BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003E11 653 bp,

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KGN53232.1|  hypothetical protein Csa_4G031030                     55.1    9e-06   Cucumis sativus [cucumbers]
gb|KHN38204.1|  Putative ribosome biogenesis protein C16orf42 like    53.5    2e-05   Glycine soja [wild soybean]
emb|CDP20798.1|  unnamed protein product                              53.1    4e-05   Coffea canephora [robusta coffee]
ref|XP_004149142.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  52.4    6e-05   
gb|EPS67198.1|  hypothetical protein M569_07576                       51.2    1e-04   Genlisea aurea
ref|XP_009625605.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  51.2    1e-04   Nicotiana tomentosiformis
ref|XP_009766591.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   Nicotiana sylvestris
ref|XP_008453772.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   Cucumis melo [Oriental melon]
ref|XP_004163491.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   
ref|XP_008453773.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   Cucumis melo [Oriental melon]
ref|XP_011090453.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   Sesamum indicum [beniseed]
ref|XP_011090454.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.8    2e-04   Sesamum indicum [beniseed]
ref|XP_007048052.1|  RNase L inhibitor protein-related isoform 1      50.1    3e-04   Theobroma cacao [chocolate]
ref|XP_010652841.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  50.1    4e-04   Vitis vinifera
ref|XP_006345858.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.7    5e-04   Solanum tuberosum [potatoes]
ref|XP_004239718.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.7    5e-04   Solanum lycopersicum
ref|XP_002528990.1|  conserved hypothetical protein                   49.7    5e-04   
emb|CBI21472.3|  unnamed protein product                              49.7    5e-04   Vitis vinifera
ref|XP_008352614.1|  PREDICTED: ribosome biogenesis protein TSR3-...  47.4    5e-04   Malus domestica [apple tree]
ref|XP_009342065.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    6e-04   Pyrus x bretschneideri [bai li]
ref|XP_003558599.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_006464289.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    7e-04   
ref|XP_006428125.1|  hypothetical protein CICLE_v10027591mg           49.3    7e-04   Citrus clementina
emb|CDY21628.1|  BnaC09g46640D                                        49.3    7e-04   Brassica napus [oilseed rape]
gb|AAZ67589.1|  80A08_4                                               49.7    7e-04   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010261184.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    7e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010491660.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    7e-04   Camelina sativa [gold-of-pleasure]
emb|CDX69863.1|  BnaA10g22120D                                        49.3    7e-04   Brassica napus [oilseed rape]
gb|KFK25302.1|  hypothetical protein AALP_AA8G094800                  49.3    7e-04   Arabis alpina [alpine rockcress]
ref|XP_006399497.1|  hypothetical protein EUTSA_v10014396mg           49.3    7e-04   Eutrema salsugineum
ref|XP_009122094.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    8e-04   Brassica rapa
ref|XP_010422897.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010261183.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    8e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010453027.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  48.9    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010030402.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  49.3    8e-04   Eucalyptus grandis [rose gum]
ref|XP_006288455.1|  hypothetical protein CARUB_v10001716mg           48.9    8e-04   Capsella rubella
gb|KCW54424.1|  hypothetical protein EUGRSUZ_I00376                   48.9    8e-04   Eucalyptus grandis [rose gum]
ref|XP_010692227.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  48.9    9e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_196569.1|  RNase L inhibitor protein-like protein              48.9    9e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMT09906.1|  hypothetical protein F775_30268                       48.9    9e-04   Aegilops tauschii
ref|XP_011468387.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  48.5    9e-04   Fragaria vesca subsp. vesca
gb|ACK44518.1|  AT5G10070-like protein                                48.9    0.001   Arabidopsis arenosa
ref|XP_010547631.1|  PREDICTED: ribosome biogenesis protein TSR3 ...  48.9    0.001   Tarenaya hassleriana [spider flower]
ref|NP_974761.1|  RNase L inhibitor protein-like protein              48.9    0.001   Arabidopsis thaliana [mouse-ear cress]



>gb|KGN53232.1| hypothetical protein Csa_4G031030 [Cucumis sativus]
Length=386

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK----ASIFLYFVTLMLNISKTYISR  442
            ++L + DFGQCD+KRCTGRKLARFGLLK     ++   F + + N+    +S+
Sbjct  140  IHLAMWDFGQCDAKRCTGRKLARFGLLKEHAGENLMDGFASQVENVQNEELSK  192



>gb|KHN38204.1| Putative ribosome biogenesis protein C16orf42 like [Glycine soja]
Length=245

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLKASIFLYFVTLM  472
            + L + DFGQCD+KRCTGRKL+R G+LKASI L  + L+
Sbjct  45   IKLAMWDFGQCDAKRCTGRKLSRLGILKASILLETIFLL  83



>emb|CDP20798.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLKASIFLYF  484
            + L + DFGQCD+KRCTGRKLARFGLLK  IF+ F
Sbjct  60   IQLAMWDFGQCDAKRCTGRKLARFGLLK-EIFVPF  93



>ref|XP_004149142.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Cucumis 
sativus]
Length=265

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            ++L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  47   IHLAMWDFGQCDAKRCTGRKLARFGLLK  74



>gb|EPS67198.1| hypothetical protein M569_07576, partial [Genlisea aurea]
Length=225

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLKASIFL  490
            + L + DFGQCD+K+CTGRKLARFG LK SI L
Sbjct  11   IQLAMWDFGQCDAKKCTGRKLARFGFLKESICL  43



>ref|XP_009625605.1| PREDICTED: ribosome biogenesis protein TSR3 homolog {ECO:0000255|HAMAP-Rule:MF_03146} 
[Nicotiana tomentosiformis]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  50   VQLAMWDFGQCDAKRCTGRKLARFGLLK  77



>ref|XP_009766591.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Nicotiana 
sylvestris]
Length=266

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARFG+LK
Sbjct  50   VQLAMWDFGQCDAKRCTGRKLARFGMLK  77



>ref|XP_008453772.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X1 
[Cucumis melo]
Length=267

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  47   IQLAMWDFGQCDAKRCTGRKLARFGLLK  74



>ref|XP_004163491.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Cucumis 
sativus]
Length=265

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  47   IQLAMWDFGQCDAKRCTGRKLARFGLLK  74



>ref|XP_008453773.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X2 
[Cucumis melo]
Length=265

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  47   IQLAMWDFGQCDAKRCTGRKLARFGLLK  74



>ref|XP_011090453.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X1 
[Sesamum indicum]
Length=272

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  52   IQLAMWDFGQCDAKRCTGRKLARFGLLK  79



>ref|XP_011090454.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X2 
[Sesamum indicum]
Length=271

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLLK
Sbjct  51   IQLAMWDFGQCDAKRCTGRKLARFGLLK  78



>ref|XP_007048052.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao]
 ref|XP_007048053.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao]
 gb|EOX92209.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao]
 gb|EOX92210.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao]
Length=261

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFG+LK
Sbjct  47   IQLAMWDFGQCDAKRCTGRKLARFGMLK  74



>ref|XP_010652841.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Vitis vinifera]
Length=288

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKL+RFGLLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLSRFGLLK  74



>ref|XP_006345858.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Solanum 
tuberosum]
Length=268

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLL+
Sbjct  51   IQLAMWDFGQCDAKRCTGRKLARFGLLR  78



>ref|XP_004239718.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Solanum 
lycopersicum]
Length=268

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKLARFGLL+
Sbjct  51   IQLAMWDFGQCDAKRCTGRKLARFGLLR  78



>ref|XP_002528990.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33409.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKL RFGLLK
Sbjct  48   VQLAMWDFGQCDAKRCTGRKLGRFGLLK  75



>emb|CBI21472.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKL+RFGLLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLSRFGLLK  74



>ref|XP_008352614.1| PREDICTED: ribosome biogenesis protein TSR3-like [Malus domestica]
 ref|XP_008361507.1| PREDICTED: ribosome biogenesis protein TSR3-like [Malus domestica]
Length=115

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFG LK
Sbjct  51   IQLAMWDFGQCDAKRCTGRKLSRFGFLK  78



>ref|XP_009342065.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Pyrus x 
bretschneideri]
Length=270

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFGLLK
Sbjct  50   IQLAMWDFGQCDAKRCTGRKLSRFGLLK  77



>ref|XP_003558599.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Brachypodium 
distachyon]
 ref|XP_010229045.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Brachypodium 
distachyon]
Length=271

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFGLLK
Sbjct  49   IQLAMWDFGQCDAKRCTGRKLSRFGLLK  76



>ref|XP_006464289.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Citrus sinensis]
Length=264

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_006428125.1| hypothetical protein CICLE_v10027591mg [Citrus clementina]
 gb|ESR41365.1| hypothetical protein CICLE_v10027591mg [Citrus clementina]
Length=279

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>emb|CDY21628.1| BnaC09g46640D [Brassica napus]
Length=296

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>gb|AAZ67589.1| 80A08_4 [Brassica rapa subsp. pekinensis]
Length=449

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_010261184.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X2 
[Nelumbo nucifera]
Length=259

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD KRCTGRKLARFGLLK
Sbjct  52   IQLAMWDFGQCDVKRCTGRKLARFGLLK  79



>ref|XP_010491660.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Camelina 
sativa]
Length=271

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>emb|CDX69863.1| BnaA10g22120D [Brassica napus]
Length=297

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>gb|KFK25302.1| hypothetical protein AALP_AA8G094800 [Arabis alpina]
Length=292

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  48   VQLAMWDFGQCDAKRCTGRKLARFNLLK  75



>ref|XP_006399497.1| hypothetical protein EUTSA_v10014396mg [Eutrema salsugineum]
 gb|ESQ40950.1| hypothetical protein EUTSA_v10014396mg [Eutrema salsugineum]
Length=268

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_009122094.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Brassica 
rapa]
Length=296

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_010422897.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Camelina 
sativa]
Length=271

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_010261183.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X1 
[Nelumbo nucifera]
Length=271

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD KRCTGRKLARFGLLK
Sbjct  52   IQLAMWDFGQCDVKRCTGRKLARFGLLK  79



>ref|XP_010453027.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Camelina 
sativa]
Length=271

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_010030402.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Eucalyptus 
grandis]
Length=328

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFGL+K
Sbjct  106  IQLAMWDFGQCDAKRCTGRKLSRFGLIK  133



>ref|XP_006288455.1| hypothetical protein CARUB_v10001716mg [Capsella rubella]
 gb|EOA21353.1| hypothetical protein CARUB_v10001716mg [Capsella rubella]
Length=269

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>gb|KCW54424.1| hypothetical protein EUGRSUZ_I00376 [Eucalyptus grandis]
Length=274

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFGL+K
Sbjct  48   IQLAMWDFGQCDAKRCTGRKLSRFGLIK  75



>ref|XP_010692227.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  49   VQLAMWDFGQCDAKRCTGRKLARFNLLK  76



>ref|NP_196569.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana]
 emb|CAB92048.1| putative protein [Arabidopsis thaliana]
 gb|AAO24528.1| At5g10070 [Arabidopsis thaliana]
 dbj|BAE99661.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91490.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana]
Length=264

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  44   VQLAMWDFGQCDAKRCTGRKLARFNLLK  71



>gb|EMT09906.1| hypothetical protein F775_30268 [Aegilops tauschii]
Length=313

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L + DFGQCD+KRCTGRKL+RFGLLK
Sbjct  75   IQLAMWDFGQCDAKRCTGRKLSRFGLLK  102



>ref|XP_011468387.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Fragaria 
vesca subsp. vesca]
Length=214

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            + L++ DFGQCD+KRCTGRKL+RFG LK
Sbjct  50   IQLVMWDFGQCDAKRCTGRKLSRFGFLK  77



>gb|ACK44518.1| AT5G10070-like protein [Arabidopsis arenosa]
Length=267

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLARFNLLK  74



>ref|XP_010547631.1| PREDICTED: ribosome biogenesis protein TSR3 homolog [Tarenaya 
hassleriana]
Length=265

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKL+RFGLL+
Sbjct  47   VQLAMWDFGQCDAKRCTGRKLSRFGLLR  74



>ref|NP_974761.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana]
 gb|AED91489.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana]
Length=266

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  588  VYLLV*DFGQCDSKRCTGRKLARFGLLK  505
            V L + DFGQCD+KRCTGRKLARF LLK
Sbjct  44   VQLAMWDFGQCDAKRCTGRKLARFNLLK  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660