sativa Japonica Group]
 dbj|BAH93196.1| Os05g0481100 [Oryza sativa Japonica Group]
Length=952

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREV
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREV  831


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  828  VREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>ref|XP_006381260.1| hypothetical protein POPTR_0006s11180g [Populus trichocarpa]
 gb|ERP59057.1| hypothetical protein POPTR_0006s11180g [Populus trichocarpa]
Length=936

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PISHGKNIVREV+
Sbjct  771  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPISHGKNIVREVN  817


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG++FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  813  VREVNMAYQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  857



>ref|XP_007033464.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04390.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=952

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVF+ELLTGM PISHGKNIVREV+
Sbjct  795  GYLDPEYFLTHKLTDKSDVYSLGVVFMELLTGMQPISHGKNIVREVN  841


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A+ SGM+FS+ID RMGSYPSEC+E+F+ LAL CC D
Sbjct  837  VREVNMAHQSGMMFSLIDGRMGSYPSECIERFVGLALSCCHD  878



>emb|CDY10230.1| BnaC05g04730D [Brassica napus]
Length=953

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE +
Sbjct  794  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVRETN  840


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + + N+AY SG I SV+D RM S P+EC+EKF TLAL+CC+++TD
Sbjct  836  VRETNIAYQSGSISSVVDARMSSVPAECIEKFATLALRCCREETD  880



>gb|AFW78403.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=835

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  676  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  723


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  718  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  762



>ref|XP_006842574.1| hypothetical protein AMTR_s00077p00152440 [Amborella trichopoda]
 gb|ERN04249.1| hypothetical protein AMTR_s00077p00152440 [Amborella trichopoda]
Length=901

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV++
Sbjct  752  GYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMRPISHGKNIVREVNT  799


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +VN AY SG + S+ID++MGSYPSEC+++F+ LAL+CC +DT
Sbjct  794  VREVNTAYQSGTLSSIIDQQMGSYPSECLDQFMKLALRCCLEDT  837



>ref|XP_008649789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649790.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649791.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649792.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 gb|AFW78416.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=943

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  784  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  831


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  826  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  870



>ref|XP_010486768.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  714  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  760


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  756  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  800



>gb|EEE64118.1| hypothetical protein OsJ_18950 [Oryza sativa Japonica Group]
Length=1009

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREV
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREV  831


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  828  VREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>ref|XP_008649777.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=943

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  784  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  831


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  826  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  870



>ref|XP_002892361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68620.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=941

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  784  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  830


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  826  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  870



>ref|XP_010475436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  714  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  760


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  756  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  800



>ref|XP_010475435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=953

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE++
Sbjct  796  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVREIN  842


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  838  VREINIAYESGSILSAVDKRMSSVPDECLEKFATLALRCCREETD  882



>ref|XP_008649788.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
Length=984

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+S
Sbjct  825  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVNS  872


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  867  VREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  911



>ref|XP_010496824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Camelina sativa]
Length=702

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  548  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  595



>gb|KCW52448.1| hypothetical protein EUGRSUZ_J01846 [Eucalyptus grandis]
Length=967

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVRE++
Sbjct  805  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVRELA  851


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  130  QVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            QVNVAY SG  FS++D  MGSYPSEC+EKF+ LALKCCQD+TD
Sbjct  853  QVNVAYQSGTTFSIVDGSMGSYPSECIEKFLMLALKCCQDETD  895



>ref|XP_007033468.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
 gb|EOY04394.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
Length=949

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLT+KSDVYSLG+VFLELLTGM PISHG+NIVREV
Sbjct  789  GYLDPEYFLTHKLTEKSDVYSLGIVFLELLTGMQPISHGRNIVREV  834


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +V  A  SG++FS+ID+ MGSYPSEC +KF+ LALKCCQDD
Sbjct  831  VREVYGACQSGLMFSIIDQSMGSYPSECTKKFMALALKCCQDD  873



>gb|KJB71495.1| hypothetical protein B456_011G125500 [Gossypium raimondii]
Length=962

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PISHG+NIVREV
Sbjct  804  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMLPISHGRNIVREV  849


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +V  A  SG++FS+ID+ MG+Y SE ++KF+ LALKCC DD
Sbjct  846  VREVFGACQSGLMFSIIDQSMGAYSSEIIKKFMALALKCCLDD  888



>emb|CDY61604.1| BnaC03g71330D [Brassica napus]
Length=942

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  794  GYLDPEYFLTHKLTDKSDVYSMGVVFLELLTGMHAISHGKNIVREVKT  841



>ref|XP_006654549.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Oryza brachyantha]
 ref|XP_006654550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Oryza brachyantha]
Length=947

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV
Sbjct  788  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREV  833


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SG I  ++D RMG  P ECV+ F  LA+KC +D+TD
Sbjct  830  VREVKKAYQSGNISEIMDSRMGLCPPECVQSFFVLAMKCSRDETD  874



>ref|XP_009119026.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brassica rapa]
Length=949

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE +
Sbjct  790  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVRETN  836


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + + N+AY SG I SV+D+RM S P+EC+EKF TLAL+CC+++TD
Sbjct  832  VRETNIAYQSGSISSVVDKRMSSVPAECIEKFATLALRCCREETD  876



>ref|XP_006644909.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Oryza brachyantha]
Length=948

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PI HGKNIVREV++
Sbjct  788  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQHGKNIVREVNT  835


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  VIDER+ S P ECV +   LA+KCC+D+TD
Sbjct  830  VREVNTAYQSGDIARVIDERIISSPPECVARLAALAVKCCRDETD  874



>gb|EEC71706.1| hypothetical protein OsI_04218 [Oryza sativa Indica Group]
Length=905

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PI HGKNIVREV++
Sbjct  740  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQHGKNIVREVNT  787


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  782  VREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  827



>emb|CDY54882.1| BnaA10g27950D [Brassica napus]
Length=949

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGM PI+HGKNIVRE +
Sbjct  790  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMQPITHGKNIVRETN  836


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + + N+AY SG I SV+D+RM S P+EC+EKF TLAL+CC+++TD
Sbjct  832  VRETNIAYQSGSISSVVDKRMSSVPAECIEKFATLALRCCREETD  876



>ref|NP_195815.3| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 gb|AED90413.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=951

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  844



>emb|CDY57828.1| BnaCnng32490D [Brassica napus]
 emb|CDY11171.1| BnaA03g00070D [Brassica napus]
Length=944

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  796  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  843



>ref|XP_009783324.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Nicotiana sylvestris]
Length=878

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  720  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  766


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++ SG +FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  762  VREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  803



>ref|XP_010490488.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Camelina sativa]
 ref|XP_010490489.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Camelina sativa]
 ref|XP_010490490.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Camelina sativa]
Length=954

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYS+GVVFLELLTGMH ISHGKNIVREV +
Sbjct  800  GYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKT  847



>ref|XP_009406863.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Musa acuminata subsp. malaccensis]
Length=943

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LE+LTGM PISHGKNIVREV+
Sbjct  785  GYLDPEYFLTHKLTDKSDVYSLGVVLLEILTGMQPISHGKNIVREVT  831


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V +A  S M+FS+ID RMGSYPSEC+EKF++LAL+CC D+TD
Sbjct  827  VREVTMACQSSMVFSIIDNRMGSYPSECIEKFVSLALRCCLDETD  871



>gb|KHG26417.1| hypothetical protein F383_04408 [Gossypium arboreum]
Length=966

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM PISHG+NIVREV
Sbjct  809  GYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRPISHGRNIVREV  854


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V +A+ SGM+ S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  851  VREVIMAHQSGMMMSIIDGRMGCYPSECIERFAGLALSCCHN  892



>gb|EEE55585.1| hypothetical protein OsJ_03881 [Oryza sativa Japonica Group]
Length=953

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PI HGKNIVREV++
Sbjct  788  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQHGKNIVREVNT  835


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  830  VREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  875



>ref|XP_009621385.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621386.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621387.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
Length=950

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  792  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  838


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A+ SG +FS++D RMGSYP+E VEKF+ LALKCCQD
Sbjct  834  VREVNMAHKSGTVFSIMDNRMGSYPAEWVEKFVALALKCCQD  875



>gb|KHG26416.1| hypothetical protein F383_04408 [Gossypium arboreum]
Length=982

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM PISHG+NIVREV
Sbjct  825  GYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRPISHGRNIVREV  870


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V +A+ SGM+ S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  867  VREVIMAHQSGMMMSIIDGRMGCYPSECIERFAGLALSCCHN  908



>ref|XP_009783320.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana sylvestris]
Length=960

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  802  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  848


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++ SG +FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  844  VREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  885



>ref|XP_009783321.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
 ref|XP_009783322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
 ref|XP_009783323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
Length=950

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHPISHGKNIVREV+
Sbjct  792  GYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHPISHGKNIVREVN  838


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++ SG +FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  834  VREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  875



>gb|KEH34525.1| LRR receptor-like kinase [Medicago truncatula]
Length=685

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH LTDKSDV+SLGVVFLELLTGM PISHGKNIVREVS
Sbjct  540  GYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQPISHGKNIVREVS  586


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  582  VREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  626



>ref|XP_006842575.1| hypothetical protein AMTR_s00077p00153450 [Amborella trichopoda]
 gb|ERN04250.1| hypothetical protein AMTR_s00077p00153450 [Amborella trichopoda]
Length=853

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLTGMHPIS G+NIVREV++
Sbjct  701  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMHPISQGRNIVREVNN  748


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG++ S+ID +M S P EC+E+F  LAL+CC D TD
Sbjct  743  VREVNNAYRSGLLLSIIDGQMDSCPLECIEQFTKLALQCCLDHTD  787



>ref|XP_010244582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Nelumbo nucifera]
Length=812

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY LTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  654  GYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPISHGKNIVREVN  700


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVAY SGM  S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  696  VREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  737



>gb|KJB29851.1| hypothetical protein B456_005G121200 [Gossypium raimondii]
Length=954

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM PISHG+NIVREV++
Sbjct  797  GYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRPISHGRNIVREVNT  844


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN A+ SG++ S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  839  VREVNTAHQSGLMMSIIDGRMGCYPSECIERFAGLALSCCHN  880



>gb|KEH34526.1| LRR receptor-like kinase [Medicago truncatula]
Length=821

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH LTDKSDV+SLGVVFLELLTGM PISHGKNIVREVS
Sbjct  676  GYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQPISHGKNIVREVS  722


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  718  VREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  762



>dbj|BAD73350.1| protein kinase-like [Oryza sativa Japonica Group]
Length=478

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PI HGKNIVREV++
Sbjct  313  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQHGKNIVREVNT  360


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  355  VREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  400



>ref|XP_006481245.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X4 [Citrus sinensis]
Length=864

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PISHGKNIVREV+
Sbjct  704  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPISHGKNIVREVN  750


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVA  SGM+FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  746  VREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  787



>dbj|BAK03216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+
Sbjct  388  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVN  434


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  ++D RMG  P +C+ +F+ LA KCC+D+TD
Sbjct  430  VREVNKAYQSGNISEIVDSRMGMCPPDCISRFLLLATKCCRDETD  474



>gb|KDO64177.1| hypothetical protein CISIN_1g002158mg [Citrus sinensis]
Length=958

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PISHGKNIVREV+
Sbjct  798  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPISHGKNIVREVN  844


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVA  SGM+FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  840  VREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  881



>ref|XP_006481243.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Citrus sinensis]
 ref|XP_006481244.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Citrus sinensis]
Length=959

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PISHGKNIVREV+
Sbjct  799  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPISHGKNIVREVN  845


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVA  SGM+FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  841  VREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  882



>ref|XP_006481242.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Citrus sinensis]
Length=961

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PISHGKNIVREV+
Sbjct  801  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPISHGKNIVREVN  847


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVA  SGM+FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  843  VREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  884



>ref|XP_011095176.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=977

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  500  NMAFLQGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            N+    GY+DPEYFLTHKLT+KSDVYSLG+VFLELLTGM PISHGKNIVREV++
Sbjct  813  NVKGTPGYVDPEYFLTHKLTEKSDVYSLGIVFLELLTGMQPISHGKNIVREVNT  866


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SGM+FS+ID  MG YPS+ V+KF+ LAL+C  D+T+
Sbjct  861  VREVNTACQSGMMFSIIDRSMGVYPSDSVKKFMALALRCSLDETN  905



>ref|XP_006429640.1| hypothetical protein CICLE_v10013792mg [Citrus clementina]
 gb|ESR42880.1| hypothetical protein CICLE_v10013792mg [Citrus clementina]
Length=1003

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVV LELLTGM PISHGKNIVREV+
Sbjct  843  GYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPISHGKNIVREVN  889


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVA  SGM+FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  885  VREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  926



>gb|AES70805.2| LRR receptor-like kinase [Medicago truncatula]
Length=936

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH LTDKSDV+SLGVVFLELLTGM PISHGKNIVREVS
Sbjct  791  GYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQPISHGKNIVREVS  837


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  833  VREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  877



>ref|XP_003600554.1| hypothetical protein MTR_3g062570 [Medicago truncatula]
Length=977

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH LTDKSDV+SLGVVFLELLTGM PISHGKNIVREVS
Sbjct  832  GYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQPISHGKNIVREVS  878


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  874  VREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  918



>ref|XP_010522021.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Tarenaya hassleriana]
Length=968

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMH IS GKN+VREV++
Sbjct  802  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHAISRGKNLVREVNA  849


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SGMI SVID+RMGS P+ECVEKF TLAL+C +D+T+
Sbjct  844  VREVNAAYQSGMILSVIDKRMGSIPTECVEKFATLALRCSRDETE  888



>ref|XP_010244581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nelumbo nucifera]
Length=866

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY LTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  708  GYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPISHGKNIVREVN  754


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVAY SGM  S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  750  VREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  791



>gb|EMT05020.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=922

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+
Sbjct  763  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVN  809


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  ++D RMG  P +C+ +F+ LA KCCQD+TD
Sbjct  805  VREVNKAYQSGNISEIVDSRMGMCPPDCINRFLLLATKCCQDETD  849



>tpg|DAA57081.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein, partial [Zea mays]
Length=742

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLT++SDVYSLGVVFLELLTGM PI HGKNIVREV+
Sbjct  582  GYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKPIQHGKNIVREVN  628


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  624  VREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  668



>ref|XP_008652663.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
 ref|XP_008674888.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
 tpg|DAA44069.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
 tpg|DAA57080.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=946

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLT++SDVYSLGVVFLELLTGM PI HGKNIVREV+
Sbjct  786  GYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKPIQHGKNIVREVN  832


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  828  VREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  872



>ref|XP_010244577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244579.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
Length=954

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY LTHKLTDKSDVYSLGVVFLELLTGM PISHGKNIVREV+
Sbjct  796  GYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPISHGKNIVREVN  842


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VNVAY SGM  S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  838  VREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  879



>ref|XP_009614147.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=951

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV
Sbjct  791  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISHGKNIVREV  836


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V++A  S  ++SV+D  MG YPSEC+EKF  LALKCC+D
Sbjct  833  VREVHLAQDSEKMYSVMDSTMGPYPSECMEKFAALALKCCED  874



>ref|XP_008652670.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008674889.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
Length=859

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLT++SDVYSLGVVFLELLTGM PI HGKNIVREV+
Sbjct  699  GYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKPIQHGKNIVREVN  745


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  741  VREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  785



>ref|XP_003568234.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
 ref|XP_010231255.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
 ref|XP_010231257.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
Length=949

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+
Sbjct  788  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVN  834


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  ++D RMG  P +C+ +F++LA KCC+D+TD
Sbjct  830  VREVNKAYQSGNISEIVDSRMGLCPPDCISRFLSLATKCCEDETD  874



>ref|XP_010231258.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Brachypodium distachyon]
Length=865

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI HGKNIVREV+
Sbjct  704  GYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIEHGKNIVREVN  750


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  ++D RMG  P +C+ +F++LA KCC+D+TD
Sbjct  746  VREVNKAYQSGNISEIVDSRMGLCPPDCISRFLSLATKCCEDETD  790



>ref|XP_009370883.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
 ref|XP_009370884.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
Length=951

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREVS
Sbjct  794  GYLDPEYFLTNKLTDKSDVYSLGIVFLELLTGNQPISHGKNIVREVS  840


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V++A+ +G++FS+ID RMGSYPSECVE+ + LAL+CC +  D
Sbjct  836  VREVSLAHQAGLVFSIIDSRMGSYPSECVERLLDLALRCCNEKQD  880



>ref|XP_009395171.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Musa acuminata subsp. malaccensis]
Length=934

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTD+SDVYSLGVVFLELLTGM PISHGKNIVREV +
Sbjct  786  GYLDPEYLLTHKLTDRSDVYSLGVVFLELLTGMRPISHGKNIVREVKT  833


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A   G++FS+ID RM +YPSEC+EKFI+LAL CC D+TD
Sbjct  828  VREVKTACQCGLMFSIIDSRMNAYPSECMEKFISLALGCCHDETD  872



>ref|XP_009395172.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Musa acuminata subsp. malaccensis]
Length=887

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTD+SDVYSLGVVFLELLTGM PISHGKNIVREV +
Sbjct  739  GYLDPEYLLTHKLTDRSDVYSLGVVFLELLTGMRPISHGKNIVREVKT  786


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  A   G++FS+ID RM +YPSEC+EKFI+LAL CC D+TD
Sbjct  781  VREVKTACQCGLMFSIIDSRMNAYPSECMEKFISLALGCCHDETD  825



>ref|XP_004249029.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Solanum lycopersicum]
 ref|XP_010327701.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Solanum lycopersicum]
Length=953

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  792  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISHGKNIVREVN  838


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A+ S  +FSV+D  MGSYPSECVEKF+ LALKCC+D
Sbjct  834  VREVNLAHGSEKMFSVMDSTMGSYPSECVEKFVALALKCCED  875



>ref|XP_010542705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
Length=987

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGMH ISHGKNIVREV +
Sbjct  825  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHAISHGKNIVREVKT  872


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SG I SV+D+RMGS P+ECVEKF TLAL+CC+ +T+
Sbjct  867  VREVKTAYQSGTILSVVDKRMGSCPAECVEKFATLALRCCRVETE  911



>ref|XP_011080636.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=972

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTH+LTDKSDVYSLGVVF+EL+TGMHPI HGKNIVREV +
Sbjct  804  GYLDPEYFLTHELTDKSDVYSLGVVFMELITGMHPIFHGKNIVREVKT  851


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V  AY SGMIFSVIDERMGSYPSECVEKF+ LALKCCQD+TD
Sbjct  846  VREVKTAYRSGMIFSVIDERMGSYPSECVEKFVILALKCCQDETD  890



>ref|XP_006646231.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Oryza brachyantha]
Length=246

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  485  QGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVR  351
            QGYL PEYFLTHKLTDKSDVYSLGVVFLEL TGM PISHG+NIVR
Sbjct  90   QGYLGPEYFLTHKLTDKSDVYSLGVVFLELQTGMQPISHGRNIVR  134



>gb|KDP21843.1| hypothetical protein JCGZ_00630 [Jatropha curcas]
Length=966

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLG+VFLELLTG+ PISHGKNI REV+
Sbjct  797  GYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGLQPISHGKNIAREVN  843


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  130  QVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            +VN+AY SG++FS+ID RMGSYPSECVE+FI LAL CC D
Sbjct  841  EVNMAYQSGIVFSIIDSRMGSYPSECVERFIALALACCHD  880



>ref|XP_006362336.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=953

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  792  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISHGKNIVREVN  838


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A+ S  +FSV+D  MGSYPSECVEKF+ LALKCC+D
Sbjct  834  VREVNLAHGSEKMFSVMDSTMGSYPSECVEKFVALALKCCED  875



>ref|XP_002266206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Vitis vinifera]
 ref|XP_010653121.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Vitis vinifera]
Length=948

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  791  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQPISHGKNIVREVN  837


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++  GM+FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  833  VREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  874



>ref|XP_010522022.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Tarenaya hassleriana]
Length=877

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMH IS GKN+VREV++
Sbjct  711  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHAISRGKNLVREVNA  758


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SGMI SVID+RMGS P+ECVEKF TLAL+C +D+T+
Sbjct  753  VREVNAAYQSGMILSVIDKRMGSIPTECVEKFATLALRCSRDETE  797



>ref|XP_010653122.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Vitis vinifera]
Length=916

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  759  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQPISHGKNIVREVN  805


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++  GM+FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  801  VREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  842



>gb|EPS60654.1| hypothetical protein M569_14148, partial [Genlisea aurea]
Length=849

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT KLTDKSDVYSLGVV LE++TGMHPISHGKNIVREV++
Sbjct  683  GYLDPEYFLTRKLTDKSDVYSLGVVLLEMITGMHPISHGKNIVREVNN  730


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +VN AY SG+IFS+ID+RMG YPS CVEKF+ +ALKCC ++T
Sbjct  725  VREVNNAYRSGIIFSIIDDRMGPYPSFCVEKFVNIALKCCLEET  768



>ref|XP_010653120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Vitis vinifera]
Length=969

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  812  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQPISHGKNIVREVN  858


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+++  GM+FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  854  VREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  895



>emb|CBI31162.3| unnamed protein product [Vitis vinifera]
Length=1821

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482   GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
             GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV+
Sbjct  1664  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQPISHGKNIVREVN  1710


 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVREV++
Sbjct  730  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNIVREVTA  777


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  136   LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             + +VN+++  GM+FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  1706  VREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  1747


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V  A  SG +FS+ID+ MG +PS+CV++F+TLAL+C QD T
Sbjct  772  VREVTAACQSGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLT  815



>emb|CDP01074.1| unnamed protein product [Coffea canephora]
Length=568

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDP+YFLTHKLTDKSDVYSLGVVFLELLTGM PI HGKNIVREV S
Sbjct  514  GYLDPDYFLTHKLTDKSDVYSLGVVFLELLTGMPPIVHGKNIVREVIS  561



>gb|KEH23301.1| LRR receptor-like kinase [Medicago truncatula]
Length=783

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS GKNIVREV+
Sbjct  616  GYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPISRGKNIVREVN  662


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A  +G+I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  658  VREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  699



>ref|XP_009780438.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=952

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GYLDPEYFLT KLTDKSDVYSLGVVFLE+LTGM PISHGKNIVREV
Sbjct  792  GYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISHGKNIVREV  837


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V++A+ S  ++SV+D  MG YPSEC+EKF  LALKCC+D
Sbjct  834  VREVHLAHDSEKMYSVMDSTMGPYPSECMEKFAALALKCCED  875



>ref|XP_006360628.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=947

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PISHG+NIVREV++
Sbjct  794  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISHGRNIVREVNA  841


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +VN A  SGM+ SVID+ +G Y S+CV+KF+ LA+KC  D+
Sbjct  836  VREVNAACQSGMMSSVIDKSIGPYSSDCVKKFLDLAVKCSLDE  878



>ref|XP_002458681.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor]
 gb|EES03801.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor]
Length=970

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVRE  348
            GYLDPEYFLTHKLT++SDVYSLGVVFLELLTGM PI HGKNIVRE
Sbjct  798  GYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKPIQHGKNIVRE  842


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  148  LWFALHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            +W  L +VN+AY SG +  +ID RM SYP ECV++F++LA++CCQD+T+
Sbjct  847  VWKGLLEVNIAYHSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCQDETE  895



>ref|XP_003533651.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006587901.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
Length=956

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV++
Sbjct  792  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVNT  839


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  834  VREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  878



>ref|XP_003623645.1| Leucine-rich repeat protein kinase [Medicago truncatula]
Length=1081

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS GKNIVREV+
Sbjct  914  GYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPISRGKNIVREVN  960


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A  +G+I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  956  VREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  997



>ref|XP_009614146.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=967

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PISHG+NIVREV++
Sbjct  804  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISHGRNIVREVNA  851


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +VN A  SG + SVID  MG YPSECV+KF+ LAL+C  D+
Sbjct  846  VREVNAACQSGTMASVIDRSMGPYPSECVKKFLDLALRCSLDE  888



>gb|AES79863.2| LRR receptor-like kinase [Medicago truncatula]
Length=962

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS GKNIVREV+
Sbjct  795  GYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPISRGKNIVREVN  841


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A  +G+I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  837  VREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  878



>ref|XP_009780439.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
 ref|XP_009780440.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=965

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PISHG+NIVREV++
Sbjct  801  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISHGRNIVREVNA  848



>ref|XP_010922797.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Elaeis guineensis]
Length=891

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLEL TGM PI HGKNIVREVS
Sbjct  734  GYLDPEYFLTHKLTDKSDVYSLGVVFLELSTGMRPILHGKNIVREVS  780


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V++   SGM+FS+ID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  776  VREVSMICQSGMMFSIIDNRMGSYPSECIEKFVSLALRCCQDETD  820



>gb|KEH23302.1| LRR receptor-like kinase [Medicago truncatula]
Length=917

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS GKNIVREV+
Sbjct  750  GYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPISRGKNIVREVN  796


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +VN+A  +G+I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  792  VREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  833



>gb|AAF63151.1|AC011001_21 Hypothetical protein [Arabidopsis thaliana]
Length=860

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVV LEL TGM PI+HGKNIVRE++
Sbjct  703  GYLDPEYFLTHQLTDKSDVYSLGVVLLELFTGMQPITHGKNIVREIN  749


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  745  VREINIAYESGSILSTVDKRMSSVPDECLEKFATLALRCCREETD  789



>ref|XP_010922796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Elaeis guineensis]
Length=943

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLTDKSDVYSLGVVFLEL TGM PI HGKNIVREVS
Sbjct  786  GYLDPEYFLTHKLTDKSDVYSLGVVFLELSTGMRPILHGKNIVREVS  832


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V++   SGM+FS+ID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  828  VREVSMICQSGMMFSIIDNRMGSYPSECIEKFVSLALRCCQDETD  872



>ref|XP_002319436.2| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|EEE95359.2| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=687

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGM PISHGKNIV+EV+
Sbjct  529  GYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVKEVN  575


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G+IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  571  VKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  615



>ref|XP_003567224.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brachypodium distachyon]
 ref|XP_010232490.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brachypodium distachyon]
Length=952

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTHKLT+KSDVYSLG+V LELLTGM PI HGKNIVREV++
Sbjct  788  GYLDPEYFLTHKLTEKSDVYSLGIVLLELLTGMKPIQHGKNIVREVNT  835


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY SG I  +ID R+ S   EC+ +F++LALKCCQD+TD
Sbjct  830  VREVNTAYRSGDISGIIDSRISSCSPECITRFLSLALKCCQDETD  874



>ref|XP_008366925.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=334

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GY+DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREV+
Sbjct  176  GYVDPEYFLTNKLTDKSDVYSLGIVFLELLTGDQPISHGKNIVREVN  222


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G++FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  218  VREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  262



>ref|XP_010553166.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553168.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553169.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553170.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553171.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553172.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553173.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553174.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553175.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
Length=948

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            G LDPEYFLTHKLTDKSDVYSLGVVF+ELLTGMH I+HGKNIVREV +
Sbjct  797  GDLDPEYFLTHKLTDKSDVYSLGVVFMELLTGMHAITHGKNIVREVKA  844


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V  A+ +G I S +D+RMG+   ECVEKF  LAL+CC D
Sbjct  839  VREVKAAHQTGRIVSWVDKRMGTCSLECVEKFAALALRCCHD  880



>ref|XP_006587902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
Length=955

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV++
Sbjct  791  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVNT  838


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  833  VREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  877



>ref|NP_172169.2| probable LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGD7.2|Y1684_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g06840; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28044.1| probable LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=953

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTH+LTDKSDVYSLGVV LEL TGM PI+HGKNIVRE++
Sbjct  796  GYLDPEYFLTHQLTDKSDVYSLGVVLLELFTGMQPITHGKNIVREIN  842


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + ++N+AY SG I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  838  VREINIAYESGSILSTVDKRMSSVPDECLEKFATLALRCCREETD  882



>gb|KHN29480.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=955

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV++
Sbjct  791  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVNT  838


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  833  VREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  877



>ref|XP_006360624.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=920

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PISHG NIVREV++
Sbjct  767  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISHGMNIVREVNA  814



>gb|KHN40602.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=957

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV++
Sbjct  794  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVNT  841


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  836  VREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  880



>ref|XP_006376568.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|ERP54365.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=825

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGM PISHGKNIV+EV+
Sbjct  667  GYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVKEVN  713


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G+IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  709  VKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  753



>ref|XP_003552328.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoformX2 [Glycine max]
 ref|XP_006602730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
 ref|XP_006602731.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X4 [Glycine max]
Length=957

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV++
Sbjct  794  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVNT  841


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG I+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  836  VREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  880



>ref|XP_006376567.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|ERP54364.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=862

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGM PISHGKNIV+EV+
Sbjct  704  GYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQPISHGKNIVKEVN  750


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G+IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  746  VKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  790



>ref|XP_004970379.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Setaria italica]
Length=947

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLTHKLT++SDVYSLGVV LELLTGM PI HGKNIVREV+
Sbjct  788  GYLDPEYFLTHKLTERSDVYSLGVVLLELLTGMRPIQHGKNIVREVN  834


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY SG I  +ID RM SYP ECV +F++LA+KCC+D+T+
Sbjct  830  VREVNMAYQSGDISRIIDSRMPSYPPECVTRFLSLAIKCCRDETE  874



>ref|XP_011466400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Fragaria vesca subsp. vesca]
Length=265

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT +LTDKSDVYSLG+VFLELLTG+ PISHGKNIVREV+
Sbjct  109  GYLDPEYFLTSQLTDKSDVYSLGIVFLELLTGVLPISHGKNIVREVN  155


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ SG++FS+ID RMGSYPSECVE+F+ LAL+CCQD  D
Sbjct  151  VREVNMAHQSGLMFSIIDTRMGSYPSECVERFVALALRCCQDKQD  195



>ref|XP_007140045.1| hypothetical protein PHAVU_008G079800g [Phaseolus vulgaris]
 gb|ESW12039.1| hypothetical protein PHAVU_008G079800g [Phaseolus vulgaris]
Length=956

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY LTHKLTDK DVYSLG+V+LELLTGM PISHGKNIVREV+
Sbjct  792  GYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPISHGKNIVREVN  838


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A  SG ++S+ID  +G Y SEC++KF+TLAL CCQD+ +
Sbjct  834  VREVNMALQSGTVYSIIDSTIGLYTSECLDKFLTLALSCCQDNPE  878



>gb|EYU42054.1| hypothetical protein MIMGU_mgv1a000864mg [Erythranthe guttata]
Length=955

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  500  NMAFLQGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            N+    GY+DPEYFLT KLT+KSDVYSLG+VFLELLTGM PISHG+NIVREV++
Sbjct  780  NVKGTPGYVDPEYFLTRKLTEKSDVYSLGIVFLELLTGMQPISHGRNIVREVNA  833


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +VN A  SGM+ S+ID +MG YPSECV+K + LAL+C  D+T
Sbjct  828  VREVNAACGSGMMVSIIDRKMGPYPSECVKKLMALALRCSLDET  871



>ref|XP_008244520.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Prunus mume]
Length=953

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLG+VFLELLTG+ PISHGKNIVREV+
Sbjct  796  GYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGVLPISHGKNIVREVN  842


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +G++FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  838  VREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  882



>ref|XP_007205469.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
 gb|EMJ06668.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
Length=349

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEY LT+KLTDKSDVYSLG+VFLELLTG+ PISHGKNIVREV+
Sbjct  192  GYLDPEYLLTNKLTDKSDVYSLGIVFLELLTGVLPISHGKNIVREVN  238


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +G++FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  234  VREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  278



>gb|EPS66864.1| hypothetical protein M569_07912, partial [Genlisea aurea]
Length=463

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GY+DPEYFLT KLTD+SDVYSLGVVFLE+LTGMHPI HGKNIVREV
Sbjct  418  GYVDPEYFLTSKLTDRSDVYSLGVVFLEMLTGMHPIFHGKNIVREV  463



>ref|XP_010543142.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g37450 [Tarenaya hassleriana]
Length=936

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            GY+DPEYFL+HKLT+KSDVYSLG+VFLE+LTGM PISHG+NIVREV
Sbjct  794  GYVDPEYFLSHKLTEKSDVYSLGIVFLEILTGMRPISHGRNIVREV  839


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            + +V  A  SGM+ S+ID  MG Y  EC ++F+ LALKCCQD
Sbjct  836  VREVREACESGMMMSIIDRSMGRYTWECGKRFMELALKCCQD  877



>ref|XP_002323095.2| hypothetical protein POPTR_0016s14690g [Populus trichocarpa]
 gb|EEF04856.2| hypothetical protein POPTR_0016s14690g [Populus trichocarpa]
Length=824

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT+KLTDKSDVYSLGVVFLELLTGM PISHGK IVREV++
Sbjct  668  GYLDPEYFLTNKLTDKSDVYSLGVVFLELLTGMEPISHGKYIVREVNA  715


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  142  FALHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + + +VN A  SG++FS++D++MG YPS+CV+KF+ LALKCC D+
Sbjct  708  YIVREVNAACQSGIMFSIVDQKMGPYPSDCVKKFMALALKCCHDE  752



>ref|XP_008244528.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Prunus mume]
Length=793

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLG+VFLELLTG+ PISHGKNIVREV+
Sbjct  636  GYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGVLPISHGKNIVREVN  682


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A+ +G++FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  678  VREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  722



>gb|KCW88415.1| hypothetical protein EUGRSUZ_A00802 [Eucalyptus grandis]
Length=933

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  500  NMAFLQGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            N+    GYLDPEYFLTHKLT+KSDVYSLG+VFLELLT M PISHG+NIVREV
Sbjct  769  NVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVFLELLTRMPPISHGRNIVREV  820


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V  A  SG +FS+ID  MG YPSEC++KF+ LALKCC D T
Sbjct  817  VREVLQACQSGSMFSIIDRSMGPYPSECIKKFMALALKCCDDQT  860



>ref|XP_010043804.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
Length=979

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  500  NMAFLQGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  345
            N+    GYLDPEYFLTHKLT+KSDVYSLG+VFLELLT M PISHG+NIVREV
Sbjct  815  NVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVFLELLTRMPPISHGRNIVREV  866


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V  A  SG +FS+ID  MG YPSEC++KF+ LALKCC D T
Sbjct  863  VREVLQACQSGSMFSIIDRSMGPYPSECIKKFMALALKCCDDQT  906



>ref|XP_002987562.1| hypothetical protein SELMODRAFT_10265, partial [Selaginella moellendorffii]
 gb|EFJ11398.1| hypothetical protein SELMODRAFT_10265, partial [Selaginella moellendorffii]
Length=870

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT KLTDKSDVYS GVV +EL+TGMHPIS GKN+VREV++
Sbjct  759  GYLDPEYFLTRKLTDKSDVYSFGVVLMELVTGMHPISQGKNLVREVTA  806


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V   Y +GM+ S++D+RMGSYPSE +E  + LAL C +++ +
Sbjct  801  VREVTATYQAGMVLSIVDQRMGSYPSEGLEPMLRLALSCVKENPN  845



>ref|XP_003632548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Vitis vinifera]
Length=949

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVREV++
Sbjct  792  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNIVREVTA  839


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V  A  SG +FS+ID+ MG +PS+CV++F+TLAL+C QD T
Sbjct  834  VREVTAACQSGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLT  877



>ref|XP_010653123.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Vitis vinifera]
Length=923

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVREV++
Sbjct  766  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNIVREVTA  813


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +V  A  SG +FS+ID+ MG +PS+CV++F+TLAL+C QD T
Sbjct  808  VREVTAACQSGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLT  851



>ref|XP_011001647.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g37450 [Populus euphratica]
Length=950

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT+KLTDKSDVYSLGVVFLELLTGM PISHGK IVRE+++
Sbjct  794  GYLDPEYFLTNKLTDKSDVYSLGVVFLELLTGMEPISHGKYIVREINA  841


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  142  FALHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + + ++N A  SG++FS++D++MG YPS+CV+KF+ LALKCC D+
Sbjct  834  YIVREINAACQSGIMFSIVDQKMGPYPSDCVKKFMALALKCCHDE  878



>ref|XP_009337807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
Length=953

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GY+DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREV+
Sbjct  796  GYVDPEYFLTNKLTDKSDVYSLGIVFLELLTGDQPISHGKNIVREVN  842


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G++FS+ID+RMGSYPS+CVE+F+ LAL+CC +  D
Sbjct  838  VREVNLAYQAGLVFSIIDKRMGSYPSKCVERFLDLALRCCNEKPD  882



>gb|EYU46036.1| hypothetical protein MIMGU_mgv1a021178mg, partial [Erythranthe 
guttata]
Length=906

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTG+HPI  GKNIVREV++
Sbjct  738  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGLHPIFRGKNIVREVNT  785


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN AY  GMIFS+ID++MGSYPSECV +F+TLALKCC+++T+
Sbjct  780  VREVNTAYRLGMIFSIIDDKMGSYPSECVGRFLTLALKCCKNETE  824



>ref|XP_002992827.1| hypothetical protein SELMODRAFT_136038, partial [Selaginella 
moellendorffii]
 gb|EFJ06117.1| hypothetical protein SELMODRAFT_136038, partial [Selaginella 
moellendorffii]
Length=926

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLT KLTDKSDVYS GVV +EL+TGMHPIS GKN+VREV++
Sbjct  766  GYLDPEYFLTRKLTDKSDVYSFGVVLMELVTGMHPISQGKNLVREVTA  813


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +V   Y +GM+ S++D+RMGSYPSE +E  + LAL C +++ +
Sbjct  808  VREVTATYQAGMVLSIVDQRMGSYPSEGLEPMLRLALNCVKENPN  852



>ref|XP_010327702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
Length=908

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVREV++
Sbjct  749  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISQGRNIVREVNA  796


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +VN A  SGM+ S+ID+ +G Y S+CV+KF+ LAL+C  D+
Sbjct  791  VREVNAACESGMMSSIIDKGIGPYSSDCVKKFLDLALRCSLDE  833



>gb|EPS63348.1| hypothetical protein M569_11437, partial [Genlisea aurea]
Length=877

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYF T+KLTDKSDVYSLGVV LE++TGMHPI HGKNIVREV+
Sbjct  731  GYLDPEYFRTYKLTDKSDVYSLGVVLLEMMTGMHPIFHGKNIVREVN  777


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            + +VNVA+  G I S+ID+RMGS+P++C  KF+ LALKCC+++T
Sbjct  773  VREVNVAHQLGAIRSIIDDRMGSFPTDCASKFVELALKCCREET  816



>ref|XP_004249703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Solanum lycopersicum]
Length=953

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVREV++
Sbjct  794  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMRPISQGRNIVREVNA  841


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            + +VN A  SGM+ S+ID+ +G Y S+CV+KF+ LAL+C  D+
Sbjct  836  VREVNAACESGMMSSIIDKGIGPYSSDCVKKFLDLALRCSLDE  878



>ref|XP_001782094.1| predicted protein [Physcomitrella patens]
 gb|EDQ53088.1| predicted protein, partial [Physcomitrella patens]
Length=743

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSSFPLH  327
            GYLDPEYFLT KLTDK+DVYS G+V LEL+TGM PI++GKNIVREV SF  H
Sbjct  627  GYLDPEYFLTQKLTDKTDVYSFGIVLLELITGMFPIAYGKNIVREVGSFLKH  678



>ref|XP_008350579.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Malus domestica]
Length=845

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GY+DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREV+
Sbjct  687  GYIDPEYFLTNKLTDKSDVYSLGIVFLELLTGGQPISHGKNIVREVN  733


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G++FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  729  VREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  773



>ref|XP_008350578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Malus domestica]
Length=953

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GY+DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREV+
Sbjct  795  GYIDPEYFLTNKLTDKSDVYSLGIVFLELLTGGQPISHGKNIVREVN  841


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G++FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  837  VREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  881



>emb|CAN80670.1| hypothetical protein VITISV_025635 [Vitis vinifera]
Length=775

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVRE  348
            GYLDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NIVRE
Sbjct  594  GYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNIVRE  638


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  145  WFALHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            ++  H V  A  SG +FS+ID+ MG +PS+CV++F+TLAL+C QD T
Sbjct  657  FYFTHHVTAACQSGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLT  703



>ref|XP_010683435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=948

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLT + PISHGKN+VREV++
Sbjct  791  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTAVPPISHGKNLVREVNT  838


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +F +ID RMG+YPSECVEKFI LA++CCQD  D
Sbjct  833  VREVNTAQKSGSLFGIIDSRMGTYPSECVEKFIALAVRCCQDKPD  877



>ref|XP_010683436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=923

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVSS  339
            GYLDPEYFLTH+LTDKSDVYSLGVVFLELLT + PISHGKN+VREV++
Sbjct  766  GYLDPEYFLTHQLTDKSDVYSLGVVFLELLTAVPPISHGKNLVREVNT  813


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN A  SG +F +ID RMG+YPSECVEKFI LA++CCQD  D
Sbjct  808  VREVNTAQKSGSLFGIIDSRMGTYPSECVEKFIALAVRCCQDKPD  852



>ref|XP_008388895.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=941

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GY DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PISHGKNIVREV+
Sbjct  783  GYXDPEYFLTNKLTDKSDVYSLGIVFLELLTGXQPISHGKNIVREVN  829


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+AY +G++FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  825  VREVNLAYQAGLVFSIIDKRMXSYPSKCVERFLDLALRCCNEKPD  869



>ref|XP_002323097.2| hypothetical protein POPTR_0016s14710g [Populus trichocarpa]
 gb|EEF04858.2| hypothetical protein POPTR_0016s14710g [Populus trichocarpa]
Length=664

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  482  GYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREVS  342
            GYLDPEYFLT KLTDKSDVYSLGVVFLELLTGM PI  GKNIVREV+
Sbjct  499  GYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMQPIYRGKNIVREVN  545


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  LHQVNVAYSSGMIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            + +VN+A  S  +FS+ID RMGSYPS+C+E+F+ LAL+CC D  D
Sbjct  541  VREVNIACESDKMFSIIDRRMGSYPSKCIERFVALALRCCHDKQD  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940