BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003F01 275 bp,:Filtered

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_974974.1|  N-terminal nucleophile aminohydrolases (Ntn hyd...  59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05365.1|  unnamed protein product                              60.1    1e-08   Coffea canephora [robusta coffee]
ref|NP_200962.2|  N-terminal nucleophile aminohydrolases (Ntn hyd...  59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358231.1|  PREDICTED: probable isoaspartyl peptidase/L-...  58.2    3e-08   Solanum tuberosum [potatoes]
dbj|BAB08998.1|  glycosylasparaginase-like protein                    59.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHN26458.1|  Putative isoaspartyl peptidase/L-asparaginase 3       55.8    4e-08   Glycine soja [wild soybean]
ref|XP_010693727.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...  58.5    5e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010318172.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.4    6e-08   Solanum lycopersicum
ref|XP_011101108.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.4    6e-08   Sesamum indicum [beniseed]
ref|XP_006358230.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.8    7e-08   Solanum tuberosum [potatoes]
ref|XP_010258812.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.0    8e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010662267.1|  PREDICTED: probable isoaspartyl peptidase/L-...  54.7    1e-07   Vitis vinifera
ref|XP_002862538.1|  predicted protein                                55.1    1e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010258811.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.0    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004235423.1|  PREDICTED: probable isoaspartyl peptidase/L-...  57.0    2e-07   Solanum lycopersicum
ref|XP_010483833.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010457450.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010546145.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    2e-07   Tarenaya hassleriana [spider flower]
gb|KJB51388.1|  hypothetical protein B456_008G214900                  55.8    2e-07   Gossypium raimondii
emb|CAN79007.1|  hypothetical protein VITISV_040897                   54.7    2e-07   Vitis vinifera
ref|XP_006582412.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.8    2e-07   Glycine max [soybeans]
ref|XP_007038310.1|  N-terminal nucleophile aminohydrolases (Ntn ...  55.5    3e-07   Theobroma cacao [chocolate]
ref|XP_008778248.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.8    3e-07   Phoenix dactylifera
ref|XP_010483828.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010483832.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010457448.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010457441.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010546143.1|  PREDICTED: probable isoaspartyl peptidase/L-...  56.2    4e-07   Tarenaya hassleriana [spider flower]
emb|CDY23060.1|  BnaC07g31270D                                        55.8    4e-07   Brassica napus [oilseed rape]
ref|XP_009136487.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.8    4e-07   Brassica rapa
emb|CDY02136.1|  BnaA03g40310D                                        55.8    4e-07   Brassica napus [oilseed rape]
ref|XP_011101107.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.8    4e-07   Sesamum indicum [beniseed]
ref|XP_008778245.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.8    5e-07   Phoenix dactylifera
ref|XP_008778247.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.5    5e-07   Phoenix dactylifera
ref|XP_003527550.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.5    5e-07   Glycine max [soybeans]
ref|XP_006394494.1|  hypothetical protein EUTSA_v10004474mg           55.5    5e-07   Eutrema salsugineum
ref|XP_004499624.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.5    5e-07   Cicer arietinum [garbanzo]
ref|XP_008778246.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.5    5e-07   
ref|XP_008778244.1|  PREDICTED: probable isoaspartyl peptidase/L-...  55.5    5e-07   Phoenix dactylifera
gb|KJB51387.1|  hypothetical protein B456_008G214900                  55.5    5e-07   Gossypium raimondii
ref|XP_007038309.1|  N-terminal nucleophile aminohydrolases (Ntn ...  55.5    6e-07   Theobroma cacao [chocolate]
gb|KHG13691.1|  hypothetical protein F383_03902                       55.5    6e-07   Gossypium arboreum [tree cotton]
ref|XP_007148726.1|  hypothetical protein PHAVU_005G009200g           55.5    6e-07   Phaseolus vulgaris [French bean]
ref|XP_010919666.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...  55.1    8e-07   Elaeis guineensis
gb|KEH32842.1|  isoaspartyl peptidase/L-asparaginase                  54.3    8e-07   Medicago truncatula
ref|XP_002864737.1|  hypothetical protein ARALYDRAFT_496317           55.1    8e-07   Arabidopsis lyrata subsp. lyrata
gb|KDP22455.1|  hypothetical protein JCGZ_26286                       54.7    9e-07   Jatropha curcas
ref|XP_009372845.1|  PREDICTED: probable isoaspartyl peptidase/L-...  53.9    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_006281606.1|  hypothetical protein CARUB_v10027724mg           54.7    1e-06   Capsella rubella
ref|XP_008376394.1|  PREDICTED: probable isoaspartyl peptidase/L-...  53.9    1e-06   Malus domestica [apple tree]
ref|XP_003598180.1|  hypothetical protein MTR_3g008180                54.3    2e-06   Medicago truncatula
ref|XP_002510993.1|  n(4)-(beta-n-acetylglucosaminyl)-l-asparagin...  53.9    2e-06   Ricinus communis
ref|XP_009370437.1|  PREDICTED: probable isoaspartyl peptidase/L-...  53.9    2e-06   Pyrus x bretschneideri [bai li]
gb|EYU31310.1|  hypothetical protein MIMGU_mgv1a025916mg              53.9    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_008376393.1|  PREDICTED: probable isoaspartyl peptidase/L-...  53.9    2e-06   Malus domestica [apple tree]
ref|XP_011470052.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.8    3e-06   Fragaria vesca subsp. vesca
ref|XP_006490167.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.8    3e-06   Citrus sinensis [Valencia orange]
gb|KDO45284.1|  hypothetical protein CISIN_1g018660mg                 52.8    3e-06   Citrus sinensis [Valencia orange]
ref|XP_008234431.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.4    3e-06   Prunus mume [ume]
ref|XP_010662264.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.4    4e-06   Vitis vinifera
ref|XP_004307788.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.8    5e-06   Fragaria vesca subsp. vesca
ref|XP_006421589.1|  hypothetical protein CICLE_v10005302mg           52.8    5e-06   Citrus clementina
ref|XP_010087277.1|  putative isoaspartyl peptidase/L-asparaginase 3  52.8    5e-06   Morus notabilis
gb|KDO45283.1|  hypothetical protein CISIN_1g018660mg                 52.8    5e-06   Citrus sinensis [Valencia orange]
ref|XP_006490166.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.8    5e-06   Citrus sinensis [Valencia orange]
ref|XP_009382441.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.8    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009629553.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.4    6e-06   Nicotiana tomentosiformis
ref|XP_008234430.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.4    6e-06   Prunus mume [ume]
ref|XP_007218154.1|  hypothetical protein PRUPE_ppa007409mg           52.4    6e-06   Prunus persica
ref|XP_003634027.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.4    8e-06   Vitis vinifera
ref|XP_004146906.1|  PREDICTED: probable isoaspartyl peptidase/L-...  52.0    9e-06   Cucumis sativus [cucumbers]
ref|XP_009793579.1|  PREDICTED: probable isoaspartyl peptidase/L-...  51.2    1e-05   Nicotiana sylvestris
ref|XP_009793578.1|  PREDICTED: probable isoaspartyl peptidase/L-...  51.2    1e-05   Nicotiana sylvestris
ref|XP_002970199.1|  hypothetical protein SELMODRAFT_93118            51.6    1e-05   Selaginella moellendorffii
dbj|BAJ94546.1|  predicted protein                                    49.3    1e-05   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004976431.1|  PREDICTED: probable isoaspartyl peptidase/L-...  51.2    2e-05   Setaria italica
ref|XP_010062502.1|  PREDICTED: probable isoaspartyl peptidase/L-...  50.4    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010062494.1|  PREDICTED: probable isoaspartyl peptidase/L-...  50.4    2e-05   Eucalyptus grandis [rose gum]
ref|XP_008453886.1|  PREDICTED: probable isoaspartyl peptidase/L-...  50.8    2e-05   Cucumis melo [Oriental melon]
ref|XP_002320603.2|  hypothetical protein POPTR_0014s18850g           50.8    3e-05   Populus trichocarpa [western balsam poplar]
gb|EAY95071.1|  hypothetical protein OsI_16887                        50.1    3e-05   Oryza sativa Indica Group [Indian rice]
gb|KCW90866.1|  hypothetical protein EUGRSUZ_A02913                   50.4    3e-05   Eucalyptus grandis [rose gum]
ref|XP_002978364.1|  hypothetical protein SELMODRAFT_108968           50.1    4e-05   Selaginella moellendorffii
dbj|BAJ89836.1|  predicted protein                                    49.3    6e-05   Hordeum vulgare subsp. vulgare [barley]
emb|CAH67499.1|  OSIGBa0134H18.1                                      49.7    6e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001146491.1|  uncharacterized LOC100280081                     49.3    6e-05   
ref|XP_011011171.1|  PREDICTED: probable isoaspartyl peptidase/L-...  48.9    7e-05   Populus euphratica
ref|XP_011011169.1|  PREDICTED: probable isoaspartyl peptidase/L-...  48.9    7e-05   Populus euphratica
gb|EMS46487.1|  putative isoaspartyl peptidase/L-asparaginase 3       49.3    8e-05   Triticum urartu
ref|NP_001053482.1|  Os04g0549300                                     49.3    8e-05   
gb|ACF83691.1|  unknown                                               49.3    9e-05   Zea mays [maize]
gb|EMT19471.1|  Putative isoaspartyl peptidase/L-asparaginase 3       49.3    1e-04   Aegilops tauschii
ref|XP_011011168.1|  PREDICTED: probable isoaspartyl peptidase/L-...  48.9    1e-04   Populus euphratica
ref|XP_006653646.1|  PREDICTED: probable isoaspartyl peptidase/L-...  48.5    2e-04   
ref|XP_010240209.1|  PREDICTED: probable isoaspartyl peptidase/L-...  47.8    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_003581496.1|  PREDICTED: probable isoaspartyl peptidase/L-...  47.4    3e-04   Brachypodium distachyon [annual false brome]
gb|EPS60153.1|  hypothetical protein M569_14648                       46.6    6e-04   Genlisea aurea



>ref|NP_974974.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 ref|NP_001032119.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 gb|AAV91334.1| At5g61540 [Arabidopsis thaliana]
 gb|AAY25472.1| At5g61540 [Arabidopsis thaliana]
 dbj|BAF02102.1| glycosylasparaginase - like protein [Arabidopsis thaliana]
 gb|AED97484.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 gb|AED97485.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
Length=257

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGACYGWTFQYSV  P MNDV+VFTVLP
Sbjct  229  HAGACYGWTFQYSVQNPDMNDVQVFTVLP  257



>emb|CDP05365.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  PGM+DVEVFTVLP
Sbjct  328  HAGACHGWTFQYSVRNPGMDDVEVFTVLP  356



>ref|NP_200962.2| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 sp|Q56W64.1|ASPG3_ARATH RecName: Full=Probable isoaspartyl peptidase/L-asparaginase 3; 
AltName: Full=L-asparagine amidohydrolase 3; Contains: RecName: 
Full=Isoaspartyl peptidase/L-asparaginase 3 subunit alpha; 
Contains: RecName: Full=Isoaspartyl peptidase/L-asparaginase 
3 subunit beta; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD95316.1| glycosylasparaginase - like protein [Arabidopsis thaliana]
 gb|AED97483.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
Length=359

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGACYGWTFQYSV  P MNDV+VFTVLP
Sbjct  331  HAGACYGWTFQYSVQNPDMNDVQVFTVLP  359



>ref|XP_006358231.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
isoform X2 [Solanum tuberosum]
Length=254

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQYSV  PGMNDV+VFTV P+
Sbjct  225  HAGACHGWTFQYSVRNPGMNDVKVFTVHPQ  254



>dbj|BAB08998.1| glycosylasparaginase-like protein [Arabidopsis thaliana]
Length=376

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGACYGWTFQYSV  P MNDV+VFTVLP
Sbjct  348  HAGACYGWTFQYSVQNPDMNDVQVFTVLP  376



>gb|KHN26458.1| Putative isoaspartyl peptidase/L-asparaginase 3 [Glycine soja]
Length=79

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1   HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
           HAGAC+GWTF+YSV  P M DVEVFTVLP
Sbjct  51  HAGACHGWTFKYSVKSPAMKDVEVFTVLP  79



>ref|XP_010693727.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
3 [Beta vulgaris subsp. vulgaris]
Length=400

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPETRSV  102
            HAGAC+GWTFQYSV  P M+DVEVFTV P++ SV
Sbjct  361  HAGACHGWTFQYSVRLPSMDDVEVFTVTPQSASV  394



>ref|XP_010318172.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Solanum lycopersicum]
Length=254

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQY V  PGMNDVEVFTV P+
Sbjct  225  HAGACHGWTFQYCVRTPGMNDVEVFTVHPQ  254



>ref|XP_011101108.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Sesamum indicum]
Length=261

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQYSV  P M DVEV+TV+PE
Sbjct  228  HAGACHGWTFQYSVRSPDMADVEVYTVIPE  257



>ref|XP_006358230.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
isoform X1 [Solanum tuberosum]
Length=350

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQYSV  PGMNDV+VFTV P+
Sbjct  321  HAGACHGWTFQYSVRNPGMNDVKVFTVHPQ  350



>ref|XP_010258812.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Nelumbo nucifera]
Length=258

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  PGM DV+VFTVLP
Sbjct  230  HAGACHGWTFQYSVRSPGMEDVKVFTVLP  258



>ref|XP_010662267.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 [Vitis 
vinifera]
 emb|CBI38641.3| unnamed protein product [Vitis vinifera]
Length=79

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1   HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
           HAGAC+GWTFQYSV  P M DVEVFTV P
Sbjct  51  HAGACHGWTFQYSVRSPEMEDVEVFTVFP  79



>ref|XP_002862538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38796.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=106

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            H+GAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  78   HSGACHGWTFQYSVQNPDMDDVQVFTVLP  106



>ref|XP_010258811.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Nelumbo nucifera]
Length=356

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  PGM DV+VFTVLP
Sbjct  328  HAGACHGWTFQYSVRSPGMEDVKVFTVLP  356



>ref|XP_004235423.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Solanum lycopersicum]
Length=350

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQY V  PGMNDVEVFTV P+
Sbjct  321  HAGACHGWTFQYCVRTPGMNDVEVFTVHPQ  350



>ref|XP_010483833.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X3 [Camelina sativa]
Length=257

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  229  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  257



>ref|XP_010457450.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X3 [Camelina sativa]
Length=257

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  229  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  257



>ref|XP_010546145.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Tarenaya hassleriana]
Length=258

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  229  HAGACHGWTFQYSVRDPDMDDVQVFTVLP  257



>gb|KJB51388.1| hypothetical protein B456_008G214900 [Gossypium raimondii]
Length=256

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  228  HAGACHGWTFQYSVRSPDMDDVKVFTVLP  256



>emb|CAN79007.1| hypothetical protein VITISV_040897 [Vitis vinifera]
Length=160

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M DVEVFTV P
Sbjct  132  HAGACHGWTFQYSVRSPEMEDVEVFTVFP  160



>ref|XP_006582412.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Glycine max]
Length=256

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DVEVFTVLP
Sbjct  228  HAGACHGWTFKYSVKSPAMKDVEVFTVLP  256



>ref|XP_007038310.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY22811.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 2 [Theobroma cacao]
Length=256

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  228  HAGACHGWTFQYSVRSPDMDDVKVFTVLP  256



>ref|XP_008778248.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X5 [Phoenix dactylifera]
Length=269

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVE+FTV+P
Sbjct  241  HAGACHGWTFQYSVRNPSMDDVEIFTVVP  269



>ref|XP_010483828.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Camelina sativa]
 ref|XP_010483829.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Camelina sativa]
 ref|XP_010483830.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Camelina sativa]
 ref|XP_010483831.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Camelina sativa]
Length=359

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  331  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  359



>ref|XP_010483832.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Camelina sativa]
Length=357

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  329  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  357



>ref|XP_010457448.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Camelina sativa]
Length=357

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  329  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  357



>ref|XP_010457441.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Camelina sativa]
Length=359

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  331  HAGACHGWTFQYSVQNPDMDDVQVFTVLP  359



>ref|XP_010546143.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546144.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Tarenaya hassleriana]
Length=362

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  333  HAGACHGWTFQYSVRDPDMDDVQVFTVLP  361



>emb|CDY23060.1| BnaC07g31270D [Brassica napus]
Length=355

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  327  HAGACHGWTFQYSVQDPNMDDVQVFTVLP  355



>ref|XP_009136487.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 [Brassica 
rapa]
 ref|XP_009136488.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 [Brassica 
rapa]
Length=356

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  328  HAGACHGWTFQYSVRDPNMDDVQVFTVLP  356



>emb|CDY02136.1| BnaA03g40310D [Brassica napus]
Length=356

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  328  HAGACHGWTFQYSVRDPNMDDVQVFTVLP  356



>ref|XP_011101107.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Sesamum indicum]
Length=363

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQYSV  P M DVEV+TV+PE
Sbjct  330  HAGACHGWTFQYSVRSPDMADVEVYTVIPE  359



>ref|XP_008778245.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Phoenix dactylifera]
Length=370

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVE+FTV+P
Sbjct  342  HAGACHGWTFQYSVRNPSMDDVEIFTVVP  370



>ref|XP_008778247.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X4 [Phoenix dactylifera]
Length=348

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVE+FTV+P
Sbjct  320  HAGACHGWTFQYSVRNPSMDDVEIFTVVP  348



>ref|XP_003527550.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Glycine max]
Length=356

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DVEVFTVLP
Sbjct  328  HAGACHGWTFKYSVKSPAMKDVEVFTVLP  356



>ref|XP_006394494.1| hypothetical protein EUTSA_v10004474mg [Eutrema salsugineum]
 gb|ESQ31780.1| hypothetical protein EUTSA_v10004474mg [Eutrema salsugineum]
Length=359

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  331  HAGACHGWTFQYSVQDPEMDDVQVFTVLP  359



>ref|XP_004499624.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
[Cicer arietinum]
Length=352

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DVEVFTVLP
Sbjct  324  HAGACHGWTFKYSVRSPAMKDVEVFTVLP  352



>ref|XP_008778246.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X3 [Phoenix dactylifera]
Length=361

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVE+FTV+P
Sbjct  333  HAGACHGWTFQYSVRNPSMDDVEIFTVVP  361



>ref|XP_008778244.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Phoenix dactylifera]
Length=375

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVE+FTV+P
Sbjct  347  HAGACHGWTFQYSVRNPSMDDVEIFTVVP  375



>gb|KJB51387.1| hypothetical protein B456_008G214900 [Gossypium raimondii]
Length=375

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  347  HAGACHGWTFQYSVRSPDMDDVKVFTVLP  375



>ref|XP_007038309.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY22810.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=357

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  329  HAGACHGWTFQYSVRSPDMDDVKVFTVLP  357



>gb|KHG13691.1| hypothetical protein F383_03902 [Gossypium arboreum]
Length=357

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+D++VFTVLP
Sbjct  329  HAGACHGWTFQYSVRSPDMDDIKVFTVLP  357



>ref|XP_007148726.1| hypothetical protein PHAVU_005G009200g [Phaseolus vulgaris]
 gb|ESW20720.1| hypothetical protein PHAVU_005G009200g [Phaseolus vulgaris]
Length=372

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DVEVFTVLP
Sbjct  342  HAGACHGWTFKYSVRSPSMEDVEVFTVLP  370



>ref|XP_010919666.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
3 [Elaeis guineensis]
Length=372

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M DVE+FTV+P
Sbjct  344  HAGACHGWTFQYSVRNPSMEDVEIFTVVP  372



>gb|KEH32842.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=254

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  226  HAGACHGWTFKYSVRSPAMKDVKVFTVLP  254



>ref|XP_002864737.1| hypothetical protein ARALYDRAFT_496317 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40996.1| hypothetical protein ARALYDRAFT_496317 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            H+GAC+GWTFQYSV  P M+DV+VFTVLP
Sbjct  331  HSGACHGWTFQYSVQNPDMDDVQVFTVLP  359



>gb|KDP22455.1| hypothetical protein JCGZ_26286 [Jatropha curcas]
Length=357

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DVEVFTV P
Sbjct  329  HAGACHGWTFQYSVRSPEMDDVEVFTVFP  357



>ref|XP_009372845.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Pyrus x bretschneideri]
Length=253

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TVLP
Sbjct  225  HAGACHGWTFQYSVRSPEMDDVKVYTVLP  253



>ref|XP_006281606.1| hypothetical protein CARUB_v10027724mg [Capsella rubella]
 gb|EOA14504.1| hypothetical protein CARUB_v10027724mg [Capsella rubella]
Length=371

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TVLP
Sbjct  343  HAGACHGWTFQYSVQNPDMDDVQVYTVLP  371



>ref|XP_008376394.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Malus domestica]
Length=253

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TVLP
Sbjct  225  HAGACHGWTFQYSVRSPEMDDVKVYTVLP  253



>ref|XP_003598180.1| hypothetical protein MTR_3g008180 [Medicago truncatula]
 gb|AES68431.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=353

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  325  HAGACHGWTFKYSVRSPAMKDVKVFTVLP  353



>ref|XP_002510993.1| n(4)-(beta-n-acetylglucosaminyl)-l-asparaginase, putative [Ricinus 
communis]
 gb|EEF51595.1| n(4)-(beta-n-acetylglucosaminyl)-l-asparaginase, putative [Ricinus 
communis]
Length=357

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P MN VEVFTV P
Sbjct  329  HAGACHGWTFQYSVRSPEMNKVEVFTVFP  357



>ref|XP_009370437.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009370438.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009372844.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Pyrus x bretschneideri]
Length=355

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TVLP
Sbjct  327  HAGACHGWTFQYSVRSPEMDDVKVYTVLP  355



>gb|EYU31310.1| hypothetical protein MIMGU_mgv1a025916mg, partial [Erythranthe 
guttata]
Length=340

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPE  90
            HAGAC+GWTFQYSV  P ++DV V+TV PE
Sbjct  307  HAGACHGWTFQYSVRTPDLDDVAVYTVTPE  336



>ref|XP_008376393.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Malus domestica]
Length=355

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TVLP
Sbjct  327  HAGACHGWTFQYSVRSPEMDDVKVYTVLP  355



>ref|XP_011470052.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=255

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TV+P
Sbjct  227  HAGACHGWTFQYSVRNPDMDDVKVYTVVP  255



>ref|XP_006490167.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
isoform X2 [Citrus sinensis]
Length=256

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  228  HAGACHGWTFKYSVRSPEMEDVKVFTVLP  256



>gb|KDO45284.1| hypothetical protein CISIN_1g018660mg [Citrus sinensis]
Length=261

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  233  HAGACHGWTFKYSVRSPEMEDVKVFTVLP  261



>ref|XP_008234431.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Prunus mume]
Length=256

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TV+P
Sbjct  228  HAGACHGWTFQYSVRSPEMDDVKVYTVVP  256



>ref|XP_010662264.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Vitis vinifera]
Length=256

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P   DVEVFTV P
Sbjct  228  HAGACHGWTFQYSVRSPEREDVEVFTVFP  256



>ref|XP_004307788.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=358

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TV+P
Sbjct  330  HAGACHGWTFQYSVRNPDMDDVKVYTVVP  358



>ref|XP_006421589.1| hypothetical protein CICLE_v10005302mg [Citrus clementina]
 gb|ESR34829.1| hypothetical protein CICLE_v10005302mg [Citrus clementina]
Length=352

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  324  HAGACHGWTFKYSVRSPEMEDVKVFTVLP  352



>ref|XP_010087277.1| putative isoaspartyl peptidase/L-asparaginase 3 [Morus notabilis]
 gb|EXB28724.1| putative isoaspartyl peptidase/L-asparaginase 3 [Morus notabilis]
Length=361

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPET  93
            HAGACYGWTFQYSV +P M+DV+V TV P +
Sbjct  329  HAGACYGWTFQYSVRRPLMDDVKVVTVHPHS  359



>gb|KDO45283.1| hypothetical protein CISIN_1g018660mg [Citrus sinensis]
Length=352

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  324  HAGACHGWTFKYSVRSPEMEDVKVFTVLP  352



>ref|XP_006490166.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
isoform X1 [Citrus sinensis]
Length=352

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P M DV+VFTVLP
Sbjct  324  HAGACHGWTFKYSVRSPEMEDVKVFTVLP  352



>ref|XP_009382441.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 [Musa 
acuminata subsp. malaccensis]
Length=371

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEVFTV+P
Sbjct  341  HAGACHGWTFQYSVRNSSMKDVEVFTVVP  369



>ref|XP_009629553.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 [Nicotiana 
tomentosiformis]
Length=349

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGA +GWTFQYSV  PGM DVEVFTV P
Sbjct  321  HAGASHGWTFQYSVRNPGMKDVEVFTVHP  349



>ref|XP_008234430.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Prunus mume]
Length=369

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TV+P
Sbjct  341  HAGACHGWTFQYSVRSPEMDDVKVYTVVP  369



>ref|XP_007218154.1| hypothetical protein PRUPE_ppa007409mg [Prunus persica]
 gb|EMJ19353.1| hypothetical protein PRUPE_ppa007409mg [Prunus persica]
Length=369

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+DV+V+TV+P
Sbjct  341  HAGACHGWTFQYSVRSPEMDDVKVYTVVP  369



>ref|XP_003634027.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Vitis vinifera]
 emb|CBI38635.3| unnamed protein product [Vitis vinifera]
Length=356

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P   DVEVFTV P
Sbjct  328  HAGACHGWTFQYSVRSPEREDVEVFTVFP  356



>ref|XP_004146906.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
[Cucumis sativus]
 ref|XP_004161588.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
[Cucumis sativus]
 gb|KGN53159.1| hypothetical protein Csa_4G022950 [Cucumis sativus]
Length=361

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GW FQYSV  P M+  EVFTVLP
Sbjct  333  HAGACHGWKFQYSVRSPEMHSAEVFTVLP  361



>ref|XP_009793579.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009793580.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Nicotiana sylvestris]
Length=253

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGA +GWTFQYSV  PGM D EVFTV P
Sbjct  225  HAGASHGWTFQYSVRNPGMKDAEVFTVHP  253



>ref|XP_009793578.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Nicotiana sylvestris]
Length=260

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGA +GWTFQYSV  PGM D EVFTV P
Sbjct  232  HAGASHGWTFQYSVRNPGMKDAEVFTVHP  260



>ref|XP_002970199.1| hypothetical protein SELMODRAFT_93118, partial [Selaginella moellendorffii]
 gb|EFJ28329.1| hypothetical protein SELMODRAFT_93118, partial [Selaginella moellendorffii]
Length=328

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HA AC+GWTF+YSV   GM+DVEV TVLP
Sbjct  298  HASACHGWTFRYSVWSKGMDDVEVITVLP  326



>dbj|BAJ94546.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=112

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  84   HAGACHGWTFQYSVRNSSMQDVEVITVTP  112



>ref|XP_004976431.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
[Setaria italica]
Length=383

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSVM   M+DVEV TV P
Sbjct  355  HAGACHGWTFQYSVMNSSMHDVEVITVYP  383



>ref|XP_010062502.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Eucalyptus grandis]
Length=259

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPETRSV  102
            HAGAC+GWTFQYSV    M++VE+FTV P T S+
Sbjct  224  HAGACHGWTFQYSVRSVEMDEVEIFTVQPATVSM  257



>ref|XP_010062494.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Eucalyptus grandis]
Length=264

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPETRSV  102
            HAGAC+GWTFQYSV    M++VE+FTV P T S+
Sbjct  229  HAGACHGWTFQYSVRSVEMDEVEIFTVQPATVSM  262



>ref|XP_008453886.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X3 [Cucumis melo]
Length=361

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV  P M+  +VFTVLP
Sbjct  333  HAGACHGWTFQYSVRSPEMHSAKVFTVLP  361



>ref|XP_002320603.2| hypothetical protein POPTR_0014s18850g [Populus trichocarpa]
 gb|EEE98918.2| hypothetical protein POPTR_0014s18850g [Populus trichocarpa]
Length=358

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P   DVEVFTVLP
Sbjct  330  HAGACHGWTFEYSVRSPVTVDVEVFTVLP  358



>gb|EAY95071.1| hypothetical protein OsI_16887 [Oryza sativa Indica Group]
Length=274

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  246  HAGACHGWTFQYSVRNSSMQDVEVITVSP  274



>gb|KCW90866.1| hypothetical protein EUGRSUZ_A02913 [Eucalyptus grandis]
Length=362

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPETRSV  102
            HAGAC+GWTFQYSV    M++VE+FTV P T S+
Sbjct  327  HAGACHGWTFQYSVRSVEMDEVEIFTVQPATVSM  360



>ref|XP_002978364.1| hypothetical protein SELMODRAFT_108968, partial [Selaginella 
moellendorffii]
 gb|EFJ20350.1| hypothetical protein SELMODRAFT_108968, partial [Selaginella 
moellendorffii]
Length=328

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV   GM+ VEV TVLP
Sbjct  298  HAGACHGWTFRYSVWSKGMDVVEVITVLP  326



>dbj|BAJ89836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  257  HAGACHGWTFQYSVRNSSMQDVEVITVTP  285



>emb|CAH67499.1| OSIGBa0134H18.1 [Oryza sativa Indica Group]
 emb|CAH67618.1| OSIGBa0106P14.8 [Oryza sativa Indica Group]
Length=387

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  359  HAGACHGWTFQYSVRNSSMQDVEVITVSP  387



>ref|NP_001146491.1| uncharacterized LOC100280081 [Zea mays]
 gb|ACF81269.1| unknown [Zea mays]
 gb|ACL54140.1| unknown [Zea mays]
 tpg|DAA36564.1| TPA: L-asparaginase-like family protein isoform 1 [Zea mays]
 tpg|DAA36565.1| TPA: L-asparaginase-like family protein isoform 2 [Zea mays]
 tpg|DAA36566.1| TPA: L-asparaginase-like family protein isoform 3 [Zea mays]
Length=273

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  245  HAGACHGWTFQYSVRNSSMQDVEVITVYP  273



>ref|XP_011011171.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X3 [Populus euphratica]
Length=256

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P   DV+VFTVLP
Sbjct  228  HAGACHGWTFEYSVRSPVTVDVKVFTVLP  256



>ref|XP_011011169.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Populus euphratica]
Length=261

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P   DV+VFTVLP
Sbjct  233  HAGACHGWTFEYSVRSPVTVDVKVFTVLP  261



>gb|EMS46487.1| putative isoaspartyl peptidase/L-asparaginase 3 [Triticum urartu]
Length=397

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  369  HAGACHGWTFQYSVRNSSMQDVEVITVTP  397



>ref|NP_001053482.1| Os04g0549300 [Oryza sativa Japonica Group]
 dbj|BAF15396.1| Os04g0549300 [Oryza sativa Japonica Group]
 dbj|BAG88636.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61446.1| hypothetical protein OsJ_15685 [Oryza sativa Japonica Group]
Length=387

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  359  HAGACHGWTFQYSVRNSSMQDVEVITVSP  387



>gb|ACF83691.1| unknown [Zea mays]
 tpg|DAA36562.1| TPA: L-asparaginase-like family protein [Zea mays]
Length=383

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  355  HAGACHGWTFQYSVRNSSMQDVEVITVYP  383



>gb|EMT19471.1| Putative isoaspartyl peptidase/L-asparaginase 3 [Aegilops tauschii]
Length=622

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  594  HAGACHGWTFQYSVRNSSMLDVEVITVTP  622



>ref|XP_011011168.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Populus euphratica]
Length=358

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTF+YSV  P   DV+VFTVLP
Sbjct  330  HAGACHGWTFEYSVRSPVTVDVKVFTVLP  358



>ref|XP_006653646.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3-like 
[Oryza brachyantha]
Length=369

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYS+    M DVEV TV P
Sbjct  341  HAGACHGWTFQYSLRNSSMQDVEVITVAP  369



>ref|XP_010240209.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X2 [Brachypodium distachyon]
Length=280

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  245  HAGACHGWTFQYSVRNFSMQDVEVITVTP  273



>ref|XP_003581496.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 3 isoform 
X1 [Brachypodium distachyon]
Length=387

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLP  87
            HAGAC+GWTFQYSV    M DVEV TV P
Sbjct  352  HAGACHGWTFQYSVRNFSMQDVEVITVTP  380



>gb|EPS60153.1| hypothetical protein M569_14648 [Genlisea aurea]
Length=359

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  1    HAGACYGWTFQYSVMKPGMNDVEVFTVLPETR-SVR*RSML  120
            HAGA + W FQY+VM P M+DV+VFTV P+    VR  S++
Sbjct  315  HAGASHRWDFQYAVMSPEMDDVQVFTVRPQINVEVRNNSLM  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561347857865