BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003F06 642 bp,

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   3e-52   Nicotiana sylvestris
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   4e-51   Nicotiana tomentosiformis
emb|CDP20730.1|  unnamed protein product                                170   2e-46   Coffea canephora [robusta coffee]
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   4e-44   Solanum tuberosum [potatoes]
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   2e-43   Solanum lycopersicum
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   4e-41   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             155   5e-41   Populus trichocarpa [western balsam poplar]
emb|CDX82342.1|  BnaA03g34790D                                          154   2e-40   Brassica napus [oilseed rape]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   2e-40   Brassica rapa
emb|CDX75968.1|  BnaC03g40510D                                          154   2e-40   Brassica napus [oilseed rape]
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   3e-40   Fragaria vesca subsp. vesca
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   3e-40   Populus euphratica
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         153   3e-40   Jatropha curcas
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   3e-39   Solanum lycopersicum
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   4e-39   Vitis vinifera
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    150   5e-39   Eucalyptus grandis [rose gum]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             150   6e-39   Prunus persica
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        150   7e-39   Theobroma cacao [chocolate]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   7e-39   Prunus mume [ume]
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   7e-39   Cicer arietinum [garbanzo]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   1e-38   Malus domestica [apple tree]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   1e-38   Malus domestica [apple tree]
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    148   3e-38   Ricinus communis
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    148   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   6e-38   Malus domestica [apple tree]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   6e-38   Brassica rapa
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    147   8e-38   Arabis alpina [alpine rockcress]
emb|CDY69364.1|  BnaCnng63170D                                          146   1e-37   Brassica napus [oilseed rape]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             146   1e-37   Phaseolus vulgaris [French bean]
gb|KJB52970.1|  hypothetical protein B456_008G285900                    146   1e-37   Gossypium raimondii
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   3e-37   Nicotiana tomentosiformis
ref|XP_002885261.1|  aspartyl protease family protein                   145   4e-37   Arabidopsis lyrata subsp. lyrata
gb|KJB37242.1|  hypothetical protein B456_006G195400                    143   1e-36   Gossypium raimondii
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             143   2e-36   Eutrema salsugineum
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   2e-36   
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   2e-36   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   2e-36   Cucumis sativus [cucumbers]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   3e-36   Malus domestica [apple tree]
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   3e-36   Glycine max [soybeans]
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             142   3e-36   Capsella rubella
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  142   3e-36   Morus notabilis
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       142   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   7e-36   Nicotiana sylvestris
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                     141   7e-36   Eucalyptus grandis [rose gum]
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    141   1e-35   Eucalyptus grandis [rose gum]
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             140   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                  135   2e-35   Citrus sinensis [Valencia orange]
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   7e-35   Camelina sativa [gold-of-pleasure]
emb|CDP20336.1|  unnamed protein product                                138   9e-35   Coffea canephora [robusta coffee]
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   2e-34   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   3e-34   Citrus sinensis [Valencia orange]
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             136   3e-34   Citrus clementina
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   9e-34   Fragaria vesca subsp. vesca
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             134   2e-33   Citrus clementina
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   2e-33   Citrus sinensis [Valencia orange]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   134   2e-33   Citrus sinensis [Valencia orange]
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   2e-33   Solanum tuberosum [potatoes]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   3e-33   Nelumbo nucifera [Indian lotus]
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            134   3e-33   Medicago truncatula
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    134   3e-33   Arabis alpina [alpine rockcress]
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   3e-33   Solanum lycopersicum
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   4e-33   Tarenaya hassleriana [spider flower]
emb|CDY24483.1|  BnaC05g34710D                                          132   9e-33   Brassica napus [oilseed rape]
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Brassica rapa
emb|CDX92240.1|  BnaA05g21670D                                          131   2e-32   Brassica napus [oilseed rape]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Nicotiana sylvestris
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   3e-32   Nicotiana tomentosiformis
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    130   5e-32   
ref|NP_173922.1|  aspartyl protease family protein                      130   5e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24395.1|  BnaCnng04620D                                          130   6e-32   Brassica napus [oilseed rape]
ref|XP_002315953.1|  aspartyl protease family protein                   130   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   7e-32   Brassica rapa
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Malus domestica [apple tree]
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Vitis vinifera
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             128   3e-31   Capsella rubella
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    127   5e-31   Elaeis guineensis
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   9e-31   Prunus mume [ume]
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30   Brassica rapa
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30   Phoenix dactylifera
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             126   1e-30   Eutrema salsugineum
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Glycine max [soybeans]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Cucumis melo [Oriental melon]
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg                125   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   4e-30   Cucumis sativus [cucumbers]
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          125   5e-30   Amborella trichopoda
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         124   6e-30   Jatropha curcas
emb|CDO98452.1|  unnamed protein product                                124   6e-30   Coffea canephora [robusta coffee]
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   7e-30   Elaeis guineensis
ref|XP_002890686.1|  aspartyl protease family protein                   123   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             123   2e-29   Phaseolus vulgaris [French bean]
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    123   2e-29   
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   3e-29   Populus euphratica
gb|ABK24467.1|  unknown                                                 122   4e-29   Picea sitchensis
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  122   4e-29   Morus notabilis
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   5e-29   Phoenix dactylifera
gb|KJB50738.1|  hypothetical protein B456_008G185200                    122   5e-29   Gossypium raimondii
dbj|BAK07248.1|  predicted protein                                      121   1e-28   Hordeum vulgare subsp. vulgare [barley]
emb|CDM80984.1|  unnamed protein product                                120   2e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   Sesamum indicum [beniseed]
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   4e-28   Glycine max [soybeans]
gb|EPS61272.1|  hypothetical protein M569_13524                         119   5e-28   Genlisea aurea
gb|ABK24255.1|  unknown                                                 119   8e-28   Picea sitchensis
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                117   2e-27   Erythranthe guttata [common monkey flower]
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              117   3e-27   Zea mays [maize]
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          116   5e-27   Sorghum bicolor [broomcorn]
emb|CDY03848.1|  BnaC07g10730D                                          116   7e-27   Brassica napus [oilseed rape]
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        115   2e-26   Theobroma cacao [chocolate]
gb|EAY72465.1|  hypothetical protein OsI_00321                          113   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   6e-26   Setaria italica
ref|NP_001041979.1|  Os01g0140100                                       113   7e-26   
gb|EAY72467.1|  hypothetical protein OsI_00323                          113   8e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   Phoenix dactylifera
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             112   2e-25   Prunus persica
emb|CBI27051.3|  unnamed protein product                                109   3e-25   Vitis vinifera
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              111   3e-25   Selaginella moellendorffii
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  111   6e-25   Morus notabilis
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              109   1e-24   Selaginella moellendorffii
emb|CDY25081.1|  BnaC06g18230D                                          109   1e-24   Brassica napus [oilseed rape]
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   1e-24   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   Brassica rapa
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   Populus euphratica
ref|XP_002302634.2|  aspartyl protease family protein                   108   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   Elaeis guineensis
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   5e-24   Tarenaya hassleriana [spider flower]
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   5e-24   Cucumis melo [Oriental melon]
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   6e-24   Nicotiana tomentosiformis
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              107   6e-24   Selaginella moellendorffii
ref|XP_008393394.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   6e-24   Malus domestica [apple tree]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   6e-24   Solanum lycopersicum
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              107   7e-24   Selaginella moellendorffii
emb|CBI40559.3|  unnamed protein product                                107   7e-24   Vitis vinifera
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   7e-24   Sesamum indicum [beniseed]
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   8e-24   Oryza brachyantha
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   8e-24   Cucumis melo [Oriental melon]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   9e-24   Cicer arietinum [garbanzo]
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   9e-24   
emb|CDY51131.1|  BnaA07g37140D                                          107   9e-24   Brassica napus [oilseed rape]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Cucumis sativus [cucumbers]
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   Malus domestica [apple tree]
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Camelina sativa [gold-of-pleasure]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       107   1e-23   Cucumis sativus [cucumbers]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Solanum tuberosum [potatoes]
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   Solanum lycopersicum
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Fragaria vesca subsp. vesca
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Vitis vinifera
gb|EPS66029.1|  hypothetical protein M569_08742                         106   2e-23   Genlisea aurea
emb|CDX90023.1|  BnaA10g00590D                                          106   2e-23   Brassica napus [oilseed rape]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Brassica rapa
emb|CDY15187.1|  BnaC05g00660D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Nicotiana sylvestris
ref|NP_171637.1|  aspartyl protease family protein                      106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             106   2e-23   Capsella rubella
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             106   2e-23   Eutrema salsugineum
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Cicer arietinum [garbanzo]
emb|CDX67868.1|  BnaA07g19080D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   3e-23   Elaeis guineensis
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   3e-23   Tarenaya hassleriana [spider flower]
gb|ABK25248.1|  unknown                                                 105   3e-23   Picea sitchensis
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            105   3e-23   Medicago truncatula
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                105   4e-23   Erythranthe guttata [common monkey flower]
emb|CDY25371.1|  BnaA05g19130D                                          105   4e-23   Brassica napus [oilseed rape]
emb|CDY24567.1|  BnaC05g32510D                                          105   4e-23   Brassica napus [oilseed rape]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             105   4e-23   Eutrema salsugineum
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                  103   4e-23   
ref|XP_001757102.1|  predicted protein                                  104   4e-23   Physcomitrella patens
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    105   4e-23   Arabis alpina [alpine rockcress]
emb|CAE05761.2|  OSJNBa0064G10.12                                       105   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054261.2|  Os04g0677100                                       105   5e-23   
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         105   5e-23   Jatropha curcas
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          105   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-23   Brassica rapa
emb|CAJ86229.1|  H0402C08.5                                             105   5e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             105   5e-23   Capsella rubella
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-23   Cucumis sativus [cucumbers]
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   7e-23   Nicotiana sylvestris
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   7e-23   Sesamum indicum [beniseed]
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   7e-23   Solanum tuberosum [potatoes]
gb|ABR17085.1|  unknown                                                 105   8e-23   Picea sitchensis
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    104   8e-23   Arabis alpina [alpine rockcress]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Populus euphratica
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             104   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Populus euphratica
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Nicotiana tomentosiformis
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   Elaeis guineensis
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Camelina sativa [gold-of-pleasure]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                104   1e-22   Erythranthe guttata [common monkey flower]
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                104   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             104   1e-22   Eutrema salsugineum
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Phoenix dactylifera
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            103   1e-22   Medicago truncatula
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              103   1e-22   Selaginella moellendorffii
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   Phoenix dactylifera
gb|KJB49971.1|  hypothetical protein B456_008G147500                    104   1e-22   Gossypium raimondii
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   Glycine max [soybeans]
ref|XP_002892074.1|  aspartyl protease family protein                   104   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        104   1e-22   Theobroma cacao [chocolate]
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   Phoenix dactylifera
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              103   1e-22   Selaginella moellendorffii
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  103   2e-22   Morus notabilis
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   2e-22   
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002885351.1|  pepsin A                                           103   2e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             103   2e-22   Selaginella moellendorffii
gb|KJB79793.1|  hypothetical protein B456_013G067200                    103   2e-22   Gossypium raimondii
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    103   2e-22   Arabis alpina [alpine rockcress]
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Sesamum indicum [beniseed]
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             103   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              103   2e-22   Selaginella moellendorffii
gb|AAK64003.1|  AT3g61820/F15G16_210                                    102   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             103   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Camelina sativa [gold-of-pleasure]
gb|ABK24480.1|  unknown                                                 103   2e-22   Picea sitchensis
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Citrus sinensis [Valencia orange]
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             103   2e-22   Citrus clementina
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                103   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   Eucalyptus grandis [rose gum]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   Elaeis guineensis
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   Populus euphratica
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    103   3e-22   Ricinus communis
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             103   4e-22   Citrus clementina
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   4e-22   Nicotiana tomentosiformis
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   Nelumbo nucifera [Indian lotus]
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   103   4e-22   Citrus sinensis [Valencia orange]
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   4e-22   Citrus sinensis [Valencia orange]
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_002320868.1|  aspartyl protease family protein                   102   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   Eucalyptus grandis [rose gum]
gb|ABR16474.1|  unknown                                                 103   4e-22   Picea sitchensis
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   Elaeis guineensis
ref|XP_001784204.1|  predicted protein                                  101   5e-22   Physcomitrella patens
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   5e-22   Malus domestica [apple tree]
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   5e-22   Nicotiana sylvestris
ref|NP_191741.1|  aspartyl protease                                     102   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             102   6e-22   Prunus persica
emb|CDX89133.1|  BnaA04g00530D                                          102   7e-22   Brassica napus [oilseed rape]
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          102   7e-22   Amborella trichopoda
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   7e-22   Populus euphratica
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   8e-22   Prunus mume [ume]
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             102   8e-22   Medicago truncatula
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   8e-22   Nicotiana sylvestris
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             102   8e-22   Prunus persica
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   9e-22   Cucumis melo [Oriental melon]
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   9e-22   Cucumis sativus [cucumbers]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   9e-22   Vitis vinifera
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Cucumis sativus [cucumbers]
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    101   1e-21   Sesamum indicum [beniseed]
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Malus domestica [apple tree]
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Solanum tuberosum [potatoes]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Glycine max [soybeans]
emb|CDP08669.1|  unnamed protein product                                101   1e-21   Coffea canephora [robusta coffee]
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   1e-21   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Cicer arietinum [garbanzo]
ref|XP_001759252.1|  predicted protein                                  100   2e-21   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
emb|CBI35367.3|  unnamed protein product                                101   2e-21   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-21   
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
gb|KJB49569.1|  hypothetical protein B456_008G125700                    100   2e-21   
gb|KJB77420.1|  hypothetical protein B456_012G135900                    100   2e-21   
ref|XP_002878415.1|  aspartyl protease family protein                   100   3e-21   
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                       100   5e-21   
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                99.8    5e-21   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   
emb|CDY43952.1|  BnaC04g21580D                                        99.8    5e-21   
gb|KJB09628.1|  hypothetical protein B456_001G154400                  99.4    6e-21   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   6e-21   
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein          99.4    6e-21   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   6e-21   
emb|CDP04865.1|  unnamed protein product                              99.8    7e-21   
gb|KJB09626.1|  hypothetical protein B456_001G154400                  99.4    8e-21   
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.0    9e-21   
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein        99.0    1e-20   
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.0    1e-20   
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g           99.0    1e-20   
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     96.3    1e-20   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    1e-20   
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    2e-20   
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g           98.2    2e-20   
gb|KDP28482.1|  hypothetical protein JCGZ_14253                       98.2    2e-20   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  98.6    2e-20   
gb|AEW08303.1|  hypothetical protein 2_5996_01                        94.0    2e-20   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        97.8    2e-20   
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.2    2e-20   
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    2e-20   
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.2    2e-20   
dbj|BAJ97639.1|  predicted protein                                    97.4    3e-20   
gb|ABR17396.1|  unknown                                               96.3    4e-20   
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                     91.7    4e-20   
emb|CDP20729.1|  unnamed protein product                              97.1    5e-20   
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g           97.8    5e-20   
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...  97.1    5e-20   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            95.5    6e-20   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            95.5    6e-20   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    8e-20   
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor           96.3    9e-20   
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    1e-19   
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358            95.9    1e-19   
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.1    2e-19   
gb|AFB33417.1|  hypothetical protein 2_5996_01                        90.9    2e-19   
gb|AFB33415.1|  hypothetical protein 2_5996_01                        90.9    3e-19   
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...  94.7    3e-19   
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    4e-19   
gb|AFG60356.1|  hypothetical protein 2_5996_01                        90.5    4e-19   
gb|AFG60347.1|  hypothetical protein 2_5996_01                        90.1    5e-19   
gb|AEW08302.1|  hypothetical protein 2_5996_01                        90.1    5e-19   
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    6e-19   
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970        94.4    6e-19   
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660        94.0    7e-19   
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    8e-19   
gb|ABK24493.1|  unknown                                               93.6    8e-19   
ref|XP_009390735.1|  PREDICTED: aspartic proteinase nepenthesin-2...  94.4    8e-19   
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...  94.0    1e-18   
emb|CDO98456.1|  unnamed protein product                              93.2    1e-18   
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                   92.8    2e-18   
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    3e-18   
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    4e-18   
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    4e-18   
ref|XP_004170575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    4e-18   
ref|XP_004138238.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    4e-18   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           90.9    7e-18   
ref|XP_007147550.1|  hypothetical protein PHAVU_006G134200g           90.9    8e-18   
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    8e-18   
ref|XP_006379734.1|  hypothetical protein POPTR_0008s11690g           89.4    9e-18   
gb|ABR16115.1|  unknown                                               90.9    9e-18   
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    9e-18   
ref|NP_001056485.1|  Os05g0590000                                     90.5    1e-17   
gb|AAT38006.1|  unknow protein                                        90.5    1e-17   
gb|EAY99240.1|  hypothetical protein OsI_21202                        90.5    1e-17   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           90.9    1e-17   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...  90.9    1e-17   
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    1e-17   
gb|KJB08584.1|  hypothetical protein B456_001G092100                  90.5    1e-17   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  90.9    1e-17   
dbj|BAJ99659.1|  predicted protein                                    90.1    1e-17   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
ref|XP_002460653.1|  hypothetical protein SORBIDRAFT_02g032590        90.5    2e-17   
gb|EAY75637.1|  hypothetical protein OsI_03542                        89.7    2e-17   
ref|XP_004952344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    2e-17   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  89.7    2e-17   
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    2e-17   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                        89.4    2e-17   
gb|KHN14389.1|  Aspartic proteinase nepenthesin-2                     88.6    2e-17   
ref|XP_002460980.1|  hypothetical protein SORBIDRAFT_02g038700        89.7    2e-17   
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    3e-17   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  89.7    3e-17   
gb|EAZ09523.1|  hypothetical protein OsI_31798                        89.4    3e-17   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            89.7    3e-17   
ref|NP_001063501.1|  Os09g0482200                                     89.4    3e-17   
ref|XP_009407227.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
ref|XP_008356685.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  87.4    3e-17   
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    3e-17   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g           89.4    3e-17   
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   
ref|XP_008805509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    4e-17   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430        88.6    4e-17   
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    5e-17   
gb|EAY85563.1|  hypothetical protein OsI_06935                        89.0    5e-17   
ref|NP_001046662.1|  Os02g0314600                                     88.6    6e-17   
ref|XP_009421481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    6e-17   
ref|XP_003573011.1|  PREDICTED: aspartic proteinase nepenthesin-2...  88.6    7e-17   
gb|KHN18625.1|  Aspartic proteinase nepenthesin-2                     88.6    7e-17   
ref|XP_003594399.1|  Aspartic proteinase nepenthesin-2                87.8    7e-17   
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                   87.8    7e-17   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           88.6    8e-17   
ref|NP_196637.1|  aspartyl protease family protein                    87.8    8e-17   
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    8e-17   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    8e-17   
gb|ACJ85595.1|  unknown                                               87.8    8e-17   
gb|AAN60226.1|  unknown                                               87.8    9e-17   
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg              88.2    9e-17   
ref|XP_003552901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    1e-16   
dbj|BAJ53226.1|  JHL06P13.6                                           87.4    1e-16   
ref|XP_006857554.1|  hypothetical protein AMTR_s00061p00053330        87.4    1e-16   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    1e-16   
ref|XP_008381436.1|  PREDICTED: aspartic proteinase nepenthesin-1     87.4    1e-16   
ref|XP_010035929.1|  PREDICTED: aspartic proteinase nepenthesin-2...  88.2    1e-16   
gb|KDP37099.1|  hypothetical protein JCGZ_06155                       87.0    1e-16   
ref|XP_007048981.1|  Eukaryotic aspartyl protease family protein ...  88.2    1e-16   
ref|XP_010419657.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    1e-16   
emb|CDY53652.1|  BnaC04g52860D                                        87.4    1e-16   
ref|NP_001043485.1|  Os01g0598600                                     87.4    1e-16   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    2e-16   
ref|XP_007048982.1|  Eukaryotic aspartyl protease family protein ...  87.4    2e-16   
ref|XP_009142895.1|  PREDICTED: aspartic proteinase nepenthesin-2     87.4    2e-16   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    2e-16   
ref|XP_009363121.1|  PREDICTED: aspartic proteinase nepenthesin-1     87.0    2e-16   
gb|KCW44810.1|  hypothetical protein EUGRSUZ_L01629                   86.3    2e-16   
gb|KJB41527.1|  hypothetical protein B456_007G108800                  87.0    2e-16   
dbj|BAK01404.1|  predicted protein                                    87.0    2e-16   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                        87.0    2e-16   
ref|XP_006832956.1|  hypothetical protein AMTR_s00095p00156630        86.7    3e-16   
gb|KHN40751.1|  Aspartic proteinase nepenthesin-2                     86.3    3e-16   
gb|EYU42788.1|  hypothetical protein MIMGU_mgv1a008084mg              85.5    3e-16   
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                     86.3    3e-16   
ref|XP_003534754.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    3e-16   
emb|CDO98455.1|  unnamed protein product                              85.9    4e-16   
ref|XP_011100548.1|  PREDICTED: aspartic proteinase nepenthesin-2...  86.3    4e-16   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                   85.1    4e-16   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    4e-16   
ref|XP_010913256.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    5e-16   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    5e-16   
ref|XP_009759829.1|  PREDICTED: aspartic proteinase nepenthesin-2...  86.3    5e-16   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  86.3    5e-16   
ref|XP_009625562.1|  PREDICTED: aspartic proteinase nepenthesin-2...  86.3    5e-16   
ref|XP_006357686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    5e-16   
ref|XP_002515388.1|  Aspartic proteinase nepenthesin-2 precursor,...  85.9    5e-16   
ref|XP_008778737.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    5e-16   
gb|KDO51883.1|  hypothetical protein CISIN_1g041228mg                 85.9    5e-16   
ref|XP_002279141.2|  PREDICTED: aspartic proteinase nepenthesin-2     85.9    6e-16   
ref|XP_010256102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    6e-16   
ref|XP_010688898.1|  PREDICTED: aspartic proteinase nepenthesin-1     85.9    6e-16   
ref|XP_006437136.1|  hypothetical protein CICLE_v10031104mg           85.9    6e-16   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    6e-16   
ref|XP_010904875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    6e-16   
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg           85.5    7e-16   
emb|CDX79836.1|  BnaA05g03200D                                        85.5    7e-16   
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    7e-16   
ref|XP_011467594.1|  PREDICTED: aspartic proteinase nepenthesin-2     85.5    7e-16   
ref|NP_001140482.1|  hypothetical protein precursor                   85.5    8e-16   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    8e-16   
ref|XP_007024419.1|  Eukaryotic aspartyl protease family protein,...  85.1    8e-16   
ref|XP_002525244.1|  Aspartic proteinase nepenthesin-2 precursor,...  84.7    9e-16   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        84.7    9e-16   
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg              85.1    1e-15   
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    1e-15   
ref|XP_004243605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  85.1    1e-15   
ref|XP_009404412.1|  PREDICTED: aspartic proteinase nepenthesin-2...  85.1    1e-15   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748  85.5    1e-15   
emb|CDP15730.1|  unnamed protein product                              85.1    1e-15   
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g           84.7    1e-15   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  85.1    1e-15   
ref|XP_007226285.1|  hypothetical protein PRUPE_ppa019577mg           84.3    1e-15   
ref|XP_008796557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    2e-15   
ref|XP_009401501.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  84.7    2e-15   
ref|XP_010087862.1|  Aspartic proteinase nepenthesin-1                84.7    2e-15   
gb|AEX12632.1|  hypothetical protein 2_5918_01                        80.1    2e-15   
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615           84.0    2e-15   
ref|XP_011036735.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_011040081.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
gb|EMT14793.1|  Aspartic proteinase nepenthesin-2                     83.6    2e-15   
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
gb|EMS52672.1|  Aspartic proteinase nepenthesin-2                     83.6    2e-15   
ref|XP_002309515.1|  nucleoid DNA-binding family protein              83.6    2e-15   
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580        84.0    3e-15   
gb|AET05305.2|  eukaryotic aspartyl protease family protein           83.6    3e-15   
dbj|BAJ91382.1|  predicted protein                                    83.6    3e-15   
ref|XP_010916060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    3e-15   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           84.0    3e-15   
ref|XP_003570481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    3e-15   
ref|XP_004239252.1|  PREDICTED: aspartic proteinase nepenthesin-1...  84.0    3e-15   
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    3e-15   
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein      83.2    3e-15   
dbj|BAJ86414.1|  predicted protein                                    83.6    3e-15   
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g           83.2    3e-15   
ref|XP_003630829.1|  Aspartic proteinase nepenthesin-2                83.6    3e-15   
ref|XP_002324351.1|  nucleoid DNA-binding family protein              83.2    3e-15   
gb|AEX12643.1|  hypothetical protein 2_5918_01                        79.3    4e-15   
emb|CAJ26370.1|  chloroplast nucleoid binding protein                 82.8    4e-15   
emb|CBI21639.3|  unnamed protein product                              80.9    5e-15   
gb|KJB55134.1|  hypothetical protein B456_009G064800                  83.2    5e-15   
ref|XP_006832955.1|  hypothetical protein AMTR_s00095p00155910        82.8    5e-15   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    5e-15   
ref|XP_002881883.1|  hypothetical protein ARALYDRAFT_903676           83.2    5e-15   



>ref|XP_009762361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
sylvestris]
Length=483

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFRD-QKKssnssssssssfslsvhprssLVRPHQRDY  260
            +P +Q+ DV+ +I+ T+  LSPT +  Q+++  S++S++SS S+S++PRS+LV+P  +DY
Sbjct  27   NPHSQIFDVAESIKKTVQVLSPTSQTFQQEAITSTASNTSSISVSIYPRSALVKPRHKDY  86

Query  261  GDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGE  440
              L  +R+ RD+ RV+SL  KL ++++  + +DLKPVQT++QPEDL++P+TSG SQGSGE
Sbjct  87   ASLTLSRLERDSARVSSLTMKLTLSLTNFTHSDLKPVQTMLQPEDLQTPITSGASQGSGE  146

Query  441  YFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            YF RLG+GQPAK+FYMV+DTGSD+TWLQC+PCSDCY Q+DP+FNP+ SS+Y RVS
Sbjct  147  YFTRLGLGQPAKEFYMVLDTGSDITWLQCEPCSDCYQQSDPVFNPSGSSTYSRVS  201



>ref|XP_009616228.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFRD-QKKssnssssssssfslsvhprssLVRPHQRDY  260
            +P++Q+ DV+ +I+ T+  LSP  +  Q+++  S+ S+SSS S+S++PRS+LV+P  +DY
Sbjct  29   NPESQIFDVAESIKKTVQVLSPASQAFQQEAIRSTPSNSSSISVSIYPRSALVKPRHKDY  88

Query  261  GDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGE  440
              L  +R+ RD+ RV+SL  KL +++S  + +DLKPVQT++QPEDL++P+TSG SQGSGE
Sbjct  89   ASLTLSRLERDSARVSSLTMKLTLSLSNFTHSDLKPVQTMLQPEDLQTPITSGASQGSGE  148

Query  441  YFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            YF RLG+GQPAK+FYMV+DTGSD+TWLQC+PCSDCY Q+DPIFNP+ SS+Y RVS
Sbjct  149  YFTRLGLGQPAKEFYMVLDTGSDITWLQCEPCSDCYQQSDPIFNPSGSSTYSRVS  203



>emb|CDP20730.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  96   QVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssL------VRPHQRD  257
            Q+ DVS+ IQ T    + T + Q++     + ++++   S     SL       +P  +D
Sbjct  37   QIFDVSAVIQKTHQVFTQTPQAQQEEEARPTITATAQHNSSVLSFSLHPRASVKKPQHKD  96

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSG  437
            Y  L  AR+ARD+ +V SL++KL  A+SG + ADLKPV T VQPEDLE+P+TSGVSQGSG
Sbjct  97   YSSLTRARIARDSAQVNSLNSKLEFALSGYTQADLKPVPTAVQPEDLETPLTSGVSQGSG  156

Query  438  EYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            EYFAR+GVG+P + +YMVIDTGSD++WLQCQPC+DCY QTDP+F+P+ SS+YR VS
Sbjct  157  EYFARMGVGRPGRSYYMVIDTGSDLSWLQCQPCADCYQQTDPMFDPSSSSTYRTVS  212



>ref|XP_006341626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=486

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALSPTFRD-QKKssnssssssssfslsvhprssLVRPHQRDYG  263
            P TQ+ DV+++I+ T+  L+P  ++ Q+++  ++  +SSS S+SV+PRS+LV P  +DY 
Sbjct  30   PHTQIFDVAASIEKTVQVLTPATQNFQQEAIKNTHFNSSSISVSVYPRSALVMPRHKDYA  89

Query  264  DLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEY  443
             L  +R+ RD+ RV+SL  KL +A++  + +DLKPV+T+VQPEDL++P+TSG SQGSGEY
Sbjct  90   ALTLSRLERDSARVSSLTMKLQLALNNFNHSDLKPVETMVQPEDLQTPITSGASQGSGEY  149

Query  444  FARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            F RLG+GQP K++YMV+DTGSD+TW+QC+PCSDCY Q+DPIF
Sbjct  150  FTRLGLGQPVKEYYMVLDTGSDITWVQCEPCSDCYQQSDPIF  191



>ref|XP_004235788.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=486

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALSPTFRD-QKKssnssssssssfslsvhprssLVRPHQRDYG  263
            P TQ+ DV+++I+ T+  L+P  +  Q+++  S+  +SSS S+S++PRS+LV+P  +DY 
Sbjct  30   PHTQIFDVAASIEKTVQVLTPATQSFQQEAIKSAHFNSSSISVSIYPRSALVKPRHKDYA  89

Query  264  DLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEY  443
             L  +R+ RD+ RV+SL  KL +A++  + +DLKPV+T+VQPEDL++P+TSG  QGSGEY
Sbjct  90   ALTLSRLERDSARVSSLTMKLHLALNNFNHSDLKPVETMVQPEDLQTPITSGARQGSGEY  149

Query  444  FARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            F RLG+GQP K +YMV+DTGSD+TW+QC+PCSDCY Q+DPIF
Sbjct  150  FTRLGLGQPVKQYYMVLDTGSDITWVQCEPCSDCYQQSDPIF  191



>ref|XP_006354732.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=491

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALSPTFRDQKKssnssss-----ssssfslsvhprssLVRPHQ  251
            P +Q+LDVS  IQNTL  LSP  +  ++            SSS+FS+S++PRSSLV+P  
Sbjct  32   PHSQILDVSKYIQNTLQVLSPNIKSLQQQEAIEQQQQPLYSSSAFSVSIYPRSSLVKPQH  91

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQG  431
             DY  L  +R+ARD+ RV+SL+A L ++ +  + + LK V+T+   E+ ++P+ SG SQG
Sbjct  92   TDYTSLTLSRLARDSARVSSLNAMLQLSPTNFTYSHLKSVRTMSGLEEFQTPLISGSSQG  151

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            SGEYFARLGVG+PAK+FYM IDTGSD+ WLQC+PC +CY QTDPIFNP+ SS+Y ++S
Sbjct  152  SGEYFARLGVGEPAKEFYMAIDTGSDINWLQCEPCDECYQQTDPIFNPSDSSTYNQLS  209



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            + + H +DY  L+ +R+ RD VR  SL A+L +A+  +S +DLKP++T ++PEDL +PVT
Sbjct  92   IYKIHHKDYKSLVLSRLHRDTVRFNSLTARLQLALEDISKSDLKPLETEIKPEDLSTPVT  151

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF R+GVG PA+ FYMV+DTGSD+ WLQCQPC+DCY QTDPIF+P  SS+Y
Sbjct  152  SGTSQGSGEYFTRVGVGNPARQFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPTASSTY  211

Query  594  RRVS  605
              V+
Sbjct  212  APVT  215



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 127/180 (71%), Gaps = 13/180 (7%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALS--------PTFRDQKKssnssssssssfslsvhprssLVRP  245
            +T VL+V S++Q T H LS        P F  + KS     +SSS  +L +H R +L+ P
Sbjct  34   KTTVLNVVSSLQQTQHILSIDPTTTTRPEF--ESKSIPFFLNSSSPLTLELHSRDTLLAP  91

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVTS  416
            H +DY  L+ +R+ RD+ RVA + AK+  +V G+  +DLKPV   +T+  PE+L +PV S
Sbjct  92   HHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLKPVYNDETMYNPEELTTPVVS  151

Query  417  GVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYR  596
            G SQGSGEYF+R+GVG PAK+ YMV+DTGSDV WLQC+PCSDCY Q+DP+F+PA+SS+Y+
Sbjct  152  GASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAESSTYK  211



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 127/180 (71%), Gaps = 13/180 (7%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALS--------PTFRDQKKssnssssssssfslsvhprssLVRP  245
            +T VL+V S++Q T H LS        P F  + KS     +SSS  +L +H R +L+ P
Sbjct  34   KTTVLNVVSSLQQTQHILSIDPTTTTRPEF--ESKSIPFFLNSSSPLTLELHSRDTLLAP  91

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVTS  416
            H +DY  L+ +R+ RD+ RVA + AK+  +V G+  +DLKPV   +T+  PE+L +PV S
Sbjct  92   HHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLKPVYNDETMYNPEELTTPVVS  151

Query  417  GVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYR  596
            G SQGSGEYF+R+GVG PAK+ YMV+DTGSDV WLQC+PCSDCY Q+DP+F+PA+SS+Y+
Sbjct  152  GASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAESSTYK  211



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 130/185 (70%), Gaps = 18/185 (10%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALS-------------PTFRDQKKssnssssssssfslsvhprs  230
            +T VL+V+S++Q T H LS             P F  + KS     +SSS  +L +H R 
Sbjct  34   KTTVLNVASSLQQTQHILSIDPTRSSLTTTTRPEF--ESKSIPFFPNSSSPLTLELHSRD  91

Query  231  sLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLE  401
            +L+ PH +DY  L+ +R+ RD+ RVA++ AK+  +V G++ +DLKPV   +T+  PE+L 
Sbjct  92   TLLAPHHKDYKSLVLSRLERDSSRVAAIAAKVRFSVEGVNRSDLKPVYNDETMYNPEELT  151

Query  402  SPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQ  581
            +PV SG SQGSGEYF+R+GVG PAK+ YMV+DTGSDV WLQC+PCSDCY Q+DP+F+PA+
Sbjct  152  TPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAE  211

Query  582  SSSYR  596
            SS+Y+
Sbjct  212  SSTYK  216



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L   + +DY  L+  R+ RD+ RV SL+ KL +A+ G++ ADL+P+QT ++PE L +PV+
Sbjct  87   LYTSNHKDYKSLVLTRLGRDSARVNSLNTKLQLALQGVNRADLEPMQTEIRPEGLSTPVS  146

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG+S GSGEYF R+GVG PAK FYMV+DTGSDV WLQCQPCSDCY Q+DPIFNP  SS++
Sbjct  147  SGISLGSGEYFTRVGVGSPAKQFYMVLDTGSDVNWLQCQPCSDCYQQSDPIFNPTGSSTF  206

Query  594  RRVS  605
            R+++
Sbjct  207  RQLT  210



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            + + H +DY  L+ +R+ RD  R  SL A+L +A+  +S +DLKP++T ++PEDL +PVT
Sbjct  94   IYKIHHKDYKSLVLSRLHRDTARFNSLTARLQLALEDISKSDLKPLETEIKPEDLSTPVT  153

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF R+GVG PA+ FYMV+DTGSD+ WLQCQPC+DCY Q DPIF+P  SS+Y
Sbjct  154  SGTSQGSGEYFTRVGVGNPARQFYMVLDTGSDINWLQCQPCTDCYQQIDPIFDPTASSTY  213

Query  594  RRVS  605
              V+
Sbjct  214  APVT  217



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 128/178 (72%), Gaps = 7/178 (4%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALS-------PTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            T  LDVSS++Q  L  LS       P  +  +++S S S+SS SFSL++H R ++ +   
Sbjct  34   TTTLDVSSSLQQALSILSFDSKTANPFNQLGQQTSPSFSNSSLSFSLTLHSRETIYKTRH  93

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQG  431
            +DY  L+ +R+ RD+ RV ++  ++ +AV+G+S  DLKP+ T +QPED  +PVTSG SQG
Sbjct  94   KDYKSLVLSRLQRDSSRVKAITTQVELAVNGISKNDLKPLVTEIQPEDFSTPVTSGTSQG  153

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            SGEYF+R+GVG P K FYMV+DTGSD+TWLQC+PCSDCY Q DPIF P+ SSSYR +S
Sbjct  154  SGEYFSRVGVGNPEKSFYMVLDTGSDITWLQCEPCSDCYQQADPIFTPSASSSYRPLS  211



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 121/182 (66%), Gaps = 9/182 (5%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhpr---------ssLV  239
            P +Q+LDVS +IQNTL  LS   +  ++        SSS S  +            SSLV
Sbjct  32   PHSQILDVSKSIQNTLQVLSLNIKSLQQQQQQQPLYSSSSSSLLSSSALSISIYPRSSLV  91

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSG  419
            +P   DY  L  +R+ARD+ RV+SL+A L ++ +  + +  K V+T+  P + ++P+ SG
Sbjct  92   KPQHTDYTSLTLSRLARDSARVSSLNAMLQLSPTNFTYSHRKSVRTMSGPGEFQTPLISG  151

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYFARLG+G+PAK+FYMVIDTGSD+ WLQC+PC  CY QTDPIFNP+ SS+Y +
Sbjct  152  TSQGSGEYFARLGIGEPAKEFYMVIDTGSDINWLQCEPCDVCYQQTDPIFNPSDSSTYNQ  211

Query  600  VS  605
            VS
Sbjct  212  VS  213



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL  KL +A+ G+   DL+P+ T VQ +DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTRLGRDSARVNSLHTKLQLALQGIKRVDLEPMHTEVQSQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQC PCSDCY Q+DP+FNPA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTF--------RDQKKssnssssssssfslsvhprssLVRP  245
             + VLDVS +I+ TL  LS           RD+K +S S +S +SSFSL +HPR  L   
Sbjct  34   HSSVLDVSGSIRKTLDVLSHKSSVSKPSDQRDEKTTSFSPTSLASSFSLELHPRELLHGG  93

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-VVQPEDLESPVTSGV  422
              +DY  LM +R+ARD+ RV +++ KL +AVSG   +DL P+ T ++ P+D  +PVTSG 
Sbjct  94   SHKDYRALMLSRLARDSARVKAINTKLQLAVSGTDKSDLVPMDTEILHPQDFSTPVTSGT  153

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            SQGSGEYF R+G+G+P+K FYMVIDTGSDV WLQC+PC DCY Q DPIF+PA SSS+ R+
Sbjct  154  SQGSGEYFLRVGIGRPSKTFYMVIDTGSDVNWLQCKPCDDCYQQVDPIFDPASSSSFSRL  213



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 114/177 (64%), Gaps = 12/177 (7%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhpr----------ssLVR  242
            T  LDVS ++QNT   LS  F  Q ++S S                          SLVR
Sbjct  35   TATLDVSGSLQNTRGVLS--FDPQSQTSFSEQEQEQEQRQKQTSSGSFSVRLHPRESLVR  92

Query  243  PHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGV  422
               R+Y  L+ AR+ RD+ RV +L +KL +A++ ++  DL P++T +QPEDL +PV SG 
Sbjct  93   TPYREYKALVLARLGRDSARVDALASKLNLALNNVTRTDLTPLRTEIQPEDLSTPVVSGT  152

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQCQPC+DCY QTDP+F P+ SSSY
Sbjct  153  SQGSGEYFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCYQQTDPVFTPSSSSSY  209



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L+ +R+ RD+ RV SL  KL + V  +  +DL+P+ T ++PEDL +PV 
Sbjct  89   LHNSQHKDYESLVQSRLGRDSARVNSLHTKLQLVVQNIKKSDLEPMHTEIRPEDLSTPVV  148

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF R+GVG PAK  YMV+DTGSD+ WLQC+PCSDCY QTDP+FNP  SS+Y
Sbjct  149  SGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTY  208

Query  594  RRVS  605
            R V+
Sbjct  209  RPVT  212



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL  KL +A+ G+   DL+P+ T +Q +DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTRLGRDSARVNSLHTKLQLALQGIKRVDLEPMHTEIQSQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQC PCSDCY Q+DP+FNPA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_007036465.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY20966.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=491

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 128/182 (70%), Gaps = 8/182 (4%)
 Frame = +3

Query  84   SPQ-TQVLDVSSAIQNTLHALS-------PTFRDQKKssnssssssssfslsvhprssLV  239
            SPQ T  LDVSS+++   H LS          + Q  +   +SSSSS FS+ +H R SL 
Sbjct  29   SPQATTTLDVSSSLEQAQHILSFDPQSLTSFVQAQSAAPFFNSSSSSVFSIPLHSRGSLR  88

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSG  419
            + H  DY  L+ +R+ RD+ RV SL  KL +A++G+  ++L+P+ T ++PE L +PV SG
Sbjct  89   KTHHTDYKSLVLSRLDRDSSRVDSLTTKLQLALNGVKKSELRPLPTEIRPEALSTPVISG  148

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+R+GVG P+K FYMV+DTGSD+TW+QC+PCSDCY Q+DPIFNP+ SS+Y  
Sbjct  149  TSQGSGEYFSRIGVGNPSKQFYMVLDTGSDITWIQCEPCSDCYQQSDPIFNPSGSSTYSP  208

Query  600  VS  605
            VS
Sbjct  209  VS  210



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L+ +R+ RD+ RV SL  KL +AV  +  +DL+P+ T ++PEDL +PV 
Sbjct  89   LHNSQHKDYESLVLSRLGRDSARVNSLHTKLQLAVQNIKKSDLEPMHTEIRPEDLSTPVV  148

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF R+GVG PAK  YMV+DTGSD+ WLQC+PCSDCY QTDP+FNP  SS+Y
Sbjct  149  SGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTY  208

Query  594  RRVS  605
              V+
Sbjct  209  HPVT  212



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 14/187 (7%)
 Frame = +3

Query  75   RAISP-QTQVLDVSSAIQ-------------NTLHALSPTFRDQKKssnssssssssfsl  212
            R I+P  T +LDVSS+IQ             N L A +   + QK   N  S+SSS F+L
Sbjct  31   RFITPSHTSLLDVSSSIQQTNQILSFNPKNNNLLEASNYNNQQQKTQFNPISNSSSPFTL  90

Query  213  svhprssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPE  392
             +HPR +L+  H +DY +L+ +R+ARD+ RV SL+ KL +A++ +  +DL P QT +Q  
Sbjct  91   LLHPRETLLNEHHKDYKNLIFSRLARDSARVNSLNTKLQLALNNIKKSDLHPTQTELQQL  150

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            DL +PV+SG  QGSGEYF RLGVGQP K +YMV+DTGSDV W+QC+PCSDCY Q+DPI++
Sbjct  151  DLSTPVSSGTGQGSGEYFTRLGVGQPEKPYYMVLDTGSDVNWIQCKPCSDCYQQSDPIYD  210

Query  573  PAQSSSY  593
            P  SS+Y
Sbjct  211  PTTSSTY  217



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L    + RD+ RV SL  KL +A+ G+   DL+P+   +QP+DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTILGRDSARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQC PCSDCY Q+DP FNPA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL  KL +A+ G+   DL+P+   +QP+DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTRLGRDSARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQC PCSDCY Q+DP FNPA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALS--PTFRDQKKssnssssssssfslsvhprssLVR------P  245
            +T +LDVSS++Q  L+ LS  P  +         + +  SF  S    S   R      P
Sbjct  35   KTTILDVSSSLQQALNILSFNPQQQTALSQQQQQTIAIPSFLNSSFSLSLNPRDTIHKTP  94

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVS  425
            H +DY  L+ +R+ RD+ RV ++  +L + ++G+S +DLKP+QT +QP+DL +PV+SG S
Sbjct  95   H-KDYKALVLSRLHRDSSRVQAITTRLQLILNGVSKSDLKPLQTEIQPQDLSTPVSSGTS  153

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            QGSGEYF R+GVG PAK +YMV+DTGSD+ W+QCQPCSDCY Q+DPIF PA SSSY
Sbjct  154  QGSGEYFTRVGVGNPAKSYYMVLDTGSDINWIQCQPCSDCYQQSDPIFTPAASSSY  209



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL +KL +A+ G+  +DL+P+   + P+DL +PV 
Sbjct  82   LFNSQHKDYKSLTRTRLYRDSARVHSLHSKLQLALQGIKKSDLEPMHAKILPQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV DTGSDV WLQC PCSDCY Q+DP+FNPA SSSY
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVPDTGSDVNWLQCDPCSDCYQQSDPVFNPAGSSSY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL  KL +A+ G+  +DL+P+   + P+DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTRLDRDSARVNSLHTKLQLALQGIKKSDLEPMHAEILPQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GVG PAK FYMV+DTGSDV WLQC PCSDCY Q+DP+F+PA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCNPCSDCYQQSDPVFSPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 118/195 (61%), Gaps = 31/195 (16%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS------------------PTFRDQKKssnssssssssfs  209
            S +T VLDV S++Q T H LS                  P F +     +    S  +  
Sbjct  31   SHETTVLDVVSSLQQTQHILSLDPTLTSLTTTTSIPGSDPVFLNSSSPLSLELHSRDT--  88

Query  210  lsvhprssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTV  380
                    LV    +DY  L+ +R+ RD+ RVA + AK+  AV G+  +DLKPV   +T 
Sbjct  89   --------LVASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLKPVYNDETS  140

Query  381  VQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTD  560
             QPEDL +PV SG SQGSGEYF+R+GVG PAK+ +MV+DTGSD+ W+QCQPCSDCY Q+D
Sbjct  141  YQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSD  200

Query  561  PIFNPAQSSSYRRVS  605
            P+F+PA SS+++ +S
Sbjct  201  PVFDPASSSTFKSLS  215



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 125/184 (68%), Gaps = 11/184 (6%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALS--PTFRD------QKKssnssssssssfslsvhprssLVR  242
            P+T VLDV S++Q T H LS  PT         + +S     +SSS  SL++H R +LV 
Sbjct  32   PKTTVLDVVSSLQQTQHILSLDPTLSSLTTAIPESQSDPVFLNSSSPLSLTLHSRDTLVA  91

Query  243  PHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVT  413
               +DY  L+ +R+ RD+ RVA + AK+  AV G+  +DLKPV   +T  Q EDL +PV 
Sbjct  92   SQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLKPVYNDETRYQTEDLTTPVV  151

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG  QGSGEYF+R+GVG PAK+ +MV+DTGSD+ W+QCQPCSDCY Q+DPIF+P  SS++
Sbjct  152  SGAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPIFDPTSSSTF  211

Query  594  RRVS  605
            + ++
Sbjct  212  KSLT  215



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 118/196 (60%), Gaps = 32/196 (16%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS-------------------PTFRDQKKssnssssssssf  206
            S +T VLDV S++Q T H LS                   P F +     +    S  + 
Sbjct  32   SHETTVLDVVSSLQQTQHILSLDPTLSSLTTTTTTIPGSDPVFLNSSSPLSLELHSRDT-  90

Query  207  slsvhprssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QT  377
                     LV    +DY  L+ +R+ RD+ RVA +  K+  AV G+  +DLKPV   +T
Sbjct  91   ---------LVASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLKPVYNDET  141

Query  378  VVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQT  557
            + QPEDL +PV SG SQGSGEYF+R+GVG PAK+ +MV+DTGSD+ W+QCQPCSDCY Q+
Sbjct  142  LYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQS  201

Query  558  DPIFNPAQSSSYRRVS  605
            DP+F+PA SS+++ +S
Sbjct  202  DPVFDPASSSTFKSLS  217



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L      DY  L+ +R+ARD+ RV SL+ KL +A++ +  ++L P QT ++PEDL +PV+
Sbjct  81   LFNAQHPDYKTLVLSRLARDSARVNSLETKLQLALNSVKRSELYPTQTEIRPEDLSTPVS  140

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF+R+GVGQPAK F+MV+DTGSDV WLQC+PCSDCY QTDP+F+P  SSSY
Sbjct  141  SGTSQGSGEYFSRVGVGQPAKPFFMVLDTGSDVNWLQCKPCSDCYQQTDPVFDPTSSSSY  200



>gb|KJB52970.1| hypothetical protein B456_008G285900 [Gossypium raimondii]
Length=492

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 128/181 (71%), Gaps = 7/181 (4%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS--PTF-----RDQKKssnssssssssfslsvhprssLVR  242
            SP T++LDV ++++   H LS  P       + Q    NSSSSS S FS+ +H R SL +
Sbjct  30   SPTTKILDVLASLKQAQHILSFDPQISNGFSKSQPLFFNSSSSSGSGFSIPLHSRGSLRK  89

Query  243  PHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGV  422
             H  DY +L+ +R+ RD+ RV +L  ++++AV+G+   +LKPV T ++PE L +PV SG 
Sbjct  90   THHVDYKNLVRSRLDRDSARVNTLTTEVLLAVNGVRKTELKPVVTELEPEALSTPVISGT  149

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            SQGSGEYF R+GVG PAK FYMV+DTGSDV W+QC+PC+DCY Q+DPIF+P+ SS+Y  V
Sbjct  150  SQGSGEYFTRVGVGNPAKQFYMVLDTGSDVNWIQCEPCTDCYQQSDPIFDPSASSTYSPV  209

Query  603  S  605
            +
Sbjct  210  T  210



>ref|XP_009609715.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=476

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 112/172 (65%), Gaps = 10/172 (6%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYGDL  269
             +Q+LDV+ +IQNTLH LSP F+  ++ +      +SS S S    +  V  + R    L
Sbjct  30   NSQILDVAKSIQNTLHVLSPKFQSFQQEAIKQPLYNSSSSSSSSSSAFSVSIYPRS--SL  87

Query  270  MaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFA  449
               +         S  A+  V VS L+        T++Q E++++PVTSGVS+GSGEYFA
Sbjct  88   AKTQHKNYTCLTLSRLARDSVRVSSLT--------TMLQLEEIQTPVTSGVSEGSGEYFA  139

Query  450  RLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            R+G+GQP K+FYMVIDTGSD+TW QC+PCS+CY QTDPIFNP+ SS+Y R+S
Sbjct  140  RVGLGQPLKEFYMVIDTGSDITWFQCEPCSECYQQTDPIFNPSDSSTYTRLS  191



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ---TVVQPEDLES  404
            LV    +DY  L+ +R+ RD+ RVA + AK+  AV G+  +DLKPV    T  QPE L +
Sbjct  90   LVASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVNNEDTRYQPEALTT  149

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQS  584
            PV SGVSQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QC+PCSDCY Q+DP+FNP  S
Sbjct  150  PVVSGVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSS  209

Query  585  SSYRRVS  605
            S+Y+ ++
Sbjct  210  STYKSLT  216



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSG  419
            + H  DY  L+ +R+ RD+ RV SL  KL++A++G+  + L+P+ T +Q E L +P+ SG
Sbjct  91   KTHHTDYKALVLSRLERDSARVDSLSTKLLLALNGVKKSQLRPLPTQIQAEALSTPIISG  150

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+R+GVG+PAK FYMV+DTGSD+ W+QC+PC++CY Q+DPIFNP+ SS+Y  
Sbjct  151  TSQGSGEYFSRVGVGKPAKQFYMVLDTGSDINWIQCEPCNECYQQSDPIFNPSGSSTYSP  210

Query  600  VS  605
            V+
Sbjct  211  VT  212



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 121/191 (63%), Gaps = 17/191 (9%)
 Frame = +3

Query  78   AISPQTQVLDVSSAIQNTLHALS------------PTFRDQKKssnssssssssfslsvh  221
            + S +T VLDV S++Q T H LS            P F+ +      +SSS  S  L   
Sbjct  30   STSHKTTVLDVVSSLQQTQHILSVDPTRSSLTARIPEFKPESDPVFLNSSSPLSLELHSR  89

Query  222  prssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPE  392
                LV    +DY  L+ +R+ RD+ RVA + AK+  AV G+  +DLKPV   +T  QPE
Sbjct  90   DT--LVASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVDIDETRFQPE  147

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            DL +PV SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QC PCS+CY Q+DPIF+
Sbjct  148  DLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPCSECYQQSDPIFD  207

Query  573  PAQSSSYRRVS  605
            P  SS+++ ++
Sbjct  208  PTSSSTFKSLT  218



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             +DY  L+ +R++RD+ RV S+  +L  A+S L  +DL+P++T + PEDL +P+ SG SQ
Sbjct  89   HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSDLEPLKTEILPEDLSTPIVSGTSQ  148

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVGQPAK FYMV+DTGSD+ WLQCQPC+DCY QTDPIF+P  SSS+
Sbjct  149  GSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSF  203



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             +DY  L+ +R++RD+ RV S+  +L  A+S L  +DL+P++T + PEDL +P+ SG SQ
Sbjct  91   HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSDLEPLKTEILPEDLSTPIISGTSQ  150

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVGQPAK FYMV+DTGSD+ WLQCQPC+DCY QTDPIF+P  SSS+
Sbjct  151  GSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSF  205



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             +DY  L+ +R++RD+ RV S+  +L  A+S L  +DL+P++T + PEDL +P+ SG SQ
Sbjct  91   HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSDLEPLKTEILPEDLSTPIISGTSQ  150

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVGQPAK FYMV+DTGSD+ WLQCQPC+DCY QTDPIF+P  SSS+
Sbjct  151  GSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSF  205



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            L     +DY  L   R+ RD+ RV SL  KL +A+ G+   DL+P+   +QP+DL +PV 
Sbjct  82   LFNSQHKDYKSLTLTRLGRDSARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVV  141

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGVSQGSGEYF+R+GV  PAK FYMV+DTGSDV WLQC PCSDCY Q+DP  NPA SS+Y
Sbjct  142  SGVSQGSGEYFSRIGVXTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXXNPAGSSTY  201

Query  594  RRVS  605
             +++
Sbjct  202  SQLT  205



>ref|XP_003534178.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Glycine 
max]
Length=492

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-VVQPEDLESPV  410
            L+     +Y  L+ +R+ARD  RV SL+ KL +A+S L+ +DL P +T +++PEDL +PV
Sbjct  87   LLNEQHPNYKTLVLSRLARDTARVNSLNTKLQLALSSLNRSDLYPTETELLRPEDLSTPV  146

Query  411  TSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSS  590
            +SG +QGSGEYF+R+GVGQP+K FYMV+DTGSDV WLQC+PCSDCY Q+DPIF+P  SSS
Sbjct  147  SSGTAQGSGEYFSRVGVGQPSKPFYMVLDTGSDVNWLQCKPCSDCYQQSDPIFDPTASSS  206

Query  591  YR  596
            Y 
Sbjct  207  YN  208



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ---TVVQPEDLES  404
             V    +DY  L+ +R+ RD+ RV  + AK+  AV G+  +DLKPV    T  QPEDL +
Sbjct  91   FVASQHKDYKSLVLSRLERDSSRVNGIAAKVRFAVEGIDRSDLKPVSNEDTRYQPEDLTT  150

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQS  584
            PV SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QCQPCSDCY Q+DP+F+P  S
Sbjct  151  PVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFSPTSS  210

Query  585  SSYRRVS  605
            S+Y+ ++
Sbjct  211  STYKSLT  217



>ref|XP_010092769.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB52179.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ-TVVQPEDLESPV  410
            L+  + +DY  L+ +R+ RD+ RV SL+ K  +A++GL  +DL+P +  +++PEDL +P+
Sbjct  91   LLNSNHKDYRSLVLSRLDRDSARVDSLNLKHQLALNGLKRSDLRPTEDQLLRPEDLSTPI  150

Query  411  TSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
             SG SQGSGE+FAR+GVGQPAK FYMVIDTGSDV WLQCQPCSDCYSQTDPIF+
Sbjct  151  VSGTSQGSGEFFARIGVGQPAKQFYMVIDTGSDVNWLQCQPCSDCYSQTDPIFD  204



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 120/184 (65%), Gaps = 11/184 (6%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALS--------PTFRDQKKssnssssssssfslsvhprssLVR  242
            P+T VLDV S++Q T   LS         T + +  S     +SSS  SL +H R + V 
Sbjct  33   PKTNVLDVVSSLQQTQTILSLDPTRSSLTTTKPESLSDPVFFNSSSPLSLELHSRDTFVA  92

Query  243  PHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVT  413
               +DY  L  +R+ RD+ RVA + AK+  AV G+  +DLKPV    T  Q EDL +PV 
Sbjct  93   SQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLKPVYNEDTRYQTEDLTTPVV  152

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF+R+GVG PAKD Y+V+DTGSDV W+QC+PC+DCY Q+DP+FNP  SS+Y
Sbjct  153  SGASQGSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTY  212

Query  594  RRVS  605
            + ++
Sbjct  213  KSLT  216



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALS-----PTFRDQKKssnsss-----sssssfslsvh  221
            P +  P+T VLDV S++Q T   LS      +F   +  S S S     +SSS  SL +H
Sbjct  28   PLSTPPKTSVLDVVSSLQQTQTILSLDPARSSFTSTRPESVSLSDPVFLNSSSPLSLELH  87

Query  222  prssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPE  392
             R  LV    +DY  L+ +R+ R++ RVA + AK+  AV G+  +DLKPV    T  Q +
Sbjct  88   SRDILVASQHKDYKSLVLSRLERESSRVAGIAAKIQFAVEGIDRSDLKPVYNEDTRYQTQ  147

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            +L +PV SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QCQPCSDCY Q+DP+FN
Sbjct  148  ELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFN  207

Query  573  PAQSSSYRRVS  605
            P  SS+Y+ ++
Sbjct  208  PTSSSTYKSLT  218



>ref|XP_009798772.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=472

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 23/176 (13%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFR----DQKKssnssssssssfslsvhprssLVRPHQRD  257
            ++Q+LDV+ +IQNTLH LSP F+    +  K    +SSSSS+FS+S++PRSSL +   ++
Sbjct  31   ESQILDVAKSIQNTLHVLSPKFQSFQQEAIKQPLFNSSSSSAFSVSIYPRSSLTKTQHKN  90

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSG  437
            Y  L             S  A+  V VS L+        T++Q E++++PVTSGVS+GSG
Sbjct  91   YTYL-----------TLSRLARDSVRVSSLT--------TMLQLEEIQTPVTSGVSEGSG  131

Query  438  EYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            EYFAR+G GQP K+FYM IDTGSD+TWLQC+PCS+CY QTD IFNP+ SS+Y  +S
Sbjct  132  EYFARVGFGQPVKEFYMAIDTGSDITWLQCEPCSECYQQTDSIFNPSDSSTYTSLS  187



>gb|KCW86348.1| hypothetical protein EUGRSUZ_B03036 [Eucalyptus grandis]
Length=492

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 123/185 (66%), Gaps = 14/185 (8%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRD-------QKKssnssssssssfslsvhprs  230
            P   S  T VLDV ++++N L AL+   RD       Q++ +   SSSSSS +L +H R+
Sbjct  29   PTTTSVATTVLDVRASVRNALDALA---RDPQTTPLRQQEEAQRQSSSSSSLTLQLHSRA  85

Query  231  sLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ----PEDL  398
            SL +P QRDY  L  AR+ RD+ RV SL A++ +AV G++ +DLKP++   +     E  
Sbjct  86   SLRKPSQRDYRSLTLARLERDSARVKSLGARVDLAVDGIAKSDLKPLEASAEREIGAEGF  145

Query  399  ESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPA  578
            ESPV SG SQGSGEYF+RLGVG P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA
Sbjct  146  ESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPA  205

Query  579  QSSSY  593
             S+S+
Sbjct  206  SSASF  210



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 123/185 (66%), Gaps = 14/185 (8%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRD-------QKKssnssssssssfslsvhprs  230
            P   S  T VLDV ++++N L AL+   RD       Q++ +   SSSSSS +L +H R+
Sbjct  29   PTTTSVATTVLDVRASVRNALDALA---RDPQTTPLRQQEEAQRQSSSSSSLTLQLHSRA  85

Query  231  sLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ----PEDL  398
            SL +P QRDY  L  AR+ RD+ RV SL A++ +AV G++ +DLKP++   +     E  
Sbjct  86   SLRKPSQRDYRSLTLARLERDSARVKSLGARVDLAVDGIAKSDLKPLEASAEREIGAEGF  145

Query  399  ESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPA  578
            ESPV SG SQGSGEYF+RLGVG P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA
Sbjct  146  ESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPA  205

Query  579  QSSSY  593
             S+S+
Sbjct  206  SSASF  210



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 120/184 (65%), Gaps = 11/184 (6%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALS--------PTFRDQKKssnssssssssfslsvhprssLVR  242
            P+T VLDV S++Q T   LS         T + +  S     +SSS  SL +H R + V 
Sbjct  33   PKTNVLDVVSSLQQTQTILSLDPTRSSLTTTKPESLSDPVFFNSSSPLSLELHSRDTFVA  92

Query  243  PHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVT  413
               +DY  L  +R+ RD+ RVA + AK+  AV G+  +DLKPV    T  Q EDL +PV 
Sbjct  93   SQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLKPVYNEDTRYQTEDLTTPVV  152

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QC+PC+DCY Q+DP+FNP  SS+Y
Sbjct  153  SGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTY  212

Query  594  RRVS  605
            + ++
Sbjct  213  KSLT  216



>gb|KDO70057.1| hypothetical protein CISIN_1g0117491mg, partial [Citrus sinensis]
Length=235

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  78   AISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +IS  T  LDVS++IQNTL   S  F  +    +  SSSSSS +L +H R+S+ R    D
Sbjct  29   SISVTTTTLDVSASIQNTLKPFS--FDPRTTPQSLISSSSSSLALQLHSRTSVQRTSHND  86

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT--VVQPEDLESPVTSGVSQG  431
            Y  L  AR+ RD+ RV SL A+L +A+ G++ +DLKP+ +    + E+++ P+ SG SQG
Sbjct  87   YKSLTLARLERDSARVRSLSARLDLAIRGIATSDLKPLDSGSEFEAEEIQGPIVSGSSQG  146

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGEYF+R+G+G+P    YMV+DTGSDV WLQC PC+DCY Q DPIF P  SSSY
Sbjct  147  SGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSY  200



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALS-----PTFRDQKKssnsss-----sssssfslsvh  221
            P +  P+T VLDV S++Q T   LS      +F   +  S S S     +SSS  SL +H
Sbjct  27   PLSTPPKTSVLDVVSSLQQTQTILSLDPARSSFTSTRPESVSLSDPVFLNSSSPLSLELH  86

Query  222  prssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPE  392
             R   V    +DY  L+ +R+ RD+ RVA + AK+  AV G+  +DLKPV    T  Q +
Sbjct  87   SRDIFVASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVYNEDTRYQTQ  146

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            +L +PV SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QC+PCSDCY Q+DP+FN
Sbjct  147  ELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFN  206

Query  573  PAQSSSYRRVS  605
            P  SS+Y+ ++
Sbjct  207  PTSSSTYKSLT  217



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALS-----PTFRDQKKssnsss-----sssssfslsvh  221
            P +  P+T VLDV S++Q T   LS      +F   +  S S S     +SSS  SL +H
Sbjct  27   PLSTPPKTSVLDVVSSLQQTQTILSLDPARSSFTSTRPVSVSLSDPVFLNSSSPLSLELH  86

Query  222  prssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ---TVVQPE  392
             R   V    +DY  L+ +R+ RD+ RV+ + AK+  AV G+  +DLKPV    T  Q +
Sbjct  87   SRDIFVASQHKDYKSLVLSRLERDSSRVSGIAAKIRFAVEGIDRSDLKPVDNEDTRYQTQ  146

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            +L +PV SG SQGSGEYF+R+GVG PAK+ Y+V+DTGSDV W+QC+PCSDCY Q+DP+FN
Sbjct  147  ELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFN  206

Query  573  PAQSSSYRRVS  605
            P  SS+Y+ ++
Sbjct  207  PTSSSTYKSLT  217



>emb|CDP20336.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 116/177 (66%), Gaps = 3/177 (2%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHAL---SPTFRDQKKssnssssssssfslsvhprssLVRPHQR  254
            S  T VLDV+S++Q TL      S   +  +    S SSSSS  SL +H R  L +    
Sbjct  26   SSATNVLDVTSSLQKTLDVFTVDSQATKSLENQETSFSSSSSLLSLKLHSRVGLRKASDI  85

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGS  434
            DY  L  AR+ RD+ RV SL  +L +AV G+S ADLKP++T +  E +E PV SG SQGS
Sbjct  86   DYKALTLARLGRDSARVNSLQTRLDLAVHGISKADLKPMETQLDVEAMEGPVISGTSQGS  145

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GEYF+R+G+G+P    YMV+D+GSDV W+QC PCSDCY Q DPIF PA SSS+ R++
Sbjct  146  GEYFSRVGIGRPPSQVYMVLDSGSDVNWVQCAPCSDCYQQADPIFQPASSSSFSRLT  202



>ref|XP_010677970.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 111/171 (65%), Gaps = 15/171 (9%)
 Frame = +3

Query  102  LDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQR---------  254
            LDVSS+I++TL+  S   ++Q+ + + +   + +   +       ++ H R         
Sbjct  43   LDVSSSIRSTLNVFSIQQQEQQVTQSKNKKHAIAKPYNSSSTVLSLKIHPRMSLHAHHHQ  102

Query  255  ------DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTS  416
                  DY  L   R+ARD+ RV SL  +  +A+ G+S +DLKPV+  + P DLE+PV+S
Sbjct  103  QHQQDTDYNTLTKLRLARDSARVDSLITRAELAIRGVSRSDLKPVEKYISPMDLEAPVSS  162

Query  417  GVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            G S GSGEYF+R+GVG P+KDF+MVIDTGSD++WLQC+PCSDCY QTDPIF
Sbjct  163  GTSLGSGEYFSRVGVGSPSKDFFMVIDTGSDISWLQCEPCSDCYQQTDPIF  213



>ref|XP_006484425.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=485

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  78   AISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +IS  T  LDVS++IQNTL   S  F  +    +  SSSSSS +L +H R+S+ R    D
Sbjct  29   SISVTTTTLDVSASIQNTLKPFS--FDPRTTPQSLISSSSSSLALQLHSRTSVQRTSHND  86

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT--VVQPEDLESPVTSGVSQG  431
            Y  L  AR+ RD+ RV SL A+L +A+ G++ +DLKP+ +    + E+++SP+ SG SQG
Sbjct  87   YKSLTLARLERDSARVRSLSARLDLAIRGIATSDLKPLDSGSEFEAEEIQSPIVSGSSQG  146

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGEYF+R+G+G+P    YMV+DTGSDV WLQC PC+DCY Q DPIF P  SSSY
Sbjct  147  SGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSY  200



>ref|XP_006437718.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
 gb|ESR50958.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
Length=485

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  78   AISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +IS  T  LDVS++IQNTL   S  F  +    +  SSSSSS +L +H R+S+ R    D
Sbjct  29   SISVTTTTLDVSASIQNTLKPFS--FDPRTTPQSLISSSSSSLALQLHSRTSVQRTSHND  86

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT--VVQPEDLESPVTSGVSQG  431
            Y  L  AR+ RD+ RV SL A+L +A+ G++ +DLKP+ +    + E+++SP+ SG SQG
Sbjct  87   YKSLTLARLERDSARVRSLAARLDLAIRGIATSDLKPLDSGSEFEAEEIQSPIVSGSSQG  146

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGEYF+R+G+G+P    YMV+DTGSDV WLQC PC+DCY Q DPIF P  SSSY
Sbjct  147  SGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSY  200



>ref|XP_004298296.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYG  263
            + +T VLDV+++IQ TL+A+S         S+ + S+SSS SL +H R SL +   +DY 
Sbjct  26   TSKTTVLDVAASIQATLNAVSSYSNSGATQSSLTHSASSSLSLPLHSRISLHQHSHKDYK  85

Query  264  DLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-VVQPEDLESPVTSGVSQGSGE  440
             L++AR+ RD+ RV SL  +L +AVSG++ +DLKPV T     ++ E PV SG SQGSGE
Sbjct  86   SLISARLGRDSARVRSLTTRLDLAVSGIATSDLKPVDTESFATDEFEGPVVSGTSQGSGE  145

Query  441  YFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            YF+R+G+G+P    Y+V+DTGSDV+W+QC PC+DCY Q DPIF P  S+S+ ++S
Sbjct  146  YFSRVGIGRPPSQVYVVLDTGSDVSWVQCAPCADCYQQADPIFEPTSSASFAQLS  200



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV--VQPEDLESPVTSG  419
               DY  L  AR+ RD  RV SL  +L +A++ +S ADLKPV T+     ED+E+P+ SG
Sbjct  80   EHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKADLKPVTTMYTTDQEDIEAPLISG  139

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF PA SSSY+ 
Sbjct  140  TTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCSPCADCYHQTEPIFEPASSSSYQP  199

Query  600  VS  605
            +S
Sbjct  200  LS  201



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV--VQPEDLESPVTSG  419
               DY  L  AR+ RD  RV SL  +L +A++ +S ADLKPV T+     ED+E+P+ SG
Sbjct  80   EHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKADLKPVTTMYTTDQEDIEAPLISG  139

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF PA SSSY+ 
Sbjct  140  TTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPASSSSYQP  199

Query  600  VS  605
            +S
Sbjct  200  LS  201



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALS------PTFRDQKKssnss--ssssssfslsvhprssLVRPH  248
            T VLDVSSA+Q T H LS        F ++ +++  S   +SSSSFSL +H R  L +  
Sbjct  35   TTVLDVSSALQQTEHILSFEPETLKPFAEESETAAESFPLNSSSSFSLPLHSREILHKTR  94

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
              DY  L+ +R+ RD+ RV +L  KL +A+  +   +LKP +  + PED  +PV SG SQ
Sbjct  95   HNDYRSLVLSRLERDSARVNTLITKLQLAIYNVDRHELKPAEAQILPEDFSTPVVSGASQ  154

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVG P + F MV+DTGSD+ WLQC+PC++CY Q+DPIF+P  SSSY
Sbjct  155  GSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCTECYQQSDPIFDPKTSSSY  209



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALS------PTFRDQKKssnss--ssssssfslsvhprssLVRPH  248
            T VLDVSSA+Q T H LS        F ++ +++  S   +SSSSFSL +H R  L +  
Sbjct  35   TTVLDVSSALQQTEHILSFEPETLEPFAEESETAAESFPLNSSSSFSLPLHSREILHKTR  94

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
              DY  L+ +R+ RD+ RV +L  KL +A+  +   +LKP +  + PED  +PV SG SQ
Sbjct  95   HNDYRSLVLSRLERDSARVNTLITKLQLAIYNVDRHELKPAEAQILPEDFSTPVVSGASQ  154

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVG P + F MV+DTGSD+ WLQC+PC++CY Q+DPIF+P  SSSY
Sbjct  155  GSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCTECYQQSDPIFDPKTSSSY  209



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALS------PTFRDQKKssnss--ssssssfslsvhprssLVRPH  248
            T VLDVSSA+Q T H LS        F ++ +++  S   +SSSSFSL +H R  L +  
Sbjct  35   TTVLDVSSALQQTEHILSFEPETLEPFAEESETAAESFPLNSSSSFSLPLHSREILHKTR  94

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
              DY  L+ +R+ RD+ RV +L  KL +A+  +   +LKP +  + PED  +PV SG SQ
Sbjct  95   HNDYRSLVLSRLERDSARVNTLITKLQLAIYNVDRHELKPAEAQILPEDFSTPVVSGASQ  154

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+GVG P + F MV+DTGSD+ WLQC+PC++CY Q+DPIF+P  SSSY
Sbjct  155  GSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCTECYQQSDPIFDPKTSSSY  209



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 109/171 (64%), Gaps = 3/171 (2%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYGDL  269
            +T++LDVSS+IQ T +  S            +  SSS  S  +H R ++     +DY  L
Sbjct  26   RTKILDVSSSIQKTHNPFSLDSSLNSLKHEENQISSSLLSFQLHSRVAVRGTSHKDYNSL  85

Query  270  MaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV---VQPEDLESPVTSGVSQGSGE  440
            M AR+ RD+ R  SL  ++ + V G+  +DLKP++T    +Q E++E P+ SG SQGSGE
Sbjct  86   MLARLERDSARAKSLQTRVDLVVQGIGKSDLKPMETEFREIQAEEIEGPIISGTSQGSGE  145

Query  441  YFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            YF+R+G+G P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA SS++
Sbjct  146  YFSRIGIGHPPSQVYMVLDTGSDVNWVQCSPCADCYQQADPIFEPASSSTF  196



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 8/169 (5%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALS---PTFRD-QKKssnssssssssfslsvhprssLVRPHQR  254
            P+T VLDVS+++Q T + LS     F+    K   ++  S +S  LS+HPR +L +P   
Sbjct  32   PKTTVLDVSASLQKTHNVLSFNPEAFQTLHPKEQTTTEPSLASLVLSIHPRHTLHKPTHT  91

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV--QTVVQP--EDLESPVTSGV  422
            DY  L  AR+ RDA RV SL+ K+ +AV G+  +DLKP+  +  VQP  +DLE PV SG+
Sbjct  92   DYKTLTLARLKRDAARVRSLNTKVDLAVKGIKKSDLKPLLMENAVQPSSKDLEGPVISGM  151

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            SQGSGEYF+RLG+G PAK  YMVIDTGSDV W+QC PC+DCY Q DPI+
Sbjct  152  SQGSGEYFSRLGIGVPAKQLYMVIDTGSDVNWVQCAPCTDCYDQADPIY  200



>gb|KEH27070.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=491

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 114/181 (63%), Gaps = 9/181 (5%)
 Frame = +3

Query  75   RAISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRP---  245
            R I+  T +LD+SS+I  T   L+  F     +    + +      +    S L+ P   
Sbjct  30   RIITSHTSLLDISSSIHQTKQVLN--FNPNNINLVEETLNQKPVFSNSSSFSILIHPREN  87

Query  246  ----HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
                + +DY  LM AR+ RD+ RV SL  KL ++++ L   DL PVQT +Q EDL +PV+
Sbjct  88   LLNENHKDYTKLMQARLTRDSARVDSLTTKLELSLNNLKKTDLHPVQTELQQEDLSTPVS  147

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG   GSGEYF+RLG+GQP K +YMV+DTGSDV W+QC+PC++CY QTDPI++P  SS+Y
Sbjct  148  SGSGSGSGEYFSRLGIGQPPKPYYMVLDTGSDVNWIQCKPCTECYQQTDPIYDPTSSSTY  207

Query  594  R  596
            +
Sbjct  208  Q  208



>gb|KFK44545.1| hypothetical protein AALP_AA1G270600 [Arabis alpina]
Length=485

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 120/180 (67%), Gaps = 2/180 (1%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            P+     T  LDV+ +I+ T    S     Q++    S SSSSSF+L +HPR+S+ R   
Sbjct  23   PKISVTTTSTLDVTDSIRRTNEPTSFRLNQQEEDQTHSPSSSSSFTLQLHPRTSIRRTEH  82

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ--PEDLESPVTSGVS  425
            +DY  L  AR+ RD  RV SL  +L +A+S +S A+LKP+ T      +++E+P+ SG +
Sbjct  83   KDYKSLTLARLNRDTARVKSLITRLDLALSNISQANLKPITTTTYTTEQEIEAPLISGTT  142

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PCSDCY QT+PI+ PA SSSY  +S
Sbjct  143  QGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCSDCYHQTEPIYEPASSSSYTTLS  202



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYG  263
            + +T++LDVSS+IQ T +  S            +   SS  S  +H R ++     +DY 
Sbjct  24   TSRTKILDVSSSIQKTHNLFSLDSSLNSLKHEENQVYSSLLSFQLHSRVAVQGTSHKDYD  83

Query  264  DLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV---VQPEDLESPVTSGVSQGS  434
             LM AR+ RD+ R  SL  ++ + V G+  +DLKP++T    +Q E++E P+ SG SQGS
Sbjct  84   SLMLARLERDSARAKSLQTRVDLVVQGIGKSDLKPMETEFREIQAEEIEGPIISGTSQGS  143

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GEYF+R+G+G P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA SS++
Sbjct  144  GEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCSPCADCYQQADPIFEPASSSTF  196



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQP---EDLESPVTS  416
               DY  L  AR+ RD  RV SL  +L +A++ +S ADLKPV T +     ED+E+P+ S
Sbjct  80   EHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKADLKPVITTMYTTDQEDIEAPLIS  139

Query  417  GVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYR  596
            G +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF PA SSSY+
Sbjct  140  GTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPASSSSYQ  199

Query  597  RVS  605
             +S
Sbjct  200  PLS  202



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ---TVVQPEDLES  404
            LV    +DY  L+  R+ RD+ RV+ + AK+ +A+ G+  + L PV    ++++PED+ +
Sbjct  93   LVESQHKDYRSLLLGRLERDSARVSGITAKVRLAIEGVERSKLHPVHDDDSLIRPEDMST  152

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPA  578
            PV SG SQGSGEYF+R+GVG P K+ +MV+DTGSDV W+QCQPCSDCY Q+DP+FNPA
Sbjct  153  PVVSGASQGSGEYFSRVGVGTPPKEMFMVLDTGSDVNWIQCQPCSDCYQQSDPVFNPA  210



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 121/182 (66%), Gaps = 14/182 (8%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS--------PTFRDQKKssnssssssssfslsvhprssLV  239
            S +T VLDV S++Q T   LS         T    K+S     +SSS  SL +H R +LV
Sbjct  32   SHETTVLDVVSSLQQTQQILSIDPTRSSLTTTTAAKESIPVFLNSSSPLSLELHSRDTLV  91

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSG  419
                ++Y  L+ +R+ RD+ RVAS+ AK+ +AV G   AD    +T  QPE+L +PV SG
Sbjct  92   ASQHKNYKSLVLSRLERDSSRVASIIAKVKLAVEG---AD---SETHYQPEELTTPVISG  145

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+RLGVG PAK+ YMV+DTGSD+ W+QC+PCS CY Q+DPIF+P+ SS+Y+ 
Sbjct  146  ASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKS  205

Query  600  VS  605
            ++
Sbjct  206  LT  207



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 14/182 (8%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS--PT------FRDQKKssnssssssssfslsvhprssLV  239
            S +T VLDV S++Q T H LS  PT           +S     +SSS  SL +H R +LV
Sbjct  32   SHETTVLDVVSSLQQTQHILSIDPTRSSLTTTTTTPESVPVFLNSSSPLSLELHSRDTLV  91

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSG  419
                +DY  L+ +R+ RD+ RVAS+ AK+ +AV G   AD    +T   PE+L +PV SG
Sbjct  92   ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEG---AD---SETRYNPEELTTPVISG  145

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+RLGVG PAK+ YMV+DTGSD+ W+QC+PCS CY Q+DPIF+P+ SS+Y+ 
Sbjct  146  ASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKS  205

Query  600  VS  605
            ++
Sbjct  206  LT  207



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 114/192 (59%), Gaps = 34/192 (18%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS------------------PTFRDQKKssnssssssssfs  209
            S +T VLDV S++Q T H LS                  P F +     +    S  +  
Sbjct  32   SHETTVLDVVSSLQQTQHILSIDPTRSSLTTTTSAPESVPVFLNSSSPLSLELHSRDT--  89

Query  210  lsvhprssLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQP  389
                    LV    +DY  L+ +R+ RD+ RVA++ AK+ +AV G   AD    +T  QP
Sbjct  90   --------LVASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEG---AD---SETRYQP  135

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            E+L +PV SG SQGSGEYF+RLGVG PAK+ YMV+DTGSD+ W+QC+PCS CY Q+DPIF
Sbjct  136  EELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIF  195

Query  570  NPAQSSSYRRVS  605
            +P+ SS+Y+ ++
Sbjct  196  DPSSSSTYKSLT  207



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (68%), Gaps = 9/171 (5%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALS--PT----FRDQKKssnssssssssfslsvhprssLVRPHQ  251
            +T +LDV S++  T   LS  PT     R  +  S+    ++SSFSL +H R +L+    
Sbjct  32   ETTILDVVSSLHQTHQILSFHPTRTNINRSPESESDPVFLNASSFSLELHSRETLLESQH  91

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLESPVTSGV  422
            RDY  L+ AR+ RD+ RVA + +K+ +A+ G+  + L+P     T ++PEDL +PV SG 
Sbjct  92   RDYRSLVLARLERDSARVAGIASKVRLAIEGVDRSKLQPAYDDDTRIRPEDLSTPVVSGA  151

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            SQGSGEYF+R+GVG P KD +MV+DTGSDV W+QCQPCSDCY Q+DP+FNP
Sbjct  152  SQGSGEYFSRIGVGTPPKDMFMVLDTGSDVNWIQCQPCSDCYQQSDPVFNP  202



>ref|XP_009800603.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=488

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             RDY  L  AR+ RD+ RV SL  ++ + V  ++ +DLKPV+   Q E+LE P+ SG SQ
Sbjct  88   HRDYNSLTLARLERDSARVKSLQTRVDLVVRRITKSDLKPVEVEFQAEELEGPIISGTSQ  147

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+G+G P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA SS++
Sbjct  148  GSGEYFSRIGIGHPQSQVYMVLDTGSDVNWIQCAPCADCYQQADPIFEPASSSTF  202



>ref|XP_009608744.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             RDY  L  AR+ RD+ RV SL  ++ + V  ++ +DLKPV+   Q E+LE P+ SG SQ
Sbjct  88   HRDYNSLTLARLERDSARVKSLQTRVDLVVQRITKSDLKPVEVEFQAEELEGPIISGTSQ  147

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+G+G P    YMV+DTGSDV W+QC PC+DCY Q DPIF PA SS++
Sbjct  148  GSGEYFSRIGIGHPPNQVYMVLDTGSDVNWIQCAPCADCYQQADPIFEPASSSTF  202



>ref|XP_009336599.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=488

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = +3

Query  81   ISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDY  260
            ++ +T VLDV+++I+ TL ALS      + +   S    SS S+ +H R SL +P   DY
Sbjct  30   LTSKTTVLDVAASIRTTLRALSSE-DTSRTAQALSQQDHSSLSVPLHSRISLHKPSHSDY  88

Query  261  GDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV----VQPEDLESPVTSGVSQ  428
              L  AR+ RD+ RV SL  +L +AV G++ +DLKPV+T     +  +  E P+ SG SQ
Sbjct  89   KSLTLARLERDSARVRSLTTRLDLAVRGVATSDLKPVETGSGLQLDADGFEGPIISGTSQ  148

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GSGEYF+R+G+G+P    Y+V+DTGSD++W+QC PC+DCY Q DPIF PA S+S+  +S
Sbjct  149  GSGEYFSRVGIGKPPSQAYVVLDTGSDISWVQCAPCADCYQQADPIFEPASSTSFSPLS  207



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV---QTVVQPEDLES  404
            LV    +DY  L+ AR+ RD+VRV  + AK+ +AV G+  + L+P+    T +QPEDL +
Sbjct  87   LVESQHKDYRSLVLARLERDSVRVDGITAKVRLAVEGVDRSKLQPIYDEDTRIQPEDLST  146

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPA  578
            PV SG SQGSGEYF+R+G+G P K+ +MV+DTGSDV W+QCQPCS+CY Q+DP+F+PA
Sbjct  147  PVVSGASQGSGEYFSRIGIGNPPKEMFMVLDTGSDVNWIQCQPCSECYQQSDPVFDPA  204



>ref|XP_002529147.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33260.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=479

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +3

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ--PEDLESPVTSGVSQ  428
            DY  L  +R+ RD+ RV S++ +L +A+ GLS +DLKP+ T  Q   EDL+ P+ SG SQ
Sbjct  80   DYRSLTLSRLERDSARVKSINTRLDLAIHGLSTSDLKPLDTDSQFRAEDLQGPIISGTSQ  139

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GSGEYF+R+G+G+P+   YMV+DTGSDV W+QC PC+DCY Q DPIF PA S+SY  +S
Sbjct  140  GSGEYFSRVGIGKPSSPVYMVLDTGSDVNWIQCAPCADCYHQADPIFEPASSTSYSPLS  198



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            P   +  T +L+V+ +I  T +  + +FR  ++   + S+SSS         S     H 
Sbjct  26   PETSTTTTSILNVADSIHRTKY--TSSFRLNQQEEQTHSASSSFSLQLHSRVSVRGTEHS  83

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPE--DLESPVTSGVS  425
             DY  L  AR+ RD  RV SL  +L +A++ +S ADLKP+ T+   E  D+E+P+ SG +
Sbjct  84   -DYKSLTLARLNRDTARVKSLITRLDLAINNISKADLKPISTMYTTEEQDIEAPLISGTT  142

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            QGSGEYF R+G+G+PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF P+ SSSY  +S
Sbjct  143  QGSGEYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPCADCYHQTEPIFEPSSSSSYEPLS  202



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGS  434
            DY  L  AR+ RD+ RV SL A+L +A++ ++ ADLK      + E++E+P+ SG +QGS
Sbjct  85   DYNSLTLARLHRDSARVKSLTARLNLAINNITRADLKHTMYTTEQEEIEAPLISGTTQGS  144

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GEYF R+G+G PA++ YMV+DTGSDV WLQC PC+ CY QT+PIF P  SSSY  +S
Sbjct  145  GEYFTRVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCYHQTEPIFEPTSSSSYATLS  201



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 118/187 (63%), Gaps = 15/187 (8%)
 Frame = +3

Query  75   RAISP---QTQVLDVSSAIQNTLHALSPT-----FRDQKKssnssssssssfslsvhprs  230
            R ++P   +T VLDV+++IQ T +  S       F  Q+K + SS  +    S +     
Sbjct  22   RILTPHPSETTVLDVAASIQRTKNIFSSGPKMSPFNQQEKETTSSELTVELLSRTS----  77

Query  231  sLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT--VVQPEDLES  404
             + +     Y  L  +R+ RD+ RV SL  +L +A++ +S +DLKP++T    +PEDL+S
Sbjct  78   -IQKTTHTGYKSLTLSRLQRDSARVKSLVTRLDLAINSISSSDLKPLETDSEFKPEDLQS  136

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQS  584
            P+ SG SQGSGEYF+R+G+G+P    Y+++DTGSDV W+QC PC+DCY Q DPIF PA S
Sbjct  137  PIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCADCYQQADPIFEPASS  196

Query  585  SSYRRVS  605
            +S+  +S
Sbjct  197  ASFSTLS  203



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +3

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGS  434
            DY  L  AR+ RD+ RV SL A+L +A++ ++ A+LK      + E++E+P+ SG +QGS
Sbjct  85   DYNSLTLARLHRDSTRVKSLTARLNLAINNITRANLKHTMYTTEQEEIEAPLISGTTQGS  144

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GEYF R+G+G PA++ YMV+DTGSDV WLQC PC++CY QT+PIF P  SSSY  +S
Sbjct  145  GEYFTRVGIGSPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIFEPTTSSSYATLS  201



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 5/122 (4%)
 Frame = +3

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-----VVQPEDLESPVTSG  419
            DY  L  AR+ RDA RV S+ A+  +AVSG++ +DLKPV       +   + +E PV SG
Sbjct  102  DYKALTLARLRRDAARVRSIAARAALAVSGVAASDLKPVAEEKAAPIAAADSIEGPVVSG  161

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             S GSGEYF+R+GVG PA+ FYMV+DTGSDV+WLQC PC+DCY QTDP+F+P+ SSSY  
Sbjct  162  TSVGSGEYFSRVGVGSPARPFYMVLDTGSDVSWLQCLPCADCYQQTDPVFDPSASSSYAP  221

Query  600  VS  605
            +S
Sbjct  222  IS  223



>ref|XP_008389306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
 ref|XP_008367019.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=488

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYGDL  269
            +T VLDV ++IQ TL ALS      + +        SS S+ +H R SL  P   DY  L
Sbjct  33   KTTVLDVXASIQTTLRALSAE-DTSRTAQALYQQDHSSLSIPLHSRISLHAPSHSDYKSL  91

Query  270  MaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV----VQPEDLESPVTSGVSQGSG  437
              AR+ RD+ RV SL  +L +AV G++ +DLKPV+T     +  +  E P+ SG SQGSG
Sbjct  92   TLARLERDSARVRSLTXRLDLAVRGVATSDLKPVETGSGLQLDADGFEGPIISGTSQGSG  151

Query  438  EYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            EYF+R+G+G+P    Y+V+DTGSD++W+QC PC+DCY Q DPIF PA S+S+  +S
Sbjct  152  EYFSRVGIGKPPSQAYVVLDTGSDISWVQCAPCADCYQQADPIFEPASSTSFSPLS  207



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 8/176 (5%)
 Frame = +3

Query  87   PQTQVLDVSSAIQNTLHALSPT-------FRDQKKssnssssssssfslsvhprssLVRP  245
            P+T VLDVS +I+ +L+ LS         F+ Q++S  SSSSSSS         S     
Sbjct  31   PRTTVLDVSGSIRESLNVLSLNPQYEQMEFQHQERSFPSSSSSSSLTLSLHSRTSIHKSS  90

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVS  425
            H +DY  L+ AR+ RD+ RV SL  ++ +A++G++ +DLKPV+  ++ E LE+P+ SG S
Sbjct  91   H-KDYKSLVLARLERDSDRVRSLATRMDLAIAGITKSDLKPVEKELEAEALETPLVSGAS  149

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            QGSGEYF+R+G+G P K  YMV+DTGSDV W+QC PC+DCY Q DPIF P+ SSSY
Sbjct  150  QGSGEYFSRVGIGSPPKHVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPSFSSSY  205



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 114/177 (64%), Gaps = 5/177 (3%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfsls-vhprssLVRPHQRDYGD  266
            +T VLDV+++IQ TL ALS       +++ + S    S     +H R SL  P   DY  
Sbjct  34   KTTVLDVAASIQTTLRALSSEGTTASRTAQALSQQDRSSLSVPLHSRISLHAPSHSDYRS  93

Query  267  LMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV----VQPEDLESPVTSGVSQGS  434
            L  AR+ RD+ RV SL  +L +AV G++ +DLKPV T     ++ +  E P+ SG SQGS
Sbjct  94   LTLARLERDSARVRSLTTRLDLAVRGVATSDLKPVVTGNEFQLEAKGFEGPIISGTSQGS  153

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GEYF+R+G+G+P    Y+V+DTGSDV+W+QC PC+DCY Q DPIF PA S+S+  +S
Sbjct  154  GEYFSRVGIGKPPSQAYVVLDTGSDVSWVQCAPCADCYQQADPIFEPASSTSFSPLS  210



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV--VQPEDLESPVTSG  419
               DY  L  AR+ RD  RV SL  +L +A++ +S ADLKPV T+   + ED+E+P+ SG
Sbjct  80   EHSDYKSLTLARLDRDTARVKSLFTRLDLALNNISKADLKPVTTMYTTEQEDIEAPLISG  139

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPA  578
             +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF PA
Sbjct  140  TTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPA  192



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 112/192 (58%), Gaps = 21/192 (11%)
 Frame = +3

Query  72   PRAI--SPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRP  245
            PR+I  +P T  LDVS+++   L  LS    D  ++ +    S      +       +  
Sbjct  28   PRSIGSAPTTATLDVSASLGQALRVLS---FDPDQALDQEMKSFHHGGGAATSGGFTLEL  84

Query  246  HQRD------------YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV----QT  377
            H RD            Y  L  AR+ RD+ RV S+ A+L +A  G+  +DLKP+    + 
Sbjct  85   HSRDFLPTAAQARHTDYKTLTLARLHRDSARVKSIAARLALAAHGVKRSDLKPLAEEKEL  144

Query  378  VVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQT  557
                + ++ P+ SG SQGSGEYF+R+G+G+PAK  YMV+DTGSDVTW+QCQPC+DCY Q+
Sbjct  145  AAMAQAIKGPIVSGTSQGSGEYFSRVGIGKPAKPLYMVLDTGSDVTWVQCQPCTDCYQQS  204

Query  558  DPIFNPAQSSSY  593
            DP+F P+ SSSY
Sbjct  205  DPVFEPSASSSY  216



>ref|XP_008243190.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=556

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  90   QTQVLDVSSAIQNTLHALSPTFRDQK-KssnssssssssfslsvhprssLVRPHQRDYGD  266
            +T VLDV+++IQ TL+ALS     Q     + SSS++SS SL +H R SL +P   DY  
Sbjct  98   KTTVLDVAASIQTTLNALSSESHTQALSQQDRSSSAASSLSLPLHSRISLHKPSHSDYKS  157

Query  267  LMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-----VVQPEDLESPVTSGVSQG  431
            L  AR+ RD+ RV SL  +L +A+ G++ +DLKPV T     + + +  E PV SG SQG
Sbjct  158  LTLARLERDSARVRSLTTRLDLALQGIATSDLKPVDTGDGLELEEAKGFEGPVISGTSQG  217

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            SGEYF+R+G+G+P    Y+V+DTGSDV+W+QC PC++CY Q DPIF P  S S+  VS
Sbjct  218  SGEYFSRVGIGKPPSPAYVVLDTGSDVSWVQCAPCANCYQQADPIFEPTSSDSFSPVS  275



>ref|XP_009103072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=487

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            P+     + +LDVS +I+ T  A S     Q++ S++ S SSSSFSL +H R+S+     
Sbjct  26   PKISVTTSTILDVSDSIRRTKGAPSFQLNQQEEQSHTPSFSSSSFSLQLHSRASVQGNEH  85

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVV---QPEDLESPVTSGV  422
             DY  L  AR+ RD+ RV SL A+L +AV+ ++ ADLKPV T +   + +++E+P+ SG 
Sbjct  86   SDYKSLTLARLDRDSARVKSLMARLDLAVNNITKADLKPVITTMYTTEQQEIEAPLISGT  145

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF P
Sbjct  146  TQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEP  196



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 109/186 (59%), Gaps = 19/186 (10%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD--  257
            +P T   DVS+++   L ALS    D  ++ +    S    S +       +  H RD  
Sbjct  34   APTTATFDVSASLGQALRALS---FDPHQAIDQEMKSFHGRSGAAASSGLTLELHSRDFL  90

Query  258  ----------YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV----QTVVQPED  395
                      Y  L  AR+ RD+ RV S+ A++ +A  G+  +DLKP+    +       
Sbjct  91   PTAAQARHTDYRALTLARLHRDSARVKSIAARVALAAHGVKRSDLKPLAEEKELAASERA  150

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            ++ P+ SG SQGSGEYF+R+G+G PAK FYMV+DTGSDVTW+QCQPC+DCY Q+DP+F+P
Sbjct  151  IKGPIVSGTSQGSGEYFSRVGIGNPAKPFYMVLDTGSDVTWVQCQPCTDCYQQSDPVFDP  210

Query  576  AQSSSY  593
            + SSSY
Sbjct  211  SASSSY  216



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVR--PHQRDYGD  266
            + +LDV+ +I+ T  A S     Q+  S + S SSSS         + VR   H  DY  
Sbjct  33   SSILDVTDSIRKTKDASSFQLNKQEDQSLTHSPSSSSAFTLQLHSRASVRGAEHHSDYKS  92

Query  267  LMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTV-VQPEDLESPVTSGVSQGSGEY  443
            L  AR+ RD+ RV SL A+L +A++ +S +DLKP+ T     +D+E+P+ SG +QGSGEY
Sbjct  93   LTLARLERDSARVKSLMARLDLAINNISKSDLKPISTTYTTQQDIEAPLISGTTQGSGEY  152

Query  444  FARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            F R+G+G PA++ YMV+DTGSDV WLQC PC++CY QT+PIF
Sbjct  153  FTRVGIGNPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIF  194



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHAL--SPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            S +T +LDV S++QN  +A+  +P   +Q +    +   SSSF + +  R+S+ +P  RD
Sbjct  26   SSKTTLLDVVSSLQNAHNAVAFTPHHLNQHQRQQEALLLSSSFGIHLRSRASIQKPSHRD  85

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPED--LESPVTSGVSQG  431
            Y  L  +R+ARD+ RV SL  +L + +  +S +DL P ++  + E   L+ PV SG SQG
Sbjct  86   YKSLTLSRLARDSARVKSLQTRLDLVLKRVSNSDLHPAESNAEFEANALQGPVVSGTSQG  145

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGEYF R+G+G+P    Y+V+DTGSDV+W+QC PCS+CY Q+DPIF+P  S+SY
Sbjct  146  SGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPVSSNSY  199



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 118/182 (65%), Gaps = 11/182 (6%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNT--LHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +P+T VLDV+++IQ T  + A+ P           + S SSS SL ++ R S+++    D
Sbjct  27   TPRTSVLDVAASIQRTQQIFAMEP---KSSTPDEITVSDSSSLSLQLNSRISVMKTSHSD  83

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQ------TVVQPEDLESPVTSG  419
            Y  L  +R+ RD+ RV SL A++ +A+ G++  DL+P+       +    ED ESP+ SG
Sbjct  84   YKSLTLSRLKRDSARVKSLTARIDLAIRGITGTDLEPLGNGDGGGSQFGAEDFESPIVSG  143

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+R+G+G+P    YMV+DTGSDV+W+QC PC++CY QTDPIF P  S+S+  
Sbjct  144  ASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASFTS  203

Query  600  VS  605
            +S
Sbjct  204  LS  205



>gb|EYU19035.1| hypothetical protein MIMGU_mgv1a021892mg [Erythranthe guttata]
Length=465

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  375  TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQ  554
            TV +PE L+SPV+SG SQGSGEYFAR+GVGQPA  +YM IDTGSDV+WLQC PCSDCY Q
Sbjct  107  TVRRPEQLQSPVSSGTSQGSGEYFARIGVGQPANQYYMAIDTGSDVSWLQCDPCSDCYQQ  166

Query  555  TDPIFNPAQSSSYR  596
            TDPI+ P+ SS+Y+
Sbjct  167  TDPIYKPSSSSTYK  180



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 116/182 (64%), Gaps = 11/182 (6%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNT--LHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +P T VLDV+++IQ T  + A+ P          ++ S  SS SL ++ R S+++    D
Sbjct  27   TPTTSVLDVAASIQRTQQVFAVEP---KSSTPDETTVSDPSSLSLQLNSRISVMKASHSD  83

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ------PEDLESPVTSG  419
            Y  L  +R+ RD+ RV SL A++ +A+ G++  DL+P+            ED ESP+ SG
Sbjct  84   YKSLTLSRLKRDSARVRSLTARIDLAIRGITGTDLEPLGNGGGGGSQFGTEDFESPIVSG  143

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+R+G+G+P    YMV+DTGSDV+W+QC PC++CY QTDPIF P  S+S+  
Sbjct  144  ASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASFTS  203

Query  600  VS  605
            +S
Sbjct  204  LS  205



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 114/186 (61%), Gaps = 20/186 (11%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLH--ALSPTFRDQKKssnssssssssfslsvhprssLVRPHQR----  254
            T  L+V++++Q T H  +LS T   Q+++   S+      S S+      VR H R    
Sbjct  32   TTTLNVAASLQATRHVFSLSSTAEQQEQAELESAGEEEGSSKSLLT----VRLHPREAVK  87

Query  255  -----DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV-----QTVVQPEDLES  404
                 DY  L AAR+ RDA RV  + A++ +A  G+  ++++P+     +       +E 
Sbjct  88   PSGHEDYAALTAARLRRDAARVRGISARVALAAKGVKHSEMEPLIEEDEEASEAASGIEG  147

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQS  584
            PV SG+ QGSGEYF+R+G+GQPA + YMV+DTGSDV+W+QC+PCSDCY Q DP+FNP  S
Sbjct  148  PVVSGMQQGSGEYFSRVGIGQPAHEQYMVLDTGSDVSWVQCEPCSDCYDQADPVFNPTSS  207

Query  585  SSYRRV  602
            SSYR V
Sbjct  208  SSYRAV  213



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ--PEDLESPVT  413
            +    DY  L  AR+ RD+ RV SL  +L + + G S +DLKP+ + ++   EDL+ P+ 
Sbjct  80   KTSHTDYKSLTLARLQRDSARVRSLTTRLDLVIQGFSTSDLKPLGSDLEFKAEDLQGPIV  139

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SG SQGSGEYF+R+G+G+P    Y+V+DTGSDV WLQC PC+DCY Q DPIF PA S+SY
Sbjct  140  SGTSQGSGEYFSRVGIGKPPSSVYLVLDTGSDVNWLQCAPCADCYQQADPIFEPASSTSY  199



>emb|CDO98452.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = +3

Query  234  LVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVT  413
            +V+PH ++Y  L  +R+A D+ RV S++ KL + +S          Q ++QPEDL+SPVT
Sbjct  93   VVKPHHQNYSALTVSRLAYDSARVNSINYKLQLPISQTVH------QRLIQPEDLQSPVT  146

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSS  590
            SG SQG+ EY AR+G+G+P K+F+M IDTGSDV+WLQCQPC  CY Q+DPIFNP+ S S
Sbjct  147  SGESQGTFEYLARVGLGRPVKEFFMSIDTGSDVSWLQCQPCDSCYQQSDPIFNPSGSVS  205



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 82/122 (67%), Gaps = 4/122 (3%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV----QTVVQPEDLESP  407
             P   DY  L   R+ RD+ RV S+ A+L +A   +   DLKPV    +     E +  P
Sbjct  97   HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAAHSVKRTDLKPVAEEKEFAASAESIRGP  156

Query  408  VTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSS  587
            + SG SQGSGEYF+R+G+G P K  YMV+DTGSDVTW+QCQPC+DCY Q+DPIF+P+ SS
Sbjct  157  IVSGTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQPCADCYEQSDPIFDPSASS  216

Query  588  SY  593
            SY
Sbjct  217  SY  218



>ref|XP_002890686.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66945.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +3

Query  72   PRAISPQTQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            P+     T +L+V+ +I  T +  + +FR  ++   + S SSS         S     H 
Sbjct  28   PKTSVTTTSILNVADSIHRTKY--TSSFRLNQQEEQTHSRSSSFSLQLHSRVSVRGTEHS  85

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPE---DLESPVTSGV  422
             DY  L  AR+ RD  RV SL  +L +A++ +S ADLKPV T+       D+E+P+ SG 
Sbjct  86   -DYKSLTLARLNRDTARVKSLITRLDLAINNISKADLKPVTTMYTTTEEEDIEAPLISGT  144

Query  423  SQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF P+ SSSY  +
Sbjct  145  TQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCTPCADCYHQTEPIFEPSSSSSYEPL  204

Query  603  S  605
            S
Sbjct  205  S  205



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 115/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHAL-SPTFRDQKKssnssssssssfslsvhprssLVRPHQRDY  260
            +P+T +LDV S++QN  +A+ SP +   ++   +S  SS S  L       + +P   DY
Sbjct  28   TPKTTLLDVVSSLQNAHNAVVSPHYHPLQRQEETSLLSSFSVQLHSRAS--IQKPSHSDY  85

Query  261  GDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPED--LESPVTSGVSQGS  434
              L  +R+ARD+ RV +L  +L +A++ +S +DL P ++  + E   L+ P+ SG SQGS
Sbjct  86   KSLTLSRLARDSARVRALQTRLDLALNRVSNSDLHPAESRSEFEANALQGPIVSGTSQGS  145

Query  435  GEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GEYF R+G+G+P    Y+V+DTGSDV+W+QC+PCS+CY Q+DPIF+P  SSSY
Sbjct  146  GEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCEPCSECYQQSDPIFDPLSSSSY  198



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 115/182 (63%), Gaps = 11/182 (6%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNT--LHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +P T VLDV+++IQ T  + A+ P          ++ S  SS SL ++ R S+++    D
Sbjct  27   TPTTSVLDVAASIQRTQQVFAVEP---KSSTPDETTVSDPSSLSLQLNSRISVMKASHSD  83

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ------PEDLESPVTSG  419
            Y  L  +R+ RD+ RV SL A++ +A+ G++  DL+P+            ED ESP+ SG
Sbjct  84   YKSLTLSRLKRDSARVRSLTARIDLAIRGITGTDLEPLGNGGGGGSQFGTEDFESPIVSG  143

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRR  599
             SQGSGEYF+R+G+G+P    YMV+DTGSDV+W+QC PC++CY QTDP F P  S+S+  
Sbjct  144  ASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPXFEPTSSASFTS  203

Query  600  VS  605
            +S
Sbjct  204  LS  205



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 111/177 (63%), Gaps = 15/177 (8%)
 Frame = +3

Query  75   RAISPQ---TQVLDVSSAIQNTLHALSPT-----FRDQKKssnssssssssfslsvhprs  230
            R ++PQ   T VLDV+++IQ T +  S       F  Q+K + SS  +    S +     
Sbjct  22   RILAPQPSETTVLDVAASIQRTKNIFSSGPKMSPFNQQEKETTSSELTVELLSRTS----  77

Query  231  sLVRPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT--VVQPEDLES  404
             + +    DY  L  +R+ RD+ RV SL  +L +A++ +S +DLKP++T    + EDL+S
Sbjct  78   -IQKTTHTDYKSLTLSRLQRDSARVKSLVTRLDLAINSISSSDLKPLETDSEFKSEDLQS  136

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            P+ SG SQGSGEYF+R+G+G+P    Y+++DTGSDV W+QC PC++CY Q DPIF P
Sbjct  137  PIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCAECYQQADPIFEP  193



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 5/103 (5%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKP-----VQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPA  473
            S++A++ +A  G+S A++KP     +      +D  S + SG++QGSGEYF RLGVG P 
Sbjct  104  SINARVQLAAMGVSKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPP  163

Query  474  KDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            +  YMV+DTGSD+ W+QC PC+ CY QTDP+FNPA SS+YR+V
Sbjct  164  RYTYMVLDTGSDIMWIQCLPCAKCYGQTDPLFNPAASSTYRKV  206



>ref|XP_010105777.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC06062.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-----VVQPEDLES  404
            +P   DY  L  AR+ RD+ RV SL  +L + + G+S +DLKP +T      +  E++++
Sbjct  86   KPTHGDYKSLTLARLKRDSTRVRSLTTRLDLKLGGISHSDLKPAETGKESAELAAEEVQA  145

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            PV SG SQGSGEYF R+G+G PA   YMV+DTGSDV W+QC PC+DCY QTDPIF P
Sbjct  146  PVISGTSQGSGEYFCRIGIGNPASQVYMVVDTGSDVNWVQCAPCADCYEQTDPIFQP  202



>ref|XP_010527532.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=484

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVS  425
              RDY  L  +R+ RD+ RV SL  +L  AV+G S ADL    T  +   +E PV SG S
Sbjct  87   EHRDYRTLTLSRLERDSARVRSLVTRLGQAVNGASLADLMAKTTTAE---IEGPVVSGTS  143

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            QGSGEYF+R+G+G P +  YMVIDTGSDV WLQC PC+DCY Q DPIF+P  SSSY  +S
Sbjct  144  QGSGEYFSRVGIGNPPRQVYMVIDTGSDVNWLQCAPCADCYQQADPIFDPLSSSSYAPLS  203



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 105/178 (59%), Gaps = 8/178 (4%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALS----PTFRDQKKssnssssssssfslsvhprssLVRPHQ  251
            +P T   DVS+++   L  LS         + KS  ++S   +    S     +  +P  
Sbjct  35   APTTATFDVSASLDQALRVLSFDPHQALDQEAKSVRATSGGLTLELHSRDFLPTNAQPRP  94

Query  252  RDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPED----LESPVTSG  419
             DY  L   R+ RD+ RV S+ A+L +A  G+  +DLKPV    + E     +  P+ SG
Sbjct  95   TDYKALTLDRLRRDSTRVKSIAARLALAAHGVKRSDLKPVTEEEEFEASAEAIRGPIVSG  154

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
             SQGSGEYF+R+G+G P K  YMV+DTGSDVTW QCQPC+DCY Q+DP+F+P+ SSSY
Sbjct  155  TSQGSGEYFSRVGIGSPPKPLYMVLDTGSDVTWAQCQPCADCYQQSDPVFDPSASSSY  212



>gb|KJB50738.1| hypothetical protein B456_008G185200 [Gossypium raimondii]
Length=495

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQ--PEDLESPVT  413
            +    DY  L  +R+ RD+ RV+SL  +L +AV+G+S +DLKP+ T ++  PEDLE P+ 
Sbjct  90   KSSHLDYKALTLSRLQRDSARVSSLVTRLNLAVNGISRSDLKPLDTGLEFGPEDLEGPIV  149

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            SG SQGSGEYF+R+G+G+P    YMV+DTGSDV W+QC PC+DCY Q+DPIF
Sbjct  150  SGSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWVQCAPCADCYQQSDPIF  201



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +3

Query  342  GLSPADLKPVQTV----VQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSD  509
            G+S ADL+P            +++ PV SGV QGSGEYF+R+GVG+PA+  YMV+DTGSD
Sbjct  126  GISRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSRVGVGRPARQLYMVLDTGSD  185

Query  510  VTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            VTWLQCQPC+DCY+Q+DP+++P+ S+SY  V
Sbjct  186  VTWLQCQPCADCYAQSDPVYDPSVSTSYATV  216



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +3

Query  342  GLSPADLKPVQTV----VQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSD  509
            G+S ADL+P            +++ PV SGV QGSGEYF+R+GVG+PA+  YMV+DTGSD
Sbjct  129  GVSRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSRVGVGRPARQLYMVLDTGSD  188

Query  510  VTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            VTWLQCQPC+DCY+Q+DP+++P+ S+SY  V
Sbjct  189  VTWLQCQPCADCYTQSDPVYDPSVSASYAAV  219



>ref|XP_011072934.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=510

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  372  QTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYS  551
            + V QP+  ESP+ SG+  GSGEYFAR+GVG+P K+FYMVIDTGSDV+WLQCQPC DCY 
Sbjct  150  KAVRQPDQFESPLISGIELGSGEYFARIGVGRPVKEFYMVIDTGSDVSWLQCQPCYDCYQ  209

Query  552  QTDPIFNPAQSSSYRRVS  605
            Q DPIF+ + SS+Y+ +S
Sbjct  210  QADPIFDASASSTYKPLS  227



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  84   SPQTQVLDVSSAIQNTLHALSPTFR--DQKKssnssssssssfslsvhprssLVRPHQRD  257
            SPQT +LDV S++QN  + ++ T    ++ +    SS  +SSF + +H R+S+ +    D
Sbjct  26   SPQTTLLDVVSSLQNAHNVVAFTHHHPNKHQRQQESSLLTSSFGIQLHSRASIQKSSHSD  85

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPED--LESPVTSGVSQG  431
            Y  L  +R+ARD+ RV +L  +L + +  +S +DL P ++  + E   L+ PV SG SQG
Sbjct  86   YKSLTLSRLARDSARVKALQTRLDLFLKRVSNSDLHPAESKAEFESNALQGPVVSGTSQG  145

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            SGEYF R+G+G+P    Y+V+DTGSDV+W+QC PCS+CY Q+DPIF+P  S+SY
Sbjct  146  SGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPISSNSY  199



>gb|EPS61272.1| hypothetical protein M569_13524, partial [Genlisea aurea]
Length=489

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQR-----D  257
            T VLDVSSAI  T   L      +++     SSSSSS           VR  +R     D
Sbjct  30   TAVLDVSSAISRTQQLLEAEKNARREKHAVESSSSSSSLSFKLHSRFSVRGGRRRSSGKD  89

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPV--QTVVQPEDLESPVTSGVSQG  431
            Y  +  AR+ARD+ RV ++  ++ +   G+  ADL P+  +  V  E L  PVTSG SQG
Sbjct  90   YKAVTEARLARDSARVRAIQIRVDLVSLGIRKADLVPLGEEGGVWDEKLAGPVTSGTSQG  149

Query  432  SGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            SGEYF R+G+G P K  Y+V+DTGSDV W+QC PCSDCY Q DPIF+P+ SSS+ R++
Sbjct  150  SGEYFCRVGIGNPPKPTYLVLDTGSDVNWVQCAPCSDCYQQADPIFDPSLSSSFSRLT  207



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT---VVQPEDLESPV  410
            + ++  Y + M  R+ RDA RVA+++++L +AV+G+  + LKP  +    +   D +SPV
Sbjct  75   KNNELSYAERMQQRLKRDAARVAAINSRLELAVNGIKRSSLKPDSSSSFTMAESDFQSPV  134

Query  411  TSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSS  590
             SG+ QGSGEYF+R+GVG P +D  MV+DTGSDVTW+QC+PCSDCY Q+DPI+NPA SSS
Sbjct  135  VSGMDQGSGEYFSRIGVGAPRRDQLMVLDTGSDVTWIQCEPCSDCYQQSDPIYNPALSSS  194

Query  591  YRRV  602
            Y+ V
Sbjct  195  YKLV  198



>gb|EYU40867.1| hypothetical protein MIMGU_mgv1a023461mg [Erythranthe guttata]
Length=479

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  342  GLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWL  521
            G++ ADL P+++    E LE PV SG SQGSGEYF R+G+G P+   YMV+DTGSDV W+
Sbjct  110  GITKADLTPLESEFGEEKLEGPVMSGTSQGSGEYFCRVGIGHPSTQAYMVLDTGSDVNWV  169

Query  522  QCQPCSDCYSQTDPIFNPAQSSSY  593
            QC PC+DCY Q DPI++P  SSS+
Sbjct  170  QCAPCADCYQQADPIYDPGLSSSF  193



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +3

Query  330  VAVSGLSPADLKPVQ---TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDT  500
            +A  G++  DL+P            ++ PV SGV QGSGEYF+R+G+G PA+  YMV+DT
Sbjct  126  LAADGVTRLDLRPANGSAVFAASAAIQGPVVSGVGQGSGEYFSRVGIGSPARQLYMVLDT  185

Query  501  GSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GSDVTW+QCQPC+DCY Q+DP+F+P+ S+SY  VS
Sbjct  186  GSDVTWVQCQPCADCYQQSDPVFDPSLSASYAAVS  220



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +3

Query  333  AVSGLSPADLKPVQTVVQPED---LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTG  503
            +  GL P+D  P+ +         L+ PV SGV QGSGEYF+R+G+G PA+  YMV+DTG
Sbjct  146  SAGGLIPSDQTPIFSASAASAAALLQGPVVSGVGQGSGEYFSRIGIGSPARQLYMVLDTG  205

Query  504  SDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            SDVTWLQC PC+DCY+Q+DP+F+PA SSSY  V
Sbjct  206  SDVTWLQCAPCADCYAQSDPLFDPALSSSYATV  238



>ref|XP_002457394.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
 gb|EES02514.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
Length=509

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  345  LSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQ  524
            L PA+   V        ++ PV SGV QGSGEYF+R+G+G PA++ YMV+DTGSDVTW+Q
Sbjct  137  LRPANESAVFGASLAAAIQGPVVSGVGQGSGEYFSRVGIGSPARELYMVLDTGSDVTWVQ  196

Query  525  CQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            CQPC+DCY Q+DP+F+P+ S+SY  VS
Sbjct  197  CQPCADCYQQSDPVFDPSLSASYAAVS  223



>emb|CDY03848.1| BnaC07g10730D [Brassica napus]
Length=485

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  237  VRPHQR-DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVV---QPEDLES  404
            VR ++  DY  L  AR+ RD+ RV  L A+L +A + +S ADLKPV T +   + +++E+
Sbjct  78   VRGNEHPDYKSLTLARLDRDSARVKFLMARLDLATNNISKADLKPVITTMYTTEQQEIEA  137

Query  405  PVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            P+ SG +QGSGEYF  +G+G PA++ YMV+DTGSDV WLQC PC+DCY QT+PIF
Sbjct  138  PLISGTTQGSGEYFTSVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIF  192



>ref|XP_009380958.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=523

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +3

Query  255  DYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQT-----VVQPEDLESPVTSG  419
            DY  L  AR+ RDA RV S+ A+  +AV G++ +DLKP+       +   + +E PV SG
Sbjct  97   DYKALTLARLRRDAARVRSIAARAALAVGGVAASDLKPIAEEKALPIAAADSIEGPVVSG  156

Query  420  VSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
             S GSGEYF+R+GVG PAK  YMV+DTGSDV+W+QC PC+DCY QTDP+F+P+ SSSY
Sbjct  157  TSLGSGEYFSRVGVGSPAKPLYMVLDTGSDVSWIQCAPCADCYQQTDPVFDPSASSSY  214



>ref|XP_007046283.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY02115.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=489

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +3

Query  240  RPHQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKP--VQTVVQPEDLESPVT  413
            +    DY  L  +R+ RD+ RV SL  +L +AV+G+S +DL+P  + +    E++E P+ 
Sbjct  85   KSSHLDYKSLTLSRLKRDSGRVRSLTTRLDLAVNGISRSDLEPLDIGSEFSAEEMEGPIV  144

Query  414  SGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            SG SQGSGEYF+R+G+G+P    YMV+DTGSDV W+QC PC+DCY Q DPIF P
Sbjct  145  SGSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWVQCAPCADCYQQADPIFEP  198



>gb|EAY72465.1| hypothetical protein OsI_00321 [Oryza sativa Indica Group]
Length=343

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +3

Query  342  GLSPADLKPVQTVV---QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDV  512
            G+S  DL P           +++ PV SGV  GSGEYF+R+GVG PA+  YMV+DTGSDV
Sbjct  131  GVSRFDLVPANVTAFEASAAEIQGPVVSGVGLGSGEYFSRVGVGSPARQLYMVLDTGSDV  190

Query  513  TWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            TW+QCQPC+DCY Q+DP+F+P+ S+SY  V+
Sbjct  191  TWVQCQPCADCYQQSDPVFDPSLSTSYASVA  221



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = +3

Query  342  GLSPADLKPVQTVVQPED----LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSD  509
            G++  DL+P             ++ PV SGV QGSGEYF+R+G+G PA+  YMV+DTGSD
Sbjct  140  GVTRLDLRPANASAVFAASAAAIQGPVVSGVGQGSGEYFSRVGIGSPARQLYMVLDTGSD  199

Query  510  VTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            VTW+QCQPC+DCY Q+DP+F+P+ S+SY  VS
Sbjct  200  VTWVQCQPCADCYQQSDPVFDPSLSASYAAVS  231



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +3

Query  342  GLSPADLKPVQTVV---QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDV  512
            G+S  DL P           +++ PV SGV  GSGEYF+R+GVG PA+  YMV+DTGSDV
Sbjct  131  GVSRFDLVPANVTAFEASAAEIQGPVVSGVGLGSGEYFSRVGVGSPARQLYMVLDTGSDV  190

Query  513  TWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            TW+QCQPC+DCY Q+DP+F+P+ S+SY  V+
Sbjct  191  TWVQCQPCADCYQQSDPVFDPSLSTSYASVA  221



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +3

Query  342  GLSPADLKPVQTVV---QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDV  512
            G+S  DL P           +++ PV SGV  GSGEYF+R+GVG PA+  YMV+DTGSDV
Sbjct  127  GVSRFDLVPANVTAFEASAAEIQGPVVSGVGLGSGEYFSRVGVGSPARQLYMVLDTGSDV  186

Query  513  TWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            TW+QCQPC+DCY Q+DP+F+P+ S+SY  V+
Sbjct  187  TWVQCQPCADCYQQSDPVFDPSLSTSYASVA  217



>ref|XP_008791253.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Phoenix 
dactylifera]
Length=495

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             RDY  L  AR+ RD+ RV S+ A++  A+ G   ++ KP +  V  + ++  + SG SQ
Sbjct  95   HRDYESLTLARLRRDSARVRSIAARVAFAIDG---SNSKPAKAAVMLDSIQGTIVSGNSQ  151

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            GSGEYF+R+G+G+PAK  +MV+DTGSD+ W+QCQPC+DCY Q DPI++P  S +Y
Sbjct  152  GSGEYFSRVGIGRPAKPQFMVLDTGSDINWVQCQPCTDCYKQADPIYDPTGSDTY  206



>ref|XP_007225636.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
 gb|EMJ26835.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
Length=540

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (64%), Gaps = 14/176 (8%)
 Frame = +3

Query  81   ISPQTQVLDVSSAIQNTLHALS-PTFRDQKKssnssssssssfslsvhprssLVRPHQRD  257
            +S +T VLDV+++I  TL+ALS  +        + SSS++SS SL +H R SL +P   D
Sbjct  97   LSSKTTVLDVAASIHTTLNALSSESHTQALSQQDQSSSAASSLSLPLHSRISLHKPSHSD  156

Query  258  YGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSG  437
            Y  L  AR+ RD+ RV SL  +L +A+ G++ +DLKPV T             G  QGSG
Sbjct  157  YKSLTLARLERDSARVRSLTTRLDLALQGIATSDLKPVDT-------------GNGQGSG  203

Query  438  EYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            EYF+R+G+G+P    Y+V+DTGSDV+W+QC PC+DCY Q +PIF P  S S+  +S
Sbjct  204  EYFSRVGIGKPPSPAYVVLDTGSDVSWVQCAPCADCYQQAEPIFEPTSSDSFSPLS  259



>emb|CBI27051.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +3

Query  360  LKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCS  539
            L  ++T+   E LE+P+ SG SQGSGEYF+R+G+G P K  YMV+DTGSDV W+QC PC+
Sbjct  28   LFSIKTIA--EALETPLVSGASQGSGEYFSRVGIGSPPKHVYMVVDTGSDVNWVQCAPCA  85

Query  540  DCYSQTDPIFNPAQSSSY  593
            DCY Q DPIF P+ SSSY
Sbjct  86   DCYQQADPIFEPSFSSSY  103



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            DL  PVTSG+  GSGEYF RLGVG PA+  +MV+DTGSD+ WLQCQPC  CY Q DPIF+
Sbjct  113  DLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVVDTGSDLPWLQCQPCKSCYKQADPIFD  172

Query  573  PAQSSSYRRV  602
            P  SSS++R+
Sbjct  173  PRNSSSFQRI  182



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + ED  S V SG+ QGSGEYF R+GVG PA+  YMVID+GSD+ W+QCQPCS CY QTDP
Sbjct  163  EVEDFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQTDP  222

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+SY  VS
Sbjct  223  VFDPADSASYEFVS  236



>ref|XP_002978584.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
 gb|EFJ20570.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
Length=407

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            DL  PVTSG+  GSGEYF RLG+G PA+  +MV+DTGSD+ WLQCQPC  CY Q DPIF+
Sbjct  38   DLNGPVTSGLLYGSGEYFVRLGLGTPARSLFMVVDTGSDLPWLQCQPCKSCYKQADPIFD  97

Query  573  PAQSSSYRRV  602
            P  SSS++R+
Sbjct  98   PRNSSSFQRI  107



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYM  488
            SL  K +  ++ +S       +T   P      V SG+SQGSGEYF RLGVG PA + YM
Sbjct  92   SLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYM  151

Query  489  VIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            V+DTGSDV WLQC PC  CY+Q+DP+FNPA+S+++  V
Sbjct  152  VLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATV  189



>ref|XP_010695864.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
            L SP+ SG+SQGSGEYF+R+G+GQPA++ Y++IDTGSD++W+QC+PC+ CY Q DPIF+P
Sbjct  128  LRSPIISGISQGSGEYFSRVGIGQPAREIYVIIDTGSDLSWVQCEPCTQCYIQPDPIFDP  187

Query  576  AQSSSY  593
            +QS+S+
Sbjct  188  SQSTSF  193



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYM  488
            SL  K +  ++ +S       +T   P      V SG+SQGSGEYF RLGVG PA + YM
Sbjct  92   SLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYM  151

Query  489  VIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            V+DTGSDV WLQC PC  CY+Q+DP+FNPA+S+++  V
Sbjct  152  VLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATV  189



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +3

Query  246  HQRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVS  425
              RDY  L  AR+ RD+ RV SL  +L +AVS +SPA L   +T      +  PV SG S
Sbjct  114  EHRDYRTLTLARLERDSARVRSLTTRLDLAVSRVSPAAL---ETRDGGAKINGPVVSGTS  170

Query  426  QGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            QGSGEYF+R+G+G P +  YMV+DTGSDV WLQC PC+DCY Q+DP+F+
Sbjct  171  QGSGEYFSRVGIGNPPRQVYMVLDTGSDVNWLQCSPCADCYQQSDPLFD  219



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  DAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVI  494
            DA  + +++ L+ A  +  +T  +     S V SG++QGSGEYF RLGVG PA+  +MV+
Sbjct  107  DASRVKSLTSLAAATGRTNRTRARGPGFSSSVISGLAQGSGEYFTRLGVGTPARYVFMVL  166

Query  495  DTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            DTGSD+ W+QC PC  CYSQTDP+FNP +S S+  +
Sbjct  167  DTGSDIVWIQCAPCKKCYSQTDPVFNPTKSRSFANI  202



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  DAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVI  494
            DA  + +++ L+ A     +T  +     S VTSG++QGSGEYF RLGVG PA+  +MV+
Sbjct  105  DASRVKSLTSLAAAVGSTNRTRARGPGFSSSVTSGLAQGSGEYFTRLGVGTPARYVFMVL  164

Query  495  DTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            DTGSDV W+QC PC  CYSQTDP+FNP +S S+  +
Sbjct  165  DTGSDVVWIQCAPCKKCYSQTDPVFNPTKSRSFANI  200



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +3

Query  336  VSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVT  515
            V+GL+             ED  S V SG+ +GSGEYF R+GVG P ++ YMVID+GSD+T
Sbjct  72   VAGLTRRLAASTGLAYSSEDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDIT  131

Query  516  WLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            W+QCQPCS CY Q DP+F+PAQS+S+  + 
Sbjct  132  WVQCQPCSQCYHQADPVFDPAQSASFYSIG  161



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            +D  S V SG+ QGSGEYF R+GVG P ++ YMVID+GSD+ W+QCQPC  CY Q+DP+F
Sbjct  108  DDFGSDVVSGMDQGSGEYFVRIGVGSPPRNQYMVIDSGSDMVWVQCQPCKLCYKQSDPVF  167

Query  570  NPAQSSSYRRVS  605
            +PA+S+SY  VS
Sbjct  168  DPAESASYTGVS  179



>ref|XP_008453383.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=488

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  93   TQVLDVSSAIQNTLHALSPTFRDQKKssnssssssssfslsvhprssLVRPHQRDYGDLM  272
            T   DVS++I   L+ALS      K     S  S+S  SLS+HPR ++  P  +DYG L+
Sbjct  37   TTTFDVSASINQALNALS---IKPKPFQTHSYHSNSPLSLSLHPRLTVHNPSYKDYGTLV  93

Query  273  aarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFAR  452
             AR+AR A RV SL+ KL ++++G      K +        L +PVTSG S G GEYFAR
Sbjct  94   RARLARHATRVQSLNRKLELSLNGAKQFG-KRINGSASTNSLTAPVTSGASHGDGEYFAR  152

Query  453  LGVGQPAKDFYMVIDTGSDVTWLQCQPCSD---CYSQTDPIFNP  575
            +GVGQP + F++V DTGSDVTWLQC+PC++   C+ Q DPIF+P
Sbjct  153  IGVGQPVQSFFLVPDTGSDVTWLQCKPCANENACFKQLDPIFDP  196



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 5/102 (5%)
 Frame = +3

Query  315  DAKLMVAVSGLSPADLK-----PVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKD  479
            DA    A+S L+ A++          VV   D  S VTSG++QGSGEYF RLGVG P K 
Sbjct  122  DAARAKALSDLAAANITVGRRGGGHHVVGSRDFSSSVTSGLAQGSGEYFTRLGVGTPPKY  181

Query  480  FYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
             YMV+DTGSDV W+QC PC  CY+Q+DP+F+P +S+S+  VS
Sbjct  182  AYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSTSFLGVS  223



>ref|XP_002964789.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
 gb|EFJ33627.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
Length=390

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  VTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSS  587
            V+SG+S GSGEYFAR+G+G P + +Y+ +DTGSDVTW+QC PCS CYSQ DPI++P+ SS
Sbjct  34   VSSGLSLGSGEYFARMGIGSPQRSYYLELDTGSDVTWIQCAPCSSCYSQVDPIYDPSNSS  93

Query  588  SYRRV  602
            SYRRV
Sbjct  94   SYRRV  98



>ref|XP_008393394.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=179

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  381  VQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTD  560
            +QP+DL +PV +GV+QG+ + F+R+GV  PAK FYMV+DTGSD+ WLQC PCS+ Y Q+D
Sbjct  5    IQPQDLSTPVNTGVNQGNDKNFSRIGVRTPAKSFYMVLDTGSDINWLQCGPCSNSYQQSD  64

Query  561  PIFNPAQSSSYRRVS  605
            P+ NPA SS+Y +++
Sbjct  65   PVXNPAGSSTYSQLT  79



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +3

Query  315  DAKLMVAVSGLSPADLKPVQTVVQPE----DLESPVTSGVSQGSGEYFARLGVGQPAKDF  482
            DA    A+S L+ A+    +   +P     D  S V SG+SQGSGEYF R+GVG P+K  
Sbjct  113  DAYRAKAISDLASANATVGRRAGKPHPGGRDFSSSVVSGLSQGSGEYFTRIGVGTPSKYV  172

Query  483  YMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            YMV+DTGSDV W+QC PC  CY+Q+DP+F+P++SSS+  V+
Sbjct  173  YMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVA  213



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  345  LSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQ  524
            L+ A   P   V       S V SG++QGSGEYFAR+G+G PA+  YMV+DTGSDV WLQ
Sbjct  115  LAVATAPPAANVTSRRGFSSKVVSGLAQGSGEYFARIGIGTPARYAYMVLDTGSDVVWLQ  174

Query  525  CQPCSDCYSQTDPIFNPAQSSSY  593
            C PC  CYSQ+DPIF+P  S SY
Sbjct  175  CAPCRRCYSQSDPIFDPRSSRSY  197



>ref|XP_002961719.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
 gb|EFJ36979.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
Length=357

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  VTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSS  587
            ++SG+S GSGEYFAR+G+G P + +Y+ +DTGSDVTW+QC PCS CYSQ DPI++P+ SS
Sbjct  1    ISSGLSLGSGEYFARMGIGNPQRSYYLELDTGSDVTWIQCAPCSSCYSQVDPIYDPSNSS  60

Query  588  SYRRV  602
            SYRRV
Sbjct  61   SYRRV  65



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  375  TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQ  554
            T  Q     S VTSG++QGSGEYF RLGVG P K  YMV+DTGSDV W+QC PC  CYSQ
Sbjct  152  THAQGGGFSSSVTSGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQ  211

Query  555  TDPIFNPAQSSSYRRVS  605
            TDP+F+P +S S+  +S
Sbjct  212  TDPVFDPKKSGSFSSIS  228



>ref|XP_011077177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Sesamum 
indicum]
Length=492

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
            ++DY  L  AR+ARD+ RV S+  +L +    +  ADL P++   + + LE PV SG SQ
Sbjct  92   EKDYETLTLARLARDSARVKSIQTRLDLVSLDIKKADLTPLEVEFEEQKLEGPVISGTSQ  151

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPI  566
            GSGEYF R+GVG P    YMV+DTGSDV W+QC PC+DCY Q DPI
Sbjct  152  GSGEYFCRVGVGNPPTQAYMVLDTGSDVNWVQCAPCADCYQQADPI  197



>ref|XP_006653026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=477

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  360  LKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCS  539
            +K + +   PEDL S V SG+ +GSGEYF R+GVG P  D Y+V+D+GSDV W+QC+PC 
Sbjct  107  VKRLASTYLPEDLGSDVVSGLGEGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCD  166

Query  540  DCYSQTDPIFNPAQSSSYRRVS  605
             CY+QTDP+F+PA SSS+  V+
Sbjct  167  QCYAQTDPLFDPATSSSFSGVA  188



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF R+GVG P K  YMV+DTGSD+ WLQC PC +CYSQTDP+FNP
Sbjct  117  FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNP  176

Query  576  AQSSSYRRV  602
             +S S+ +V
Sbjct  177  VKSGSFAKV  185



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            E L  P+ SG SQGSGEYF+R+G+G+P    YMV+DTGSD++W+QC PC+DCY Q DPIF
Sbjct  117  EKLSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYHQADPIF  176

Query  570  NPAQSSSY  593
             PA S+SY
Sbjct  177  EPASSASY  184



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF R+GVG P K  YMV+DTGSD+ WLQC PC +CYSQTDP+FNP
Sbjct  27   FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNP  86

Query  576  AQSSSYRRV  602
             +S S+ +V
Sbjct  87   VKSGSFAKV  95



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +3

Query  363  KPVQTVV---QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQP  533
            +PV T +   + +++E+P+ SG +QGSGEYF R+G+G PA++ YMV+DTGSDV WLQC P
Sbjct  102  RPVITTMYTTEQQEIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAP  161

Query  534  CSDCYSQTDPIFNP  575
            C+DCY QT+PIF P
Sbjct  162  CADCYHQTEPIFEP  175



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF R+GVG P K  YMV+DTGSD+ WLQC PC +CYSQTDP+FNP
Sbjct  114  FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNP  173

Query  576  AQSSSYRRV  602
             +S S+ +V
Sbjct  174  VKSGSFAKV  182



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  336  VSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVT  515
            V+ L+   L    + ++  D  S V SG+ QGSGEYF R+GVG P ++ YMVID+GSD+ 
Sbjct  160  VASLTRHLLNCSNSELESLDFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIV  219

Query  516  WLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            W+QCQPC++CY Q+DPIF+PA+S+SY  VS
Sbjct  220  WVQCQPCTECYHQSDPIFDPARSASYSGVS  249



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  336  VSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVT  515
            V+ L+   L    + ++  D  S V SG+ QGSGEYF R+GVG P ++ YMVID+GSD+ 
Sbjct  161  VASLTRRLLNDSNSELESLDFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIV  220

Query  516  WLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            W+QCQPC++CY Q+DPIF+PA+S+SY  VS
Sbjct  221  WVQCQPCTECYHQSDPIFDPARSASYSGVS  250



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  366  PVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDC  545
            P + V       S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  C
Sbjct  116  PRRNVTHAPGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRC  175

Query  546  YSQTDPIFNPAQSSSY  593
            YSQ+DPIF+P +S +Y
Sbjct  176  YSQSDPIFDPRKSRTY  191



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF R+GVG P K  YMV+DTGSD+ WLQC PC +CYSQTDP+FNP
Sbjct  155  FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNP  214

Query  576  AQSSSYRRV  602
             +S S+ +V
Sbjct  215  VKSGSFAKV  223



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +3

Query  315  DAKLMVAVSGLSPADLKPVQTVVQPE----DLESPVTSGVSQGSGEYFARLGVGQPAKDF  482
            DA    A+S L+ A+    +   +P     D  S V SG+SQGSGEYF R+GVG P K  
Sbjct  93   DAYRAKAISDLAAANATVGRRAGKPHAGGRDFSSSVVSGLSQGSGEYFTRIGVGTPPKYV  152

Query  483  YMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            YMV+DTGSDV W+QC PC  CY+Q+DP+F+P++SSS+  V+
Sbjct  153  YMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVA  193



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            +D  S V SG+SQGSGEYF R+G+G P K  Y+V+DTGSD+ W+QC PCS CYSQ+DP+F
Sbjct  98   KDFSSSVISGLSQGSGEYFTRIGIGTPVKYVYLVLDTGSDIVWIQCLPCSKCYSQSDPVF  157

Query  570  NPAQSSSYRRVS  605
            +P++SSS+  V+
Sbjct  158  DPSKSSSFSTVT  169



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  372  QTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYS  551
            Q + +  D  S V SG++QGSGEYF R+GVG PA+  Y+VID+GSD+ W+QCQPCS CY 
Sbjct  112  QVMNKKLDFGSEVVSGMAQGSGEYFVRIGVGSPARSQYVVIDSGSDIVWVQCQPCSQCYH  171

Query  552  QTDPIFNPAQSSSYRRVS  605
            Q+DPIF+P++S+SY  VS
Sbjct  172  QSDPIFDPSRSASYSGVS  189



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  123  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  182

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  183  IFDPRKSRTY  192



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
             D  S + SG+SQGSGEYF RLGVG P K  YMV+DTGSD+ W+QC PC  CY QTD +F
Sbjct  124  RDFSSSIVSGLSQGSGEYFTRLGVGTPPKYMYMVLDTGSDIVWIQCTPCKKCYDQTDRMF  183

Query  570  NPAQSSSYRRV  602
            NP +S SYR +
Sbjct  184  NPVKSGSYRSI  194



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  375  TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQ  554
            T  Q     S VTSG++QGSGEYF RLGVG P K  YMV+DTGSDV W+QC PC  CYSQ
Sbjct  125  THAQGGGFSSSVTSGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQ  184

Query  555  TDPIFNPAQSSSYRRVS  605
            TDP+F+P +S S+  +S
Sbjct  185  TDPVFDPKKSGSFSSIS  201



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +  D  S VTSG+SQGSGEYF R+G+G P +  YMV+DTGSDV W+QC PC+ CYSQTDP
Sbjct  101  RARDFSSSVTSGLSQGSGEYFTRIGIGTPPRYVYMVLDTGSDVVWIQCSPCTKCYSQTDP  160

Query  564  IFNPAQSSSYRRVS  605
            +F+P  S+S+  VS
Sbjct  161  VFDPRASTSFLGVS  174



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  119  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  178

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  179  IFDPRKSRTY  188



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  123  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  182

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  183  IFDPRKSKTY  192



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  119  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  178

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  179  IFDPRKSRTY  188



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  119  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  178

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  179  IFDPRKSRTY  188



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            D  S VTSG++QGSGEYF RLGVG P K  YMV+DTGSDV W+QC PC  CY+Q+DP+F+
Sbjct  134  DFSSSVTSGLAQGSGEYFTRLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFD  193

Query  573  PAQSSSYRRVS  605
            P +SSS+  VS
Sbjct  194  PTKSSSFLGVS  204



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  123  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  182

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  183  IFDPRKSKTY  192



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DP
Sbjct  119  RPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDP  178

Query  564  IFNPAQSSSY  593
            IF+P +S +Y
Sbjct  179  IFDPRKSRTY  188



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +3

Query  318  AKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVID  497
            A ++  +SG S   + P  +  + +D  S V SG+ QGSGEYF R+GVG P +D YMVID
Sbjct  91   AAILRRISGKS---VPPSNSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVID  147

Query  498  TGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            +GSD+ W+QCQPC  CY Q+DP+F+PA+S SY  VS
Sbjct  148  SGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVS  183



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + E+  S V SG+ QGSGEYF R+GVG P K+ Y+VID+GSD+ W+QCQPC+ CY Q+DP
Sbjct  128  KTEEFGSDVVSGMEQGSGEYFVRIGVGSPPKNQYVVIDSGSDIIWVQCQPCTQCYRQSDP  187

Query  564  IFNPAQSSSYRRVS  605
            +FNP  SSSY  VS
Sbjct  188  VFNPGDSSSYSGVS  201



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYM  488
            SL  K +  ++ +S       +T   P      V SG+SQGSGEYF RLGVG PA + YM
Sbjct  92   SLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYM  151

Query  489  VIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            V+DTGSDV WLQC PC  CY+Q+DP+F+PA+S ++  V
Sbjct  152  VLDTGSDVVWLQCSPCKVCYNQSDPMFDPAKSKTFATV  189



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P    + V SG+SQGSGEYF R+G+G PA+   MV+DTGSDV WLQC PC  CYSQTDP
Sbjct  134  RPRGFSASVVSGLSQGSGEYFTRIGIGTPARYLNMVLDTGSDVVWLQCAPCRRCYSQTDP  193

Query  564  IFNPAQSSSYRRV  602
            IF+P QS SY  V
Sbjct  194  IFDPRQSRSYAAV  206



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG+SQGSGEYF R+GVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DPIF P
Sbjct  109  FSSSVISGLSQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYSQSDPIFVP  168

Query  576  AQSSSYRRVS  605
            A+S +Y  +S
Sbjct  169  AKSKTYAGIS  178



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            D    V SG+ QGSGEYF R+GVG P ++ YMV+DTGSDV W+QC+PC +CYSQ DPIFN
Sbjct  141  DFGGEVVSGMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFN  200

Query  573  PAQSSSYRRV  602
            P+ S+S+  V
Sbjct  201  PSYSASFSTV  210



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + E+  S V SG+ QGSGEYF R+GVG P K+ Y+V+D+GSD+ W+QCQPC+ CY Q+DP
Sbjct  128  ETEEFGSGVVSGMEQGSGEYFVRIGVGSPPKNQYVVVDSGSDIIWVQCQPCTQCYHQSDP  187

Query  564  IFNPAQSSSYRRVS  605
            +FNP  SSSY  VS
Sbjct  188  VFNPEDSSSYAGVS  201



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            D  S V SG+ QGSGEYF R+GVG PA+  YMVID+GSD+ W+QCQPCS CY Q+DP+F+
Sbjct  141  DFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQSDPVFD  200

Query  573  PAQSSSYRRVS  605
            PA S+S+  VS
Sbjct  201  PADSASFTGVS  211



>emb|CDY25371.1| BnaA05g19130D [Brassica napus]
Length=397

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  366  PVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDC  545
            P  +  + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  C
Sbjct  102  PSGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLC  161

Query  546  YSQTDPIFNPAQSSSYRRVS  605
            Y Q+DP+F+PA+S SY  VS
Sbjct  162  YKQSDPVFDPAKSGSYTGVS  181



>emb|CDY24567.1| BnaC05g32510D [Brassica napus]
Length=395

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W QCQPC  CY Q+DP
Sbjct  106  EVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWFQCQPCKLCYKQSDP  165

Query  564  IFNPAQSSSYRRVS  605
            +F+PA+S SY  VS
Sbjct  166  VFDPAKSGSYTGVS  179



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  VTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSS  587
            V SG+SQGSGEYF RLGVG PA + YMV+DTGSDV WLQC PC  CY+Q+DP+FNPA+S 
Sbjct  125  VISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCSPCKVCYNQSDPVFNPAKSK  184

Query  588  SYRRV  602
            ++  V
Sbjct  185  TFATV  189



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            + L  P+ SG SQGSGEYF+R+G+G+P    YMV+DTGSD++W+QC PC+DCY Q DPIF
Sbjct  115  DKLSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIF  174

Query  570  NPAQSSSY  593
             P  S+SY
Sbjct  175  EPTASASY  182



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYM  488
            S+  ++   V+GL+ +  +  QT V  +D ++PV SG+S GSGEYF R+ VG P +  Y+
Sbjct  14   SIHGRINQTVNGLTRSRSRDRQTKVPSQDFQAPVVSGLSLGSGEYFIRISVGTPPRRMYL  73

Query  489  VIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            V+DTGSD+ WLQC PC +CY Q+D IF+P +SS+Y
Sbjct  74   VMDTGSDILWLQCAPCVNCYHQSDAIFDPYKSSTY  108



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DPI++P
Sbjct  119  FSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYSQSDPIYDP  178

Query  576  AQSSSYRRVS  605
             +S++Y  +S
Sbjct  179  RKSTTYSTIS  188



>emb|CAE05761.2| OSJNBa0064G10.12 [Oryza sativa Japonica Group]
Length=451

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  387  PEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPI  566
            PEDL S V  GV  GSGEYF R+GVG P  D Y+V+D+GSDV W+QC+PC  CY+QTDP+
Sbjct  112  PEDLVSEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPL  171

Query  567  FNPAQSSSYRRVS  605
            F+PA SSS+  VS
Sbjct  172  FDPAASSSFSGVS  184



>ref|NP_001054261.2| Os04g0677100 [Oryza sativa Japonica Group]
 dbj|BAF16175.2| Os04g0677100 [Oryza sativa Japonica Group]
Length=464

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  387  PEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPI  566
            PEDL S V  GV  GSGEYF R+GVG P  D Y+V+D+GSDV W+QC+PC  CY+QTDP+
Sbjct  112  PEDLVSEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPL  171

Query  567  FNPAQSSSYRRVS  605
            F+PA SSS+  VS
Sbjct  172  FDPAASSSFSGVS  184



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            Q  D  + V SG++QGSGEYF R+GVG P +D Y+VID+GSD+ W+QCQPC+ CY QTDP
Sbjct  111  QVNDFGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPCTQCYHQTDP  170

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+S+  VS
Sbjct  171  VFDPANSASFIGVS  184



>gb|EAZ32412.1| hypothetical protein OsJ_16623 [Oryza sativa Japonica Group]
Length=473

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  387  PEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPI  566
            PEDL S V  GV  GSGEYF R+GVG P  D Y+V+D+GSDV W+QC+PC  CY+QTDP+
Sbjct  112  PEDLVSEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPL  171

Query  567  FNPAQSSSYRRVS  605
            F+PA SSS+  VS
Sbjct  172  FDPAASSSFSGVS  184



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  366  PVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDC  545
            P  +  + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  C
Sbjct  103  PYGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLC  162

Query  546  YSQTDPIFNPAQSSSYRRVS  605
            Y Q+DP+F+PA+S SY  VS
Sbjct  163  YKQSDPVFDPAKSGSYTGVS  182



>emb|CAJ86229.1| H0402C08.5 [Oryza sativa Indica Group]
 gb|EAY96049.1| hypothetical protein OsI_17922 [Oryza sativa Indica Group]
Length=473

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  387  PEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPI  566
            PEDL S V  GV  GSGEYF R+GVG P  D Y+V+D+GSDV W+QC+PC  CY+QTDP+
Sbjct  112  PEDLVSEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPL  171

Query  567  FNPAQSSSYRRVS  605
            F+PA SSS+  VS
Sbjct  172  FDPAASSSFSGVS  184



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            Q +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP
Sbjct  117  QVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDP  176

Query  564  IFNPAQSSSYRRVS  605
            +F+PA+S SY  VS
Sbjct  177  VFDPAKSGSYTGVS  190



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG+SQGSGEYF RLGVG P +  YMV+DTGSDV WLQC PC  CYSQ+DPIFNP
Sbjct  95   FSSSVVSGLSQGSGEYFTRLGVGTPPRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNP  154

Query  576  AQSSSY  593
             +S S+
Sbjct  155  YKSKSF  160



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  378  VVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQT  557
            V + E+  S V SG+ QGSGEYF R+GVG PA++ YMVID+GSD+ W+QCQPC+ CY Q+
Sbjct  134  VYRVEEFGSNVISGMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQS  193

Query  558  DPIFNPAQSSSYRRVS  605
            DP+F+P+ S S+  VS
Sbjct  194  DPVFDPSLSGSFAGVS  209



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S VTSG++QGSGEYF RLGVG PAK  YMV+DTGSDV W+QC PC  CY+Q+DP+F+P
Sbjct  121  FSSSVTSGLAQGSGEYFTRLGVGTPAKYVYMVLDTGSDVVWVQCSPCRRCYTQSDPVFDP  180

Query  576  AQSSSYRRVS  605
             +S+S+  VS
Sbjct  181  RKSTSFLGVS  190



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +3

Query  330  VAVSGLSP-ADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGS  506
            VA S L+P  D+K +Q +     +   V SG S GSGEYF+R+GVG P K  YM++DTGS
Sbjct  133  VADSVLNPNTDVKALQ-IAAVNSIMGSVISGASMGSGEYFSRVGVGSPPKPLYMILDTGS  191

Query  507  DVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            DV+W+QC PC+DCY Q+DP+F+P+ SSSY  +S
Sbjct  192  DVSWVQCLPCADCYEQSDPVFDPSDSSSYTLLS  224



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            +D  S V SG+SQGSGEYF R+G+G P K  Y+V+DTGSD+ W+QC PC+ CYSQ+DP+F
Sbjct  101  KDFSSSVISGLSQGSGEYFTRIGIGTPTKYVYLVLDTGSDIVWIQCLPCAKCYSQSDPVF  160

Query  570  NPAQSSSYRRVS  605
            +P++SSS+  V+
Sbjct  161  DPSKSSSFSPVT  172



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            D    V SG+ QGSGEYF R+GVG P ++ YMV+DTGSDV W+QC+PC +CYSQ DPIFN
Sbjct  141  DFGGEVVSGMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFN  200

Query  573  PAQSSSYRRV  602
            P+ S+S+  V
Sbjct  201  PSYSASFSTV  210



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  375  TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQ  554
            T  + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q
Sbjct  99   TKYKVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  158

Query  555  TDPIFNPAQSSSYRRVS  605
            +DP+F+PA+S SY  VS
Sbjct  159  SDPVFDPAKSGSYTGVS  175



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP
Sbjct  112  EVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDP  171

Query  564  IFNPAQSSSYRRVS  605
            +F+PA+S SY  VS
Sbjct  172  VFDPAKSGSYTGVS  185



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QC+PC+ CY QTDP+F
Sbjct  145  EDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLF  204

Query  570  NPAQSSSYRRVS  605
            +PA S+S+  VS
Sbjct  205  DPADSASFMGVS  216



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QC+PC+ CY QTDP+F
Sbjct  146  EDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLF  205

Query  570  NPAQSSSYRRVS  605
            +PA S+S+  VS
Sbjct  206  DPADSASFMGVS  217



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QC+PC+ CY QTDP+F
Sbjct  145  EDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLF  204

Query  570  NPAQSSSYRRVS  605
            +PA S+S+  VS
Sbjct  205  DPADSASFMGVS  216



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            E+  S V SG+ QGSGEYF R+GVG PA++ YMVID+GSD+ W+QCQPC+ CY Q+DP+F
Sbjct  135  EEFGSDVVSGMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVF  194

Query  570  NPAQSSSYRRVS  605
            +P+ S S+  VS
Sbjct  195  DPSLSGSFAGVS  206



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP
Sbjct  113  EVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDP  172

Query  564  IFNPAQSSSYRRVS  605
            +F+PA+S SY  VS
Sbjct  173  VFDPAKSGSYTGVS  186



>ref|XP_010911344.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Elaeis guineensis]
Length=315

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +3

Query  249  QRDYGDLMaarvardavrvaSLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQ  428
             +DY  L  AR+ RD  RV S+ A+  +A++G   +D K  +    P+ +   + SG SQ
Sbjct  103  HKDYESLTLARLRRDFDRVRSIFARAAIAING---SDSKAAKAAAMPDSIRGTIVSGSSQ  159

Query  429  GSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSY  593
            G GEYF+R+G+G+PAK  +MV+DTGSDV+W+QC PC+DCY Q DPI++P  S +Y
Sbjct  160  GIGEYFSRVGIGRPAKPQFMVLDTGSDVSWVQCLPCTDCYKQADPIYDPTGSDTY  214



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP
Sbjct  112  EVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDP  171

Query  564  IFNPAQSSSYRRVS  605
            +F+PA+S SY  VS
Sbjct  172  VFDPAKSGSYTGVS  185



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  366  PVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDC  545
            P     +P    S V SG++ GSGEYF RLGVG PAK  YMV+DTGSDV W+QC PC  C
Sbjct  107  PTNVSGKPHGFSSSVISGLAHGSGEYFTRLGVGTPAKYVYMVLDTGSDVVWIQCSPCRKC  166

Query  546  YSQTDPIFNPAQSSSYRRVS  605
            Y+Q+DP+F+P +S ++  V+
Sbjct  167  YTQSDPVFDPKKSKTFSGVA  186



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  375  TVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQ  554
            +V +P D  S + SG++QGSGEYF R+G+G P K  YMV+DTGSDV W+QC PC  CYSQ
Sbjct  107  SVGRPGDFSSSIVSGLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQ  166

Query  555  TDPIFNPAQSSSY  593
            +DP+F+P  S+S+
Sbjct  167  SDPVFDPKSSTSF  179



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DPIF+P
Sbjct  128  FSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYSQSDPIFDP  187

Query  576  AQSSSY  593
             +S +Y
Sbjct  188  RKSRTY  193



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  360  LKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCS  539
            L+ +     P+D  S V SG+ +GSGEYF R+GVG P K+ +MVID+GSD+ W+QC+PC+
Sbjct  99   LRRLGAGYHPDDFGSDVVSGLDEGSGEYFVRIGVGSPPKEQFMVIDSGSDIVWVQCRPCT  158

Query  540  DCYSQTDPIFNPAQSSSYRRVS  605
             CY+Q+DP+F+PA S+S+  +S
Sbjct  159  QCYAQSDPVFDPADSTSFAGIS  180



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            + L  P+ SG SQGSGEYF+R+G+G+P    YMV+DTGSD++W+QC PC+DCY Q DPIF
Sbjct  115  DKLSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIF  174

Query  570  NPAQSSSY  593
             P  S+SY
Sbjct  175  EPTASASY  182



>ref|XP_002990366.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
 gb|EFJ08635.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
Length=420

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              SP+ SG++ GSG+YFAR+GVG PA+  YMV DTGSDV+WLQC PC  CY Q DPIFNP
Sbjct  66   FASPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQQDPIFNP  125

Query  576  AQSSSYR  596
            + SSS++
Sbjct  126  SLSSSFK  132



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
                S V SG++QGSGEYF R+G+G PA+  YMV+DTGSDV WLQC PC  CYSQTDPIF
Sbjct  132  RGFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPIF  191

Query  570  NPAQSSSY  593
            +P +S SY
Sbjct  192  DPRRSRSY  199



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +  D  S V SG+ QGSGEYF R+GVG P K  YMVID+GSD+ W+QCQPC+ CY Q+DP
Sbjct  122  EVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQYMVIDSGSDIVWVQCQPCNQCYRQSDP  181

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+SY  +S
Sbjct  182  VFDPADSASYAGIS  195



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            E   S V SG+ QGSGEYF R+GVG P ++ Y+VID+GSD+ W+QC+PC+ CY Q+DP+F
Sbjct  117  EAFGSDVVSGMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYHQSDPVF  176

Query  570  NPAQSSSYRRVS  605
            NPA SSSY  VS
Sbjct  177  NPADSSSYAGVS  188



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG+SQGSGEYF RLGVG PA+  YMV+DTGSD+ WLQC PC  CYSQ+DPIF+P
Sbjct  127  FSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDP  186

Query  576  AQSSSY  593
             +S +Y
Sbjct  187  RKSKTY  192



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +  D  S V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QCQPC+ CY Q+DP
Sbjct  123  EVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQSDP  182

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+SY  VS
Sbjct  183  VFDPANSASYSGVS  196



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 9/95 (9%)
 Frame = +3

Query  321  KLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDT  500
            + + A++GL+ + L         +D  S V SG+ +GSGEYF R+GVG P ++ YMVID+
Sbjct  97   RRVAALTGLAYSSL---------QDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDS  147

Query  501  GSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
            GSD+TW+QCQPCS CY Q  P+F+PAQS+++  V 
Sbjct  148  GSDITWVQCQPCSQCYHQAGPVFDPAQSTTFYNVG  182



>ref|XP_002979394.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
 gb|EFJ19802.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
Length=353

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  402  SPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQ  581
            SP+ SG++ GSG+YFAR+GVG PA+  YMV DTGSDV+WLQC PC  CY Q DPIFNP+ 
Sbjct  1    SPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQQDPIFNPSL  60

Query  582  SSSYR  596
            SSS++
Sbjct  61   SSSFK  65



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF RLGVG P +  YMV+DTGSDV WLQC PC  CY+Q DP+F+P
Sbjct  134  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDP  193

Query  576  AQSSSYRRVS  605
            ++S S+ R+S
Sbjct  194  SKSRSFARIS  203



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF RLGVG P +  YMV+DTGSDV WLQC PC  CYSQ+DPIFNP
Sbjct  159  FSSSVISGLAQGSGEYFTRLGVGTPPRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNP  218

Query  576  AQSSSY  593
             +S S+
Sbjct  219  YKSKSF  224



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SGV QGSGEYF R+GVG P ++ YMVID+GSD+ W+QCQPC+ CY Q DP+F
Sbjct  122  EDFASEVVSGVDQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCNQCYRQLDPVF  181

Query  570  NPAQSSSYRRVS  605
            +PA S+++  V+
Sbjct  182  DPADSATFAGVA  193



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
             D  S V SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP+F
Sbjct  115  NDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVF  174

Query  570  NPAQSSSYRRVS  605
            +PA+S SY  VS
Sbjct  175  DPAKSGSYTGVS  186



>ref|XP_002986620.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
 gb|EFJ12477.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
Length=423

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQP---EDLESPVTSGVSQGSGEYFARLGVGQPAKD  479
            S+ +++ + V+G+  + L        P   +D E+P+ SG+S GSGEYF  LGVG P + 
Sbjct  34   SISSRISLGVAGIPKSSLTNPLKNTNPFLQQDFETPLRSGLSDGSGEYFVSLGVGTPPRT  93

Query  480  FYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
              MV DTGSDV WLQC PC  CY QTDP+FNP+ SS+++ ++
Sbjct  94   VNMVADTGSDVLWLQCLPCQSCYGQTDPLFNPSFSSTFQSIT  135



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            Q  D  S V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QCQPC+ CY Q+DP
Sbjct  116  QVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQSDP  175

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+S+  VS
Sbjct  176  VFDPANSASFSGVS  189



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
                V SG+SQGSGEYF RLGVG PA + YMV+DTGSDV WLQC PC  CY+Q+DPIF+P
Sbjct  122  FSGAVISGLSQGSGEYFMRLGVGTPATNAYMVLDTGSDVVWLQCSPCKVCYNQSDPIFDP  181

Query  576  AQSSSYRRVS  605
             +S SY  V+
Sbjct  182  KKSKSYATVA  191



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            D  S V SG++QGSGEYF R+G+G P K  YMV+DTGSDV W+QC PC  CYSQTDP+F+
Sbjct  118  DFSSSVISGLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQTDPVFD  177

Query  573  PAQSSSYRRVS  605
            P  S+S+  VS
Sbjct  178  PKASTSFLGVS  188



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SG++QGSGEYF R+G+G P +  YMVID+GSD+ W+QC+PC+ CY QTDP+F
Sbjct  145  EDFGSDVVSGMNQGSGEYFVRIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLF  204

Query  570  NPAQSSSYRRVS  605
            +PA S+S+  VS
Sbjct  205  DPADSASFMGVS  216



>ref|XP_002965292.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
 gb|EFJ34130.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
Length=423

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQP---EDLESPVTSGVSQGSGEYFARLGVGQPAKD  479
            S+ +++ + V+G+  + L        P   +D E+P+ SG+S GSGEYF  LGVG P + 
Sbjct  34   SISSRISLGVAGIPKSSLTNPLKNTNPFLQQDFETPLRSGLSDGSGEYFVSLGVGTPPRT  93

Query  480  FYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRVS  605
              MV DTGSDV WLQC PC  CY QTDP+FNP+ SS+++ ++
Sbjct  94   VNMVADTGSDVLWLQCLPCQSCYGQTDPLFNPSFSSTFQSIT  135



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +3

Query  309  SLDAKLMVAVSGLSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYM  488
            SL  K + +++ +S       +T          V SG+SQGSGEYF RLGVG PA + YM
Sbjct  91   SLRVKSITSLAAVSTGRNATKRTPRTAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYM  150

Query  489  VIDTGSDVTWLQCQPCSDCYSQTDPIFNPAQSSSYRRV  602
            V+DTGSDV WLQC PC  CY+QTD IF+P +S ++  V
Sbjct  151  VLDTGSDVVWLQCSPCKACYNQTDAIFDPKKSKTFATV  188



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            E   S V SG+ QGSGEYF R+GVG P ++ Y+VID+GSD+ W+QC+PC+ CY Q+DP+F
Sbjct  119  EAFGSDVVSGMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYRQSDPVF  178

Query  570  NPAQSSSYRRVS  605
            NPA SSSY  VS
Sbjct  179  NPADSSSYAGVS  190



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
                V SG+SQGSGEYF RLGVG PA + YMV+DTGSDV WLQC PC  CY+Q+DPIF+P
Sbjct  120  FSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDP  179

Query  576  AQSSSYRRV  602
             +S +Y  V
Sbjct  180  KRSKTYATV  188



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  DLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFN  572
            +  S V SG+ QGSGEYF R+G+G P ++ YMV+DTGSDV W+QC+PC +CYSQ DPIFN
Sbjct  138  EFGSEVVSGMEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFN  197

Query  573  PAQSSSYRRV  602
            P+ S S+  V
Sbjct  198  PSSSVSFSTV  207



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF RLGVG P +  YMV+DTGSDV W+QC PC  CYSQTDP+F+P
Sbjct  123  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDP  182

Query  576  AQSSSYRRV  602
            A+S S+  V
Sbjct  183  AKSRSFATV  191



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
             D  S + SG+ QGSGEYF R+GVG P +D YMVID+GSD+ W+QCQPC  CY Q+DP+F
Sbjct  114  NDFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVF  173

Query  570  NPAQSSSYRRVS  605
            +PA+S SY  VS
Sbjct  174  DPAKSGSYTGVS  185



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF RLGVG P +  YMV+DTGSDV W+QC PC  CYSQTDP+F+P
Sbjct  123  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDP  182

Query  576  AQSSSYRRV  602
            A+S S+  V
Sbjct  183  AKSRSFATV  191



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            +P D  S + SG++QGSGEYF R+G+G P K  YMV+DTGSDV W+QC PC  CYSQ+DP
Sbjct  108  RPGDFSSSIVSGLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDP  167

Query  564  IFNPAQSSSY  593
            +F+P  S+S+
Sbjct  168  VFDPKSSTSF  177



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
            ED  S V SG+ QGSGEYF R+GVG PA+  YMVID+GSD+ W+QCQPC+ CY Q+DP+F
Sbjct  142  EDFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVF  201

Query  570  NPAQSSSYRRV  602
            +P+ S+S+  V
Sbjct  202  DPSASASFSGV  212



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  390  EDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIF  569
                S V SG++QGSGEYF R+G+G PA+  YMV+DTGSDV WLQC PC  CYSQTDP+F
Sbjct  135  RGFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPVF  194

Query  570  NPAQSSSY  593
            +P +S SY
Sbjct  195  DPRRSRSY  202



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
                V SG+SQGSGEYF RLGVG PA + YMV+DTGSDV WLQC PC  CY+Q+DPIF+P
Sbjct  123  FSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDP  182

Query  576  AQSSSYRRV  602
             +S +Y  V
Sbjct  183  KRSKTYATV  191



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
                V SG+SQGSGEYF RLGVG PA + YMV+DTGSDV WLQC PC  CY+Q+DPIF+P
Sbjct  125  FSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDP  184

Query  576  AQSSSYRRV  602
             +S +Y  V
Sbjct  185  KRSKTYATV  193



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  396  LESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDPIFNP  575
              S V SG++QGSGEYF RLGVG PA+  YMV+DTGSD+ W+QC PC  CYSQTDP+F+P
Sbjct  147  FSSSVISGLAQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWIQCAPCKKCYSQTDPVFDP  206

Query  576  AQSSSYRRV  602
             +S S+  +
Sbjct  207  TKSRSFASI  215



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +3

Query  345  LSPADLKPVQTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQ  524
            LSP D     +V   E+  + V SG++QGSGEYF R+GVG P ++ Y+VID+GSD+ W+Q
Sbjct  113  LSPRDATSSYSV---EEFGAEVVSGMNQGSGEYFIRIGVGSPPREQYVVIDSGSDIVWVQ  169

Query  525  CQPCSDCYSQTDPIFNPAQSSSYRRV  602
            CQPC+ CY QTDP+F+PA S+S+  V
Sbjct  170  CQPCTQCYHQTDPVFDPADSASFMGV  195



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  + V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QCQPCS CY Q+DP
Sbjct  137  EVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDP  196

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+S+  VS
Sbjct  197  VFDPADSASFSGVS  210



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  372  QTVVQPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYS  551
              V + E+  S V SG+ QGSGEYF R+GVG P ++ YMVID GSD+ W+QCQPC+ CY 
Sbjct  127  NNVYEVEEFGSEVISGMEQGSGEYFVRIGVGSPVREQYMVIDAGSDIVWVQCQPCTHCYH  186

Query  552  QTDPIFNPAQSSSYRRV  602
            Q+DP+F+P+ S+S+  V
Sbjct  187  QSDPVFDPSLSASFSGV  203



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + ED  S V SG+ QGSGEYF R+GVG P ++ YMV+D+GSD+ W+QCQPCS CY Q DP
Sbjct  117  EVEDFGSEVISGMEQGSGEYFVRIGVGSPPRNQYMVLDSGSDIVWVQCQPCSQCYRQLDP  176

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+++  V+
Sbjct  177  VFDPAASATFAGVA  190



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  384  QPEDLESPVTSGVSQGSGEYFARLGVGQPAKDFYMVIDTGSDVTWLQCQPCSDCYSQTDP  563
            + +D  + V SG+ QGSGEYF R+GVG P +  YMVID+GSD+ W+QCQPCS CY Q+DP
Sbjct  137  EVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDP  196

Query  564  IFNPAQSSSYRRVS  605
            +F+PA S+S+  VS
Sbjct  197  VFDPADSASFSGVS  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800