BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003E07 635 bp,

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006403265.1|  hypothetical protein EUTSA_v10003134mg             135   9e-33   Eutrema salsugineum
gb|KFK31044.1|  hypothetical protein AALP_AA6G060800                    133   7e-32   Arabis alpina [alpine rockcress]
emb|CBI23663.3|  unnamed protein product                                133   8e-32   Vitis vinifera
ref|XP_010494311.1|  PREDICTED: uncharacterized protein LOC104771477    132   1e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001190461.1|  COP1-interacting protein-like protein              132   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190459.1|  COP1-interacting protein-like protein              132   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484868.1|  PREDICTED: uncharacterized protein LOC104763157    132   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009123882.1|  PREDICTED: uncharacterized protein LOC103848...    132   2e-31   Brassica rapa
emb|CDY14872.1|  BnaA02g22140D                                          132   2e-31   Brassica napus [oilseed rape]
ref|XP_008802181.1|  PREDICTED: uncharacterized protein LOC103716091    132   2e-31   Phoenix dactylifera
ref|XP_009123881.1|  PREDICTED: uncharacterized protein LOC103848...    132   2e-31   Brassica rapa
ref|XP_009123880.1|  PREDICTED: uncharacterized protein LOC103848...    132   2e-31   Brassica rapa
ref|XP_009123883.1|  PREDICTED: uncharacterized protein LOC103848...    132   2e-31   Brassica rapa
gb|KDP40353.1|  hypothetical protein JCGZ_02351                         132   2e-31   Jatropha curcas
ref|NP_568624.1|  COP1-interacting protein-like protein                 132   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403264.1|  hypothetical protein EUTSA_v10003134mg             132   2e-31   Eutrema salsugineum
dbj|BAB10594.1|  unnamed protein product                                132   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009594212.1|  PREDICTED: uncharacterized protein LOC104090745    132   2e-31   Nicotiana tomentosiformis
ref|XP_009759151.1|  PREDICTED: uncharacterized protein LOC104211747    132   3e-31   Nicotiana sylvestris
ref|XP_009384650.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010671008.1|  PREDICTED: uncharacterized protein LOC104887...    131   3e-31   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010671007.1|  PREDICTED: uncharacterized protein LOC104887...    131   3e-31   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDO99248.1|  unnamed protein product                                131   3e-31   Coffea canephora [robusta coffee]
gb|KDO57566.1|  hypothetical protein CISIN_1g0369511mg                  130   4e-31   Citrus sinensis [Valencia orange]
ref|XP_010442037.1|  PREDICTED: uncharacterized protein LOC104725...    131   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010264948.1|  PREDICTED: uncharacterized protein LOC104602815    130   8e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006489705.1|  PREDICTED: dentin sialophosphoprotein-like         130   9e-31   Citrus sinensis [Valencia orange]
ref|XP_006354471.1|  PREDICTED: uncharacterized protein LOC102583985    130   1e-30   Solanum tuberosum [potatoes]
ref|XP_011073557.1|  PREDICTED: uncharacterized protein LOC105158471    129   1e-30   Sesamum indicum [beniseed]
ref|XP_006420261.1|  hypothetical protein CICLE_v10004168mg             129   1e-30   Citrus clementina
emb|CDY22355.1|  BnaA06g36770D                                          129   2e-30   Brassica napus [oilseed rape]
ref|XP_009101794.1|  PREDICTED: uncharacterized protein LOC103827980    129   2e-30   Brassica rapa
ref|XP_007035158.1|  COP1-interacting protein-related, putative i...    129   2e-30   Theobroma cacao [chocolate]
ref|XP_009376986.1|  PREDICTED: uncharacterized protein LOC103965641    129   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_008391232.1|  PREDICTED: uncharacterized protein LOC103453465    129   3e-30   Malus domestica [apple tree]
ref|XP_010102613.1|  hypothetical protein L484_011725                   128   3e-30   Morus notabilis
ref|XP_007035154.1|  COP1-interacting protein-related, putative i...    128   3e-30   Theobroma cacao [chocolate]
ref|XP_007035155.1|  COP1-interacting protein-related, putative i...    128   3e-30   Theobroma cacao [chocolate]
ref|XP_007035153.1|  COP1-interacting protein-related, putative i...    128   4e-30   Theobroma cacao [chocolate]
ref|XP_010326768.1|  PREDICTED: uncharacterized protein LOC101255735    128   4e-30   Solanum lycopersicum
ref|XP_010650107.1|  PREDICTED: uncharacterized protein LOC100251...    128   5e-30   Vitis vinifera
ref|XP_010650108.1|  PREDICTED: uncharacterized protein LOC100251...    128   5e-30   Vitis vinifera
ref|XP_007035156.1|  COP1-interacting protein-related, putative i...    128   5e-30   Theobroma cacao [chocolate]
ref|XP_009358041.1|  PREDICTED: uncharacterized protein LOC103948...    127   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_009358042.1|  PREDICTED: uncharacterized protein LOC103948...    127   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_009358032.1|  PREDICTED: uncharacterized protein LOC103948701    127   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_002863666.1|  hypothetical protein ARALYDRAFT_494672             127   9e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_002311679.1|  hypothetical protein POPTR_0008s16810g             127   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011029807.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   1e-29   Populus euphratica
ref|XP_002489097.1|  hypothetical protein SORBIDRAFT_0073s002020        117   2e-29   Sorghum bicolor [broomcorn]
ref|XP_008391239.1|  PREDICTED: uncharacterized protein LOC103453473    125   2e-29   Malus domestica [apple tree]
gb|KJB38392.1|  hypothetical protein B456_006G252900                    125   2e-29   Gossypium raimondii
ref|XP_007225456.1|  hypothetical protein PRUPE_ppa000302mg             125   3e-29   Prunus persica
ref|XP_008224333.1|  PREDICTED: probable GPI-anchored adhesin-lik...    125   3e-29   Prunus mume [ume]
ref|XP_009401936.1|  PREDICTED: uncharacterized protein LOC103985...    125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401933.1|  PREDICTED: uncharacterized protein LOC103985...    125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401935.1|  PREDICTED: uncharacterized protein LOC103985...    125   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38393.1|  hypothetical protein B456_006G252900                    125   5e-29   Gossypium raimondii
ref|XP_007145900.1|  hypothetical protein PHAVU_007G277200g             125   5e-29   Phaseolus vulgaris [French bean]
ref|XP_007145901.1|  hypothetical protein PHAVU_007G277200g             125   5e-29   Phaseolus vulgaris [French bean]
ref|XP_007145902.1|  hypothetical protein PHAVU_007G277200g             125   5e-29   Phaseolus vulgaris [French bean]
ref|XP_007145899.1|  hypothetical protein PHAVU_007G277200g             125   5e-29   Phaseolus vulgaris [French bean]
ref|XP_003519712.1|  PREDICTED: uncharacterized protein LOC100776...    124   6e-29   Glycine max [soybeans]
gb|KJB38391.1|  hypothetical protein B456_006G252900                    124   6e-29   Gossypium raimondii
ref|XP_009383975.1|  PREDICTED: uncharacterized protein LOC103971636    124   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38390.1|  hypothetical protein B456_006G252900                    124   7e-29   Gossypium raimondii
gb|KHN00274.1|  hypothetical protein glysoja_022878                     124   7e-29   Glycine soja [wild soybean]
ref|XP_004296379.1|  PREDICTED: uncharacterized protein LOC101304269    124   8e-29   Fragaria vesca subsp. vesca
ref|XP_011091290.1|  PREDICTED: uncharacterized protein LOC105171...    124   9e-29   Sesamum indicum [beniseed]
ref|XP_011091292.1|  PREDICTED: uncharacterized protein LOC105171...    124   9e-29   Sesamum indicum [beniseed]
ref|XP_011091289.1|  PREDICTED: uncharacterized protein LOC105171...    124   9e-29   Sesamum indicum [beniseed]
ref|XP_011091291.1|  PREDICTED: uncharacterized protein LOC105171...    124   9e-29   Sesamum indicum [beniseed]
ref|XP_010523166.1|  PREDICTED: uncharacterized protein LOC104801554    124   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_011030481.1|  PREDICTED: uncharacterized protein LOC105129...    124   2e-28   Populus euphratica
ref|XP_010906787.1|  PREDICTED: uncharacterized protein LOC105033613    123   2e-28   Elaeis guineensis
emb|CDY47813.1|  BnaC07g17040D                                          122   3e-28   Brassica napus [oilseed rape]
gb|KHN10069.1|  hypothetical protein glysoja_034311                     122   3e-28   Glycine soja [wild soybean]
gb|KHG12236.1|  Protein lifeguard 1                                     122   4e-28   Gossypium arboreum [tree cotton]
ref|XP_010934302.1|  PREDICTED: uncharacterized protein LOC105054...    121   7e-28   Elaeis guineensis
ref|XP_006279941.1|  hypothetical protein CARUB_v10025805mg             121   9e-28   Capsella rubella
gb|EPS65746.1|  hypothetical protein M569_09031                         117   1e-27   Genlisea aurea
ref|XP_010934301.1|  PREDICTED: uncharacterized protein LOC105054...    121   1e-27   Elaeis guineensis
ref|XP_010069119.1|  PREDICTED: uncharacterized protein LOC104456093    120   2e-27   Eucalyptus grandis [rose gum]
ref|XP_003590837.1|  COP1-interacting protein                           120   3e-27   
ref|XP_006650936.1|  PREDICTED: uncharacterized protein LOC102700882    119   3e-27   Oryza brachyantha
ref|XP_002528832.1|  conserved hypothetical protein                     119   4e-27   
ref|XP_011030478.1|  PREDICTED: uncharacterized protein LOC105129...    119   5e-27   Populus euphratica
gb|KHG23764.1|  Methylmalonyl-CoA mutase large subunit                  119   5e-27   Gossypium arboreum [tree cotton]
ref|XP_004956087.1|  PREDICTED: uncharacterized protein LOC101774245    118   9e-27   Setaria italica
ref|XP_008460655.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    118   1e-26   
ref|XP_002466054.1|  hypothetical protein SORBIDRAFT_01g000280          118   1e-26   Sorghum bicolor [broomcorn]
ref|XP_009382002.1|  PREDICTED: uncharacterized protein LOC103970089    118   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785220.1|  PREDICTED: uncharacterized protein LOC103703928    118   1e-26   Phoenix dactylifera
ref|XP_008652311.1|  PREDICTED: uncharacterized protein LOC103632278    117   2e-26   Zea mays [maize]
gb|EMT26204.1|  hypothetical protein F775_01959                         117   2e-26   Aegilops tauschii
ref|NP_001051978.1|  Os03g0861100                                       117   3e-26   
gb|EEC76590.1|  hypothetical protein OsI_14439                          117   3e-26   Oryza sativa Indica Group [Indian rice]
gb|EEE60346.1|  hypothetical protein OsJ_13460                          117   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30584.1|  hypothetical protein glysoja_030021                     117   3e-26   Glycine soja [wild soybean]
ref|XP_004980952.1|  PREDICTED: uncharacterized protein LOC101783885    117   4e-26   Setaria italica
gb|KJB28480.1|  hypothetical protein B456_005G050900                    115   8e-26   Gossypium raimondii
ref|XP_004497981.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    115   1e-25   Cicer arietinum [garbanzo]
ref|NP_001059533.1|  Os07g0445600                                       114   2e-25   
gb|EMS67669.1|  hypothetical protein TRIUR3_15284                       115   2e-25   Triticum urartu
gb|AES61088.2|  COP1-interacting-like protein                           114   2e-25   Medicago truncatula
ref|XP_003563185.1|  PREDICTED: uncharacterized protein LOC100821282    114   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_010228578.1|  PREDICTED: uncharacterized protein LOC100826...    114   2e-25   
gb|EEE67090.1|  hypothetical protein OsJ_24074                          114   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665790.1|  PREDICTED: microtubule-associated protein fu...    114   3e-25   Zea mays [maize]
gb|EEC81954.1|  hypothetical protein OsI_25833                          113   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006857334.1|  hypothetical protein AMTR_s00067p00089960          113   5e-25   Amborella trichopoda
gb|EMT12062.1|  hypothetical protein F775_32660                         112   9e-25   Aegilops tauschii
emb|CDP05883.1|  unnamed protein product                                112   1e-24   Coffea canephora [robusta coffee]
ref|XP_006658517.1|  PREDICTED: uncharacterized protein LOC102703415    112   1e-24   Oryza brachyantha
ref|XP_007144033.1|  hypothetical protein PHAVU_007G123500g             112   1e-24   Phaseolus vulgaris [French bean]
ref|XP_004168400.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   1e-24   
gb|KGN61590.1|  hypothetical protein Csa_2G173580                       112   1e-24   Cucumis sativus [cucumbers]
ref|XP_004147152.1|  PREDICTED: uncharacterized protein LOC101205835    112   1e-24   
ref|XP_003557289.1|  PREDICTED: uncharacterized protein LOC100826...    112   2e-24   Brachypodium distachyon [annual false brome]
gb|EMS50566.1|  hypothetical protein TRIUR3_31968                       111   2e-24   Triticum urartu
gb|EPS66126.1|  hypothetical protein M569_08650                         107   3e-24   Genlisea aurea
gb|EYU18308.1|  hypothetical protein MIMGU_mgv1a000492mg                111   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_011098337.1|  PREDICTED: uncharacterized protein LOC105177021    110   5e-24   Sesamum indicum [beniseed]
ref|XP_006606379.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   8e-24   Glycine max [soybeans]
ref|XP_006606378.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   9e-24   Glycine max [soybeans]
ref|XP_002965831.1|  hypothetical protein SELMODRAFT_85048              102   1e-23   Selaginella moellendorffii
gb|KDO74141.1|  hypothetical protein CISIN_1g001001mg                   108   1e-23   Citrus sinensis [Valencia orange]
ref|XP_006451934.1|  hypothetical protein CICLE_v10007365mg             108   1e-23   Citrus clementina
ref|XP_006606377.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   2e-23   Glycine max [soybeans]
gb|KHN05080.1|  hypothetical protein glysoja_013987                     109   2e-23   Glycine soja [wild soybean]
ref|XP_006464713.1|  PREDICTED: dentin sialophosphoprotein-like         108   2e-23   Citrus sinensis [Valencia orange]
gb|KDO74140.1|  hypothetical protein CISIN_1g001001mg                   108   2e-23   Citrus sinensis [Valencia orange]
gb|AAP44760.1|  hypothetical protein                                    108   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EYU32568.1|  hypothetical protein MIMGU_mgv1a000420mg                107   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_002983080.1|  hypothetical protein SELMODRAFT_179883             103   6e-23   Selaginella moellendorffii
ref|XP_003596469.1|  COP1-interacting protein                           107   7e-23   
gb|KEH41075.1|  COP1-interacting-like protein                           107   7e-23   Medicago truncatula
gb|EYU26404.1|  hypothetical protein MIMGU_mgv1a000705mg                107   8e-23   Erythranthe guttata [common monkey flower]
gb|KHG27241.1|  mRNA transport                                          101   2e-22   Gossypium arboreum [tree cotton]
ref|XP_010675617.1|  PREDICTED: uncharacterized protein LOC104891...    105   3e-22   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010675616.1|  PREDICTED: uncharacterized protein LOC104891...    105   3e-22   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CBI38326.3|  unnamed protein product                                103   3e-22   Vitis vinifera
ref|XP_010099013.1|  hypothetical protein L484_025673                   104   5e-22   Morus notabilis
ref|XP_004141235.1|  PREDICTED: uncharacterized protein LOC101209039    104   5e-22   Cucumis sativus [cucumbers]
ref|XP_006348387.1|  PREDICTED: microtubule-associated protein fu...    104   7e-22   Solanum tuberosum [potatoes]
ref|XP_008452483.1|  PREDICTED: dentin sialophosphoprotein isofor...    103   8e-22   Cucumis melo [Oriental melon]
ref|XP_008452486.1|  PREDICTED: dentin sialophosphoprotein isofor...    103   9e-22   Cucumis melo [Oriental melon]
ref|XP_008452485.1|  PREDICTED: dentin sialophosphoprotein isofor...    103   9e-22   Cucumis melo [Oriental melon]
ref|XP_010060529.1|  PREDICTED: uncharacterized protein LOC104448416    103   1e-21   Eucalyptus grandis [rose gum]
emb|CAN80688.1|  hypothetical protein VITISV_021551                     103   2e-21   Vitis vinifera
ref|XP_010245324.1|  PREDICTED: uncharacterized protein LOC104588898    102   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009378487.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_003541853.1|  PREDICTED: dentin sialophosphoprotein-like         102   3e-21   Glycine max [soybeans]
gb|KHN36797.1|  hypothetical protein glysoja_001528                     102   3e-21   Glycine soja [wild soybean]
ref|XP_009782944.1|  PREDICTED: uncharacterized protein LOC104231622    102   3e-21   Nicotiana sylvestris
ref|XP_007149609.1|  hypothetical protein PHAVU_005G084000g             102   5e-21   Phaseolus vulgaris [French bean]
ref|XP_006592902.1|  PREDICTED: dentin sialophosphoprotein-like         100   7e-21   Glycine max [soybeans]
ref|XP_011042495.1|  PREDICTED: uncharacterized protein LOC105138171    100   9e-21   Populus euphratica
ref|XP_007021335.1|  COP1-interacting protein 7, putative isoform 1     100   1e-20   Theobroma cacao [chocolate]
ref|XP_007021336.1|  COP1-interacting protein 7, putative isoform 2     100   1e-20   Theobroma cacao [chocolate]
ref|XP_008366718.1|  PREDICTED: dentin sialophosphoprotein-like i...    100   1e-20   Malus domestica [apple tree]
ref|XP_008366710.1|  PREDICTED: dentin sialophosphoprotein-like i...    100   1e-20   Malus domestica [apple tree]
gb|EYU27942.1|  hypothetical protein MIMGU_mgv1a001202mg                100   1e-20   Erythranthe guttata [common monkey flower]
ref|XP_006378327.1|  hypothetical protein POPTR_0010s08090g             100   2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004291665.1|  PREDICTED: uncharacterized protein LOC101305821    100   2e-20   Fragaria vesca subsp. vesca
ref|XP_009592524.1|  PREDICTED: uncharacterized protein LOC104089...    100   2e-20   Nicotiana tomentosiformis
ref|XP_009592525.1|  PREDICTED: uncharacterized protein LOC104089...    100   2e-20   Nicotiana tomentosiformis
tpg|DAA39718.1|  TPA: hypothetical protein ZEAMMB73_933797            99.4    2e-20   Zea mays [maize]
gb|KDP27022.1|  hypothetical protein JCGZ_20957                       99.8    3e-20   Jatropha curcas
tpg|DAA39719.1|  TPA: hypothetical protein ZEAMMB73_933797            99.4    3e-20   Zea mays [maize]
ref|XP_010061862.1|  PREDICTED: uncharacterized protein LOC104449412  99.4    4e-20   Eucalyptus grandis [rose gum]
gb|KDO75855.1|  hypothetical protein CISIN_1g038419mg                 99.0    4e-20   Citrus sinensis [Valencia orange]
gb|KJB13423.1|  hypothetical protein B456_002G073400                  98.6    4e-20   Gossypium raimondii
ref|XP_004487682.1|  PREDICTED: dentin sialophosphoprotein-like       99.0    5e-20   Cicer arietinum [garbanzo]
gb|KHN28039.1|  hypothetical protein glysoja_007771                   99.0    5e-20   Glycine soja [wild soybean]
ref|XP_004244206.1|  PREDICTED: uncharacterized protein LOC101248895  98.6    5e-20   Solanum lycopersicum
ref|XP_002317227.2|  hypothetical protein POPTR_0011s04670g           98.6    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002317515.2|  COP1-interacting protein 7                       98.6    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011047845.1|  PREDICTED: uncharacterized protein LOC105142085  98.2    7e-20   Populus euphratica
ref|XP_002305012.2|  hypothetical protein POPTR_0004s03850g           98.2    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006449289.1|  hypothetical protein CICLE_v10014177mg           98.2    7e-20   Citrus clementina
ref|XP_011027902.1|  PREDICTED: uncharacterized protein LOC105128082  97.8    1e-19   Populus euphratica
ref|XP_006370300.1|  COP1-interacting protein 7                       97.8    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011029438.1|  PREDICTED: uncharacterized protein LOC105129180  97.8    1e-19   Populus euphratica
ref|XP_002967692.1|  hypothetical protein SELMODRAFT_88956            92.4    1e-19   Selaginella moellendorffii
ref|XP_002964342.1|  hypothetical protein SELMODRAFT_82306            92.4    1e-19   Selaginella moellendorffii
ref|XP_006841675.1|  hypothetical protein AMTR_s00003p00244690        97.4    1e-19   Amborella trichopoda
gb|KEH38782.1|  COP1-interacting protein, putative                    97.4    1e-19   Medicago truncatula
gb|KJB13424.1|  hypothetical protein B456_002G073400                  97.1    2e-19   Gossypium raimondii
gb|KHG16266.1|  ABC transporter D family member 2, chloroplastic      97.1    2e-19   Gossypium arboreum [tree cotton]
gb|KJB13422.1|  hypothetical protein B456_002G073400                  97.1    2e-19   Gossypium raimondii
ref|XP_007213724.1|  hypothetical protein PRUPE_ppa000375mg           97.1    2e-19   Prunus persica
ref|XP_008224997.1|  PREDICTED: uncharacterized protein LOC103324676  96.3    3e-19   Prunus mume [ume]
ref|XP_008226668.1|  PREDICTED: dentin sialophosphoprotein            96.7    3e-19   Prunus mume [ume]
ref|XP_002529180.1|  conserved hypothetical protein                   92.0    3e-19   
ref|XP_011096264.1|  PREDICTED: uncharacterized protein LOC105175509  95.9    4e-19   Sesamum indicum [beniseed]
emb|CBI20343.3|  unnamed protein product                              94.7    5e-19   Vitis vinifera
ref|XP_010537005.1|  PREDICTED: uncharacterized protein LOC104811855  95.5    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_009389585.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.5    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA31739.1|  COP1-Interacting ProteinI 7 (CIP7)                   91.3    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465838.1|  PREDICTED: uncharacterized protein LOC102629...  95.1    9e-19   Citrus sinensis [Valencia orange]
ref|XP_009388078.1|  PREDICTED: uncharacterized protein LOC103974899  89.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426753.1|  hypothetical protein CICLE_v10024713mg           95.1    1e-18   Citrus clementina
emb|CAN69737.1|  hypothetical protein VITISV_008338                   94.7    1e-18   Vitis vinifera
ref|XP_010644218.1|  PREDICTED: uncharacterized protein LOC100252162  94.7    1e-18   Vitis vinifera
ref|XP_006347084.1|  PREDICTED: dentin sialophosphoprotein-like       94.0    2e-18   Solanum tuberosum [potatoes]
emb|CDY29309.1|  BnaC01g19610D                                        94.4    2e-18   Brassica napus [oilseed rape]
ref|XP_004232832.1|  PREDICTED: uncharacterized protein LOC101263075  94.0    2e-18   Solanum lycopersicum
ref|XP_009143431.1|  PREDICTED: muscle M-line assembly protein un...  94.0    2e-18   Brassica rapa
emb|CDX89251.1|  BnaA01g16420D                                        94.0    2e-18   Brassica napus [oilseed rape]
ref|XP_008799214.1|  PREDICTED: uncharacterized protein LOC103713...  94.0    2e-18   Phoenix dactylifera
ref|XP_008799213.1|  PREDICTED: uncharacterized protein LOC103713...  94.0    2e-18   Phoenix dactylifera
ref|XP_010552256.1|  PREDICTED: uncharacterized protein LOC104822...  93.6    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_006465839.1|  PREDICTED: uncharacterized protein LOC102629...  93.2    4e-18   Citrus sinensis [Valencia orange]
gb|KJB57557.1|  hypothetical protein B456_009G170400                  92.8    4e-18   Gossypium raimondii
ref|XP_009613827.1|  PREDICTED: uncharacterized protein LOC104106...  88.2    5e-18   Nicotiana tomentosiformis
ref|XP_002519011.1|  hypothetical protein RCOM_0934860                92.4    6e-18   
dbj|BAB02983.1|  COP1-interacting protein 7 (CIP7)-like               87.8    6e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57556.1|  hypothetical protein B456_009G170400                  92.4    7e-18   Gossypium raimondii
ref|XP_009613829.1|  PREDICTED: uncharacterized protein LOC104106...  87.4    7e-18   Nicotiana tomentosiformis
gb|KJB57554.1|  hypothetical protein B456_009G170400                  92.4    7e-18   Gossypium raimondii
ref|XP_010921151.1|  PREDICTED: uncharacterized protein LOC105044820  92.4    7e-18   Elaeis guineensis
ref|XP_010261738.1|  PREDICTED: uncharacterized protein LOC104600...  92.4    9e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010261739.1|  PREDICTED: uncharacterized protein LOC104600...  92.4    9e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010261736.1|  PREDICTED: uncharacterized protein LOC104600...  92.4    9e-18   Nelumbo nucifera [Indian lotus]
gb|KDP40661.1|  hypothetical protein JCGZ_24660                       92.0    1e-17   Jatropha curcas
ref|XP_010533898.1|  PREDICTED: uncharacterized protein LOC104809566  91.7    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_008371326.1|  PREDICTED: dentin sialophosphoprotein-like       91.3    1e-17   Malus domestica [apple tree]
ref|XP_009334256.1|  PREDICTED: uncharacterized protein LOC103927051  91.7    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_006843854.1|  hypothetical protein AMTR_s00007p00263470        91.7    1e-17   Amborella trichopoda
gb|KHG07859.1|  tRNA-specific 2-thiouridylase mnmA                    91.3    1e-17   Gossypium arboreum [tree cotton]
ref|XP_009104349.1|  PREDICTED: uncharacterized protein LOC103830324  90.9    2e-17   Brassica rapa
emb|CDY52491.1|  BnaA01g36080D                                        90.9    2e-17   Brassica napus [oilseed rape]
ref|XP_006392061.1|  hypothetical protein EUTSA_v10023296mg           90.9    2e-17   Eutrema salsugineum
ref|XP_009408909.1|  PREDICTED: uncharacterized protein LOC103991...  91.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408901.1|  PREDICTED: uncharacterized protein LOC103991...  91.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006467843.1|  PREDICTED: uncharacterized protein LOC102614...  90.9    2e-17   Citrus sinensis [Valencia orange]
ref|NP_176305.2|  TIR class disease resistance protein                90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185276.1|  TIR class disease resistance protein             90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34413.1|  unnamed protein product                              90.9    2e-17   Eutrema halophilum
ref|XP_002976104.1|  hypothetical protein SELMODRAFT_104230           86.3    2e-17   Selaginella moellendorffii
gb|KDP20927.1|  hypothetical protein JCGZ_21398                       90.9    2e-17   Jatropha curcas
ref|XP_007025709.1|  Uncharacterized protein TCM_029927               91.3    2e-17   Theobroma cacao [chocolate]
ref|XP_001780764.1|  predicted protein                                86.7    2e-17   Physcomitrella patens
ref|XP_009763783.1|  PREDICTED: uncharacterized protein LOC104215637  90.5    3e-17   Nicotiana sylvestris
gb|KHN39597.1|  hypothetical protein glysoja_020675                   90.9    3e-17   Glycine soja [wild soybean]
ref|NP_194473.1|  COP1-interacting protein 7                          90.9    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293497.1|  PREDICTED: uncharacterized protein LOC101305638  90.5    3e-17   Fragaria vesca subsp. vesca
emb|CDY03786.1|  BnaC01g29030D                                        90.5    3e-17   Brassica napus [oilseed rape]
ref|XP_009597624.1|  PREDICTED: uncharacterized protein LOC104093569  90.5    3e-17   Nicotiana tomentosiformis
ref|XP_007135400.1|  hypothetical protein PHAVU_010G126300g           90.5    4e-17   Phaseolus vulgaris [French bean]
ref|XP_010104606.1|  ABC transporter B family member 19               90.9    4e-17   Morus notabilis
ref|XP_009763170.1|  PREDICTED: uncharacterized protein LOC104215...  90.5    4e-17   Nicotiana sylvestris
ref|XP_010057461.1|  PREDICTED: uncharacterized protein LOC104445311  90.1    4e-17   Eucalyptus grandis [rose gum]
ref|XP_002869565.1|  cop1-interacting protein 7                       90.1    4e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006407117.1|  hypothetical protein EUTSA_v10019917mg           90.1    5e-17   Eutrema salsugineum
ref|XP_008383786.1|  PREDICTED: uncharacterized protein LOC103446447  89.7    5e-17   Malus domestica [apple tree]
ref|XP_002968272.1|  hypothetical protein SELMODRAFT_89725            85.1    6e-17   Selaginella moellendorffii
ref|XP_006413076.1|  hypothetical protein EUTSA_v10024285mg           89.7    6e-17   Eutrema salsugineum
ref|XP_006283048.1|  hypothetical protein CARUB_v10004040mg           89.7    6e-17   Capsella rubella
gb|EPS68902.1|  hypothetical protein M569_05867                       87.4    6e-17   Genlisea aurea
ref|XP_006283049.1|  hypothetical protein CARUB_v10004040mg           89.4    6e-17   Capsella rubella
ref|XP_006598845.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.7    6e-17   Glycine max [soybeans]
ref|XP_011079454.1|  PREDICTED: uncharacterized protein LOC105162...  89.7    7e-17   Sesamum indicum [beniseed]
ref|XP_006598844.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.7    7e-17   Glycine max [soybeans]
ref|XP_011079449.1|  PREDICTED: uncharacterized protein LOC105162...  89.7    7e-17   Sesamum indicum [beniseed]
ref|XP_011079438.1|  PREDICTED: uncharacterized protein LOC105162...  89.7    7e-17   Sesamum indicum [beniseed]
ref|XP_010438618.1|  PREDICTED: uncharacterized protein LOC104722...  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010438617.1|  PREDICTED: uncharacterized protein LOC104722...  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010418058.1|  PREDICTED: uncharacterized protein LOC104703699  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010448136.1|  PREDICTED: uncharacterized protein LOC104730...  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010448137.1|  PREDICTED: uncharacterized protein LOC104730...  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006583177.1|  PREDICTED: dentin sialophosphoprotein-like i...  88.6    1e-16   Glycine max [soybeans]
ref|XP_010314456.1|  PREDICTED: uncharacterized protein LOC101267294  88.6    1e-16   Solanum lycopersicum
ref|XP_006362089.1|  PREDICTED: uncharacterized protein LOC102584476  88.6    2e-16   Solanum tuberosum [potatoes]
gb|KJB81917.1|  hypothetical protein B456_013G167500                  88.6    2e-16   Gossypium raimondii
ref|XP_003593513.1|  hypothetical protein MTR_2g012990                88.2    2e-16   Medicago truncatula
gb|KHN01444.1|  hypothetical protein glysoja_009650                   88.2    2e-16   Glycine soja [wild soybean]
ref|XP_006300754.1|  hypothetical protein CARUB_v10019822mg           87.8    2e-16   Capsella rubella
ref|XP_002885016.1|  hypothetical protein ARALYDRAFT_478831           88.2    2e-16   
ref|XP_006583175.1|  PREDICTED: dentin sialophosphoprotein-like i...  88.2    2e-16   
ref|XP_007024719.1|  Uncharacterized protein isoform 5                88.2    2e-16   
ref|XP_010433372.1|  PREDICTED: uncharacterized protein LOC104717493  88.2    2e-16   
ref|XP_007148203.1|  hypothetical protein PHAVU_006G188700g           87.8    2e-16   
ref|XP_006296843.1|  hypothetical protein CARUB_v10012830mg           88.2    2e-16   
ref|XP_006583176.1|  PREDICTED: dentin sialophosphoprotein-like i...  88.2    2e-16   
ref|XP_010473310.1|  PREDICTED: uncharacterized protein LOC104752...  87.8    2e-16   
ref|XP_007024718.1|  Uncharacterized protein isoform 4                88.2    2e-16   
ref|XP_010473309.1|  PREDICTED: uncharacterized protein LOC104752...  87.8    2e-16   
ref|XP_007024720.1|  Uncharacterized protein isoform 6                88.2    2e-16   
ref|XP_007024717.1|  Uncharacterized protein isoform 3                88.2    2e-16   
ref|XP_011072663.1|  PREDICTED: uncharacterized protein LOC105157...  88.2    2e-16   
ref|XP_007024715.1|  Uncharacterized protein isoform 1                88.2    2e-16   
ref|XP_006369109.1|  hypothetical protein POPTR_0001s16530g           82.0    2e-16   
ref|XP_011072662.1|  PREDICTED: uncharacterized protein LOC105157...  88.2    2e-16   
gb|KFK29260.1|  hypothetical protein AALP_AA7G109900                  87.8    2e-16   
emb|CDX75749.1|  BnaC03g38320D                                        87.8    3e-16   
ref|XP_001775452.1|  predicted protein                                84.0    3e-16   
ref|XP_010465302.1|  PREDICTED: uncharacterized protein LOC104745...  87.4    4e-16   
gb|KHG28825.1|  5-formyltetrahydrofolate cyclo-ligase                 87.4    4e-16   
ref|XP_009406852.1|  PREDICTED: uncharacterized protein LOC103989658  87.4    4e-16   
gb|KJB70080.1|  hypothetical protein B456_011G057200                  87.0    5e-16   
emb|CDO97814.1|  unnamed protein product                              87.0    5e-16   
ref|NP_001118623.1|  uncharacterized protein                          87.0    5e-16   
ref|XP_010487205.1|  PREDICTED: uncharacterized protein LOC104765...  86.7    6e-16   
ref|XP_003545875.1|  PREDICTED: dentin sialophosphoprotein-like       86.3    7e-16   
emb|CBI18823.3|  unnamed protein product                              86.3    7e-16   
gb|EYU21289.1|  hypothetical protein MIMGU_mgv1a000325mg              86.7    7e-16   
ref|XP_010542382.1|  PREDICTED: uncharacterized protein LOC104815...  86.7    8e-16   
ref|XP_010542380.1|  PREDICTED: uncharacterized protein LOC104815...  86.7    8e-16   
ref|XP_010542381.1|  PREDICTED: uncharacterized protein LOC104815...  86.7    8e-16   
ref|XP_010318486.1|  PREDICTED: uncharacterized protein LOC101252...  86.3    1e-15   
ref|XP_006342942.1|  PREDICTED: SAFB-like transcription modulator...  86.3    1e-15   
ref|XP_004236381.1|  PREDICTED: uncharacterized protein LOC101252...  86.3    1e-15   
gb|KHN08556.1|  hypothetical protein glysoja_014321                   85.9    1e-15   
ref|XP_003543067.1|  PREDICTED: uncharacterized protein LOC100817199  85.9    1e-15   
ref|XP_010501705.1|  PREDICTED: uncharacterized protein LOC104779002  85.9    1e-15   
gb|EYU45904.1|  hypothetical protein MIMGU_mgv1a000216mg              85.5    2e-15   
ref|XP_009135364.1|  PREDICTED: uncharacterized protein LOC103859...  85.1    2e-15   
ref|XP_002304240.2|  hypothetical protein POPTR_0003s06810g           80.5    2e-15   
ref|XP_009135365.1|  PREDICTED: uncharacterized protein LOC103859...  85.1    2e-15   
emb|CDX82497.1|  BnaA03g33240D                                        85.1    2e-15   
ref|XP_009625082.1|  PREDICTED: uncharacterized protein LOC104116...  85.1    2e-15   
ref|XP_004485744.1|  PREDICTED: serine-rich adhesin for platelets...  84.7    2e-15   
ref|XP_009625084.1|  PREDICTED: uncharacterized protein LOC104116...  85.1    3e-15   
emb|CBI35826.3|  unnamed protein product                              84.7    3e-15   
ref|XP_002271999.1|  PREDICTED: uncharacterized protein LOC100251...  84.7    3e-15   
ref|XP_010654399.1|  PREDICTED: uncharacterized protein LOC100251...  84.7    3e-15   
emb|CDX97549.1|  BnaA05g25300D                                        84.7    3e-15   
emb|CDY52269.1|  BnaC05g52130D                                        84.3    4e-15   
ref|XP_008228149.1|  PREDICTED: probable GPI-anchored adhesin-lik...  83.6    6e-15   
ref|XP_009146402.1|  PREDICTED: uncharacterized protein LOC103870059  83.6    6e-15   
ref|XP_009787799.1|  PREDICTED: uncharacterized protein LOC104235688  83.6    8e-15   
gb|KJB56997.1|  hypothetical protein B456_009G144900                  83.2    1e-14   
gb|KJB56999.1|  hypothetical protein B456_009G144900                  83.2    1e-14   
gb|KJB56998.1|  hypothetical protein B456_009G144900                  83.2    1e-14   
gb|KJB57001.1|  hypothetical protein B456_009G144900                  83.2    1e-14   
gb|KJB57000.1|  hypothetical protein B456_009G144900                  83.2    1e-14   
ref|XP_008800453.1|  PREDICTED: uncharacterized protein LOC103714...  82.8    1e-14   
ref|XP_004305768.1|  PREDICTED: uncharacterized protein LOC101291...  82.8    1e-14   
ref|XP_008800452.1|  PREDICTED: uncharacterized protein LOC103714...  82.8    1e-14   
ref|XP_008800454.1|  PREDICTED: uncharacterized protein LOC103714...  82.8    1e-14   
gb|KFK26324.1|  hypothetical protein AALP_AA8G232800                  82.0    2e-14   
ref|XP_010685260.1|  PREDICTED: uncharacterized protein LOC104899715  82.4    2e-14   
ref|XP_010534960.1|  PREDICTED: uncharacterized protein LOC104810...  81.6    3e-14   
ref|XP_010534957.1|  PREDICTED: uncharacterized protein LOC104810...  81.6    3e-14   
ref|XP_010534959.1|  PREDICTED: uncharacterized protein LOC104810...  81.6    3e-14   
ref|XP_010937292.1|  PREDICTED: uncharacterized protein LOC105056692  81.6    3e-14   
ref|XP_007213034.1|  hypothetical protein PRUPE_ppa023167mg           81.3    4e-14   
ref|XP_007217656.1|  hypothetical protein PRUPE_ppa000250mg           81.3    4e-14   
ref|XP_004510543.1|  PREDICTED: serine-rich adhesin for platelets...  81.3    5e-14   
ref|XP_004510542.1|  PREDICTED: serine-rich adhesin for platelets...  81.3    5e-14   
ref|XP_011036507.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    5e-14   
ref|XP_011036505.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    5e-14   
ref|XP_011036504.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    5e-14   
ref|XP_011036502.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    5e-14   
ref|XP_011036503.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    5e-14   
ref|XP_011036499.1|  PREDICTED: uncharacterized protein LOC105133...  80.9    6e-14   
ref|XP_011048594.1|  PREDICTED: uncharacterized protein LOC105142...  80.5    7e-14   
ref|XP_011048595.1|  PREDICTED: uncharacterized protein LOC105142...  80.5    7e-14   
ref|XP_011048593.1|  PREDICTED: uncharacterized protein LOC105142...  80.5    7e-14   
ref|XP_009613828.1|  PREDICTED: uncharacterized protein LOC104106...  76.3    8e-14   
ref|XP_008342437.1|  PREDICTED: uncharacterized protein LOC103405236  80.1    9e-14   
ref|XP_009378367.1|  PREDICTED: uncharacterized protein LOC103966870  80.1    9e-14   
ref|XP_009336718.1|  PREDICTED: uncharacterized protein LOC103929277  80.1    1e-13   
ref|XP_010939875.1|  PREDICTED: uncharacterized protein LOC105058...  80.1    1e-13   
ref|XP_010939873.1|  PREDICTED: uncharacterized protein LOC105058...  80.1    1e-13   
ref|XP_010939876.1|  PREDICTED: uncharacterized protein LOC105058...  80.1    1e-13   
ref|XP_008782932.1|  PREDICTED: uncharacterized protein LOC103702...  79.3    2e-13   
ref|XP_008782922.1|  PREDICTED: uncharacterized protein LOC103702...  79.3    2e-13   
ref|XP_008782940.1|  PREDICTED: uncharacterized protein LOC103702...  79.3    2e-13   
ref|XP_008462266.1|  PREDICTED: dentin sialophosphoprotein-like       79.0    3e-13   
ref|XP_004141819.1|  PREDICTED: uncharacterized protein LOC101213033  78.6    3e-13   
ref|XP_009409129.1|  PREDICTED: uncharacterized protein LOC103991...  77.8    5e-13   
ref|XP_009409126.1|  PREDICTED: uncharacterized protein LOC103991...  77.8    5e-13   
ref|XP_009409130.1|  PREDICTED: uncharacterized protein LOC103991...  77.8    5e-13   
ref|XP_008365696.1|  PREDICTED: uncharacterized protein LOC103429323  77.8    6e-13   
ref|XP_008380773.1|  PREDICTED: probable GPI-anchored adhesin-lik...  77.8    6e-13   
ref|XP_010430100.1|  PREDICTED: uncharacterized protein LOC104714...  76.6    1e-12   
ref|XP_010430101.1|  PREDICTED: uncharacterized protein LOC104714...  76.6    1e-12   
ref|XP_003627371.1|  COP1-interacting protein 7 (CIP7)-like protein   76.3    2e-12   
ref|XP_009388755.1|  PREDICTED: uncharacterized protein LOC103975503  72.4    3e-11   
gb|AAX46319.1|  COP1-interacting protein 7                            66.6    3e-11   
ref|XP_010531886.1|  PREDICTED: uncharacterized protein LOC104808065  71.6    5e-11   
ref|XP_002988162.1|  hypothetical protein SELMODRAFT_73188            65.1    1e-10   
ref|XP_002972648.1|  hypothetical protein SELMODRAFT_73189            65.1    1e-10   
tpg|DAA63602.1|  TPA: hypothetical protein ZEAMMB73_371489            70.5    1e-10   
ref|XP_008651101.1|  PREDICTED: uncharacterized protein LOC100273...  70.5    1e-10   
tpg|DAA63603.1|  TPA: hypothetical protein ZEAMMB73_371489            70.1    2e-10   
gb|AAG52579.1|AC016529_10  hypothetical protein; 56983-57523          65.1    2e-10   
ref|XP_004958303.1|  PREDICTED: dentin sialophosphoprotein-like i...  68.9    4e-10   
ref|XP_002461014.1|  hypothetical protein SORBIDRAFT_02g039210        68.6    5e-10   
ref|XP_010537640.1|  PREDICTED: uncharacterized protein LOC104812...  68.2    7e-10   
ref|XP_010647471.1|  PREDICTED: uncharacterized protein LOC100854548  68.2    7e-10   
ref|NP_173179.4|  uncharacterized protein                             68.2    7e-10   
ref|XP_010537639.1|  PREDICTED: uncharacterized protein LOC104812...  68.2    7e-10   
ref|XP_002977964.1|  hypothetical protein SELMODRAFT_108104           64.3    9e-10   
ref|XP_002966783.1|  hypothetical protein SELMODRAFT_85819            64.3    1e-09   
ref|XP_006300593.1|  hypothetical protein CARUB_v10019680mg           66.6    2e-09   
ref|XP_010428120.1|  PREDICTED: uncharacterized protein LOC104712842  66.2    3e-09   
tpg|DAA41440.1|  TPA: hypothetical protein ZEAMMB73_598498            65.9    4e-09   
ref|XP_008670578.1|  PREDICTED: dentin sialophosphoprotein-like i...  65.9    4e-09   
ref|XP_008670577.1|  PREDICTED: dentin sialophosphoprotein-like i...  65.9    4e-09   
ref|XP_010415986.1|  PREDICTED: uncharacterized protein LOC104701920  65.5    5e-09   
ref|NP_001189890.1|  uncharacterized protein                          64.7    9e-09   
ref|NP_001185381.1|  COP1-interacting protein-related protein         64.7    1e-08   
ref|NP_177385.2|  COP1-interacting protein-related protein            64.3    1e-08   
ref|XP_010459322.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...  63.9    1e-08   
ref|XP_006416711.1|  hypothetical protein EUTSA_v10006648mg           63.5    2e-08   
ref|XP_010471265.1|  PREDICTED: uncharacterized protein LOC104751087  63.2    3e-08   
ref|XP_003559934.1|  PREDICTED: uncharacterized protein LOC100830570  63.2    3e-08   
dbj|BAJ92492.1|  predicted protein                                    63.2    3e-08   
dbj|BAC16511.1|  COP1-interacting protein 7 (CIP7)-like               62.8    4e-08   
ref|NP_001060273.1|  Os07g0616000                                     62.8    4e-08   
gb|EEC82443.1|  hypothetical protein OsI_26868                        62.4    4e-08   
ref|XP_010476884.1|  PREDICTED: uncharacterized protein LOC104756...  60.8    2e-07   
ref|XP_010476885.1|  PREDICTED: uncharacterized protein LOC104756...  60.8    2e-07   
gb|AAF79457.1|AC022492_1  F1L3.1                                      60.5    2e-07   
ref|XP_006306647.1|  hypothetical protein CARUB_v10008164mg           60.5    2e-07   
ref|XP_010498080.1|  PREDICTED: glutamic acid-rich protein-like i...  59.7    3e-07   
ref|XP_010498083.1|  PREDICTED: glutamic acid-rich protein-like i...  59.3    4e-07   
ref|XP_006467844.1|  PREDICTED: uncharacterized protein LOC102614...  57.8    1e-06   
ref|XP_009149189.1|  PREDICTED: uncharacterized protein LOC103872524  54.7    1e-05   
emb|CDY48298.1|  BnaC05g13520D                                        54.7    2e-05   
emb|CDY26250.1|  BnaA06g11670D                                        52.4    8e-05   
emb|CDX83910.1|  BnaC08g17350D                                        52.0    1e-04   
ref|XP_011079460.1|  PREDICTED: uncharacterized protein LOC105162...  51.6    2e-04   



>ref|XP_006403265.1| hypothetical protein EUTSA_v10003134mg [Eutrema salsugineum]
 gb|ESQ44718.1| hypothetical protein EUTSA_v10003134mg [Eutrema salsugineum]
Length=1189

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAQDQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+  ++A+WFTKGT+ERF+RFVS 
Sbjct  61   ILKPEDSDNAAWFTKGTIERFVRFVSN  87



>gb|KFK31044.1| hypothetical protein AALP_AA6G060800 [Arabis alpina]
Length=1176

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++I N K EKIATGL+DPFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVIVNGKTEKIATGLIDPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+  ++A+WFTKGT+ERF+RFVS 
Sbjct  61   ILKPEDSDNAAWFTKGTIERFVRFVSN  87



>emb|CBI23663.3| unnamed protein product [Vitis vinifera]
Length=1216

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S VFQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSSTLLDSAVFQLTPTRTRCDLIITANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEPK  +DA+WF KGTVERF+RFVST
Sbjct  61   ILEPKPGSDATWFAKGTVERFVRFVST  87



>ref|XP_010494311.1| PREDICTED: uncharacterized protein LOC104771477 [Camelina sativa]
Length=1178

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGTVERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTVERFVRFVST  87



>ref|NP_001190461.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
 gb|AED94944.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
Length=1180

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>ref|NP_001190459.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
 ref|NP_001190460.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
 gb|AED94942.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
 gb|AED94943.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
Length=1164

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>ref|XP_010484868.1| PREDICTED: uncharacterized protein LOC104763157 [Camelina sativa]
Length=1110

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>ref|XP_009123882.1| PREDICTED: uncharacterized protein LOC103848809 isoform X3 [Brassica 
rapa]
Length=1215

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+II N K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLIIDNGKAEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+PK  ++A+WFTK T++RF+RFVS 
Sbjct  61   VLKPKDSDNAAWFTKATIQRFVRFVSN  87



>emb|CDY14872.1| BnaA02g22140D [Brassica napus]
Length=1152

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+II N K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLIIDNGKAEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+PK  ++A+WFTK T++RF+RFVS 
Sbjct  61   VLKPKDSDNAAWFTKATIQRFVRFVSN  87



>ref|XP_008802181.1| PREDICTED: uncharacterized protein LOC103716091 [Phoenix dactylifera]
Length=1321

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS TRL+SVVFQLTPTRTRCDL+I+AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSETRLDSVVFQLTPTRTRCDLVIVANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFTKGTVERF+RFVST
Sbjct  61   TLEPDPKIDAVWFTKGTVERFVRFVST  87



>ref|XP_009123881.1| PREDICTED: uncharacterized protein LOC103848809 isoform X2 [Brassica 
rapa]
Length=1218

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+II N K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLIIDNGKAEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+PK  ++A+WFTK T++RF+RFVS 
Sbjct  61   VLKPKDSDNAAWFTKATIQRFVRFVSN  87



>ref|XP_009123880.1| PREDICTED: uncharacterized protein LOC103848809 isoform X1 [Brassica 
rapa]
Length=1219

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+II N K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLIIDNGKAEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+PK  ++A+WFTK T++RF+RFVS 
Sbjct  61   VLKPKDSDNAAWFTKATIQRFVRFVSN  87



>ref|XP_009123883.1| PREDICTED: uncharacterized protein LOC103848809 isoform X4 [Brassica 
rapa]
Length=1214

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+II N K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLIIDNGKAEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+PK  ++A+WFTK T++RF+RFVS 
Sbjct  61   VLKPKDSDNAAWFTKATIQRFVRFVSN  87



>gb|KDP40353.1| hypothetical protein JCGZ_02351 [Jatropha curcas]
Length=1309

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRCDL+I AN K EKIA+GL++PFLAHLKTAQDQ+AK GYSI
Sbjct  1    MKFSTRLDSAVFQLTPTRTRCDLVISANGKTEKIASGLVNPFLAHLKTAQDQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+  NDA+WFT+GT+ERF+RFVST
Sbjct  61   ILEPEPGNDATWFTRGTIERFVRFVST  87



>ref|NP_568624.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
 gb|AED94941.1| COP1-interacting protein-like protein [Arabidopsis thaliana]
Length=1237

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>ref|XP_006403264.1| hypothetical protein EUTSA_v10003134mg [Eutrema salsugineum]
 gb|ESQ44717.1| hypothetical protein EUTSA_v10003134mg [Eutrema salsugineum]
Length=1019

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 68/86 (79%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAQDQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVS  595
            +L+P+  ++A+WFTKGT+ERF+RFVS
Sbjct  61   ILKPEDSDNAAWFTKGTIERFVRFVS  86



>dbj|BAB10594.1| unnamed protein product [Arabidopsis thaliana]
Length=1221

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>ref|XP_009594212.1| PREDICTED: uncharacterized protein LOC104090745 [Nicotiana tomentosiformis]
Length=1283

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSS RL+SVVFQLTPTRTRCDL IIAN KKEKIA+GLL+PFLAHL+TAQDQIAK GYS+
Sbjct  1    MKSSARLDSVVFQLTPTRTRCDLFIIANGKKEKIASGLLNPFLAHLRTAQDQIAKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP +H DASWFTKGTVERF+RFVST
Sbjct  61   LLEPDAHVDASWFTKGTVERFVRFVST  87



>ref|XP_009759151.1| PREDICTED: uncharacterized protein LOC104211747 [Nicotiana sylvestris]
 ref|XP_009759152.1| PREDICTED: uncharacterized protein LOC104211747 [Nicotiana sylvestris]
 ref|XP_009759153.1| PREDICTED: uncharacterized protein LOC104211747 [Nicotiana sylvestris]
Length=1283

 Score =   132 bits (331),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSS RL+SVVFQLTPTRTRCDL IIAN KKEK+A+GLL+PFLAHL+TAQDQIAK GYS+
Sbjct  1    MKSSARLDSVVFQLTPTRTRCDLFIIANGKKEKLASGLLNPFLAHLRTAQDQIAKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP +H DASWFTKGTVERF+RFVST
Sbjct  61   LLEPDAHVDASWFTKGTVERFVRFVST  87



>ref|XP_009384650.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103972157 
[Musa acuminata subsp. malaccensis]
Length=1309

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL+S VFQLTPTRTRCDLIIIAN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MRSEARLDSAVFQLTPTRTRCDLIIIANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    DA+WFTKGTVERF+RFVST
Sbjct  61   ILEPDPETDAAWFTKGTVERFVRFVST  87



>ref|XP_010671008.1| PREDICTED: uncharacterized protein LOC104887920 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1284

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S+VFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLK A++QI K GYSI
Sbjct  1    MKSSTRLDSIVFQLTPTRTRCDLVITANGKSEKIASGLLNPFLAHLKAAEEQIGKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VLEPK  +DASWF KGTVERF+RFVS+
Sbjct  61   VLEPKHGSDASWFIKGTVERFVRFVSS  87



>ref|XP_010671007.1| PREDICTED: uncharacterized protein LOC104887920 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1286

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S+VFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLK A++QI K GYSI
Sbjct  1    MKSSTRLDSIVFQLTPTRTRCDLVITANGKSEKIASGLLNPFLAHLKAAEEQIGKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VLEPK  +DASWF KGTVERF+RFVS+
Sbjct  61   VLEPKHGSDASWFIKGTVERFVRFVSS  87



>emb|CDO99248.1| unnamed protein product [Coffea canephora]
Length=1317

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS+TRL+S VF LTPTRTRCDL IIAN KKEKIA+GLL+PFLAHLKTA+DQI K GYSI
Sbjct  1    MKSTTRLDSAVFHLTPTRTRCDLFIIANGKKEKIASGLLNPFLAHLKTARDQIEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VLEP+   DASWFTKGTVERF+RFVST
Sbjct  61   VLEPEPQTDASWFTKGTVERFVRFVST  87



>gb|KDO57566.1| hypothetical protein CISIN_1g0369511mg, partial [Citrus sinensis]
Length=955

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRLNS VFQLTPTRTRCDL+I A  K EK+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLNSAVFQLTPTRTRCDLLISAYGKTEKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP   +DASWFTKGT+ERF+RFVST
Sbjct  61   ILEPAPGSDASWFTKGTLERFVRFVST  87



>ref|XP_010442037.1| PREDICTED: uncharacterized protein LOC104725131 isoform X1 [Camelina 
sativa]
 ref|XP_010442038.1| PREDICTED: uncharacterized protein LOC104725131 isoform X2 [Camelina 
sativa]
Length=1178

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++  +A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASANAAWFTKGTIERFVRFVST  87



>ref|XP_010264948.1| PREDICTED: uncharacterized protein LOC104602815 [Nelumbo nucifera]
Length=1336

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS TRL+S VFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+QIAK GYSI
Sbjct  1    MKSGTRLDSAVFQLTPTRTRCDLVITANGKTEKIASGLLNPFLAHLKTAQEQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP   +D +WFTKGTVERF+RFVST
Sbjct  61   ILEPDPGSDLTWFTKGTVERFVRFVST  87



>ref|XP_006489705.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=1308

 Score =   130 bits (326),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRLNS VFQLTPTRTRCDL+I A  K EK+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLNSAVFQLTPTRTRCDLLISAYGKTEKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP   +DASWFTKGT+ERF+RFVST
Sbjct  61   ILEPAPGSDASWFTKGTLERFVRFVST  87



>ref|XP_006354471.1| PREDICTED: uncharacterized protein LOC102583985 [Solanum tuberosum]
Length=1278

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL IIAN+KKEKIA+GLL PFLAHL+TAQDQIAK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLFIIANDKKEKIASGLLTPFLAHLRTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVS  595
             LEP +H D SWFTKGTVERF+RFVS
Sbjct  61   FLEPDAHADDSWFTKGTVERFVRFVS  86



>ref|XP_011073557.1| PREDICTED: uncharacterized protein LOC105158471, partial [Sesamum 
indicum]
Length=1063

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRCDLIIIAN+KKEKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKHSTRLSSAVFQLTPTRTRCDLIIIANDKKEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++ +DA+WFTK T+ERF+RFVST
Sbjct  61   LLEPETGSDAAWFTKATLERFVRFVST  87



>ref|XP_006420261.1| hypothetical protein CICLE_v10004168mg [Citrus clementina]
 gb|ESR33501.1| hypothetical protein CICLE_v10004168mg [Citrus clementina]
Length=1310

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRLNS VFQLTPTRTRCDL+I A  K EK+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLNSAVFQLTPTRTRCDLLISAYGKTEKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP   +DASWFTKGT+ERF+RFVST
Sbjct  61   ILEPAPGSDASWFTKGTLERFVRFVST  87



>emb|CDY22355.1| BnaA06g36770D [Brassica napus]
Length=1143

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+  + A WFTK T+ERF+RFVS 
Sbjct  61   ILKPEDSDIAVWFTKATIERFVRFVSN  87



>ref|XP_009101794.1| PREDICTED: uncharacterized protein LOC103827980 [Brassica rapa]
Length=1144

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+  + A WFTK T+ERF+RFVS 
Sbjct  61   ILKPEDSDIAVWFTKATIERFVRFVSN  87



>ref|XP_007035158.1| COP1-interacting protein-related, putative isoform 6 [Theobroma 
cacao]
 gb|EOY06084.1| COP1-interacting protein-related, putative isoform 6 [Theobroma 
cacao]
Length=1142

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGTVERF+RFVST
Sbjct  61   ILQPEPSIDATWFTKGTVERFVRFVST  87



>ref|XP_009376986.1| PREDICTED: uncharacterized protein LOC103965641 [Pyrus x bretschneideri]
Length=1259

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDL+I AN K EKIA+GLL+PFL+HLKTAQ Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRCDLVIHANGKTEKIASGLLNPFLSHLKTAQKQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TVERF+RFVST
Sbjct  61   ILEPESGSDATWFTKSTVERFVRFVST  87



>ref|XP_008391232.1| PREDICTED: uncharacterized protein LOC103453465 [Malus domestica]
Length=1259

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDL+I AN   EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRCDLVISANGMTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TV+RF+RFVST
Sbjct  61   ILEPESGSDAAWFTKSTVQRFVRFVST  87



>ref|XP_010102613.1| hypothetical protein L484_011725 [Morus notabilis]
 gb|EXB93730.1| hypothetical protein L484_011725 [Morus notabilis]
Length=1278

 Score =   128 bits (322),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S VFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSAVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+  +D SWFTKGTVERF+RFVST
Sbjct  61   ILEPEPGSDVSWFTKGTVERFVRFVST  87



>ref|XP_007035154.1| COP1-interacting protein-related, putative isoform 2 [Theobroma 
cacao]
 gb|EOY06080.1| COP1-interacting protein-related, putative isoform 2 [Theobroma 
cacao]
Length=1145

 Score =   128 bits (322),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGTVERF+RFVST
Sbjct  61   ILQPEPSIDATWFTKGTVERFVRFVST  87



>ref|XP_007035155.1| COP1-interacting protein-related, putative isoform 3 [Theobroma 
cacao]
 ref|XP_007035157.1| COP1-interacting protein-related, putative isoform 3 [Theobroma 
cacao]
 gb|EOY06081.1| COP1-interacting protein-related, putative isoform 3 [Theobroma 
cacao]
 gb|EOY06083.1| COP1-interacting protein-related, putative isoform 3 [Theobroma 
cacao]
Length=1180

 Score =   128 bits (322),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGTVERF+RFVST
Sbjct  61   ILQPEPSIDATWFTKGTVERFVRFVST  87



>ref|XP_007035153.1| COP1-interacting protein-related, putative isoform 1 [Theobroma 
cacao]
 gb|EOY06079.1| COP1-interacting protein-related, putative isoform 1 [Theobroma 
cacao]
Length=1297

 Score =   128 bits (322),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGTVERF+RFVST
Sbjct  61   ILQPEPSIDATWFTKGTVERFVRFVST  87



>ref|XP_010326768.1| PREDICTED: uncharacterized protein LOC101255735 [Solanum lycopersicum]
Length=1278

 Score =   128 bits (321),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL IIAN+KKEKIA+GLL PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLFIIANDKKEKIASGLLTPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVS  595
            +LEP +H D SWFTK TVERF+RFVS
Sbjct  61   LLEPDAHADDSWFTKCTVERFVRFVS  86



>ref|XP_010650107.1| PREDICTED: uncharacterized protein LOC100251059 isoform X1 [Vitis 
vinifera]
Length=1369

 Score =   128 bits (321),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S VFQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSSTLLDSAVFQLTPTRTRCDLIITANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEPK  +DA+WF KGTVERF+RFVST
Sbjct  61   ILEPKPGSDATWFAKGTVERFVRFVST  87



>ref|XP_010650108.1| PREDICTED: uncharacterized protein LOC100251059 isoform X2 [Vitis 
vinifera]
Length=1345

 Score =   128 bits (321),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S VFQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSSTLLDSAVFQLTPTRTRCDLIITANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEPK  +DA+WF KGTVERF+RFVST
Sbjct  61   ILEPKPGSDATWFAKGTVERFVRFVST  87



>ref|XP_007035156.1| COP1-interacting protein-related, putative isoform 4 [Theobroma 
cacao]
 gb|EOY06082.1| COP1-interacting protein-related, putative isoform 4 [Theobroma 
cacao]
Length=1318

 Score =   128 bits (321),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EKIA+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKIASGLLNPFLAHLKTAQEQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGTVERF+RFVST
Sbjct  61   ILQPEPSIDATWFTKGTVERFVRFVST  87



>ref|XP_009358041.1| PREDICTED: uncharacterized protein LOC103948708 isoform X1 [Pyrus 
x bretschneideri]
Length=1283

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDL+I AN   EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRCDLVISANGMTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TV+RF+RFVST
Sbjct  61   ILEPESGSDAAWFTKRTVQRFVRFVST  87



>ref|XP_009358042.1| PREDICTED: uncharacterized protein LOC103948708 isoform X2 [Pyrus 
x bretschneideri]
Length=1257

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDL+I AN   EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRCDLVISANGMTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TV+RF+RFVST
Sbjct  61   ILEPESGSDAAWFTKRTVQRFVRFVST  87



>ref|XP_009358032.1| PREDICTED: uncharacterized protein LOC103948701 [Pyrus x bretschneideri]
Length=1257

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDL+I AN   EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRCDLVISANGMTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TV+RF+RFVST
Sbjct  61   ILEPESGSDAAWFTKRTVQRFVRFVST  87



>ref|XP_002863666.1| hypothetical protein ARALYDRAFT_494672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39925.1| hypothetical protein ARALYDRAFT_494672 [Arabidopsis lyrata subsp. 
lyrata]
Length=1192

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTA+DQ+ K GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAKDQLEKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRF  589
            +L+P++ ++A+WFTKGT+ERF+RF
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRF  84



>ref|XP_002311679.1| hypothetical protein POPTR_0008s16810g [Populus trichocarpa]
 gb|EEE89046.1| hypothetical protein POPTR_0008s16810g [Populus trichocarpa]
Length=1218

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S VFQLTPTRTRCDLII  N K EK+A+GL+ PFL HLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSAVFQLTPTRTRCDLIICVNGKIEKVASGLVQPFLDHLKTAQDQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP S  DA+WFTKGTVERF+RFVST
Sbjct  61   ILEPGS--DATWFTKGTVERFVRFVST  85



>ref|XP_011029807.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105129435 
[Populus euphratica]
Length=1314

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S VFQLTPTRTRCDLII  N K EK+A+GL+ PFL HLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSAVFQLTPTRTRCDLIICVNGKIEKVASGLVQPFLDHLKTAQDQVAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP S  DA+WFTKGTVERF+RFVST
Sbjct  61   ILEPGS--DATWFTKGTVERFVRFVST  85



>ref|XP_002489097.1| hypothetical protein SORBIDRAFT_0073s002020 [Sorghum bicolor]
 gb|EES20541.1| hypothetical protein SORBIDRAFT_0073s002020 [Sorghum bicolor]
Length=152

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+SVVFQLTPTRTR DL++IAN +KEK A+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDSVVFQLTPTRTRFDLVLIANGRKEKFASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S  D  WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGFDVPWFTRGTVERFVRFVST  87



>ref|XP_008391239.1| PREDICTED: uncharacterized protein LOC103453473 [Malus domestica]
Length=816

 Score =   125 bits (314),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+  +FQLTPTRTRCDL+I AN K  KIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDLALFQLTPTRTRCDLVISANGKTXKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TVERF+RFVST
Sbjct  61   ILEPESGSDATWFTKXTVERFVRFVST  87



>gb|KJB38392.1| hypothetical protein B456_006G252900 [Gossypium raimondii]
Length=1114

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K +K+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTQKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA+WF+KGTVERF+RFVST
Sbjct  61   ILQPDPTIDATWFSKGTVERFVRFVST  87



>ref|XP_007225456.1| hypothetical protein PRUPE_ppa000302mg [Prunus persica]
 gb|EMJ26655.1| hypothetical protein PRUPE_ppa000302mg [Prunus persica]
Length=1312

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTR DL+I AN K EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRYDLVISANGKTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TVERF+RFVST
Sbjct  61   ILEPESGSDATWFTKSTVERFVRFVST  87



>ref|XP_008224333.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Prunus 
mume]
Length=1316

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTR DL+I AN K EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSALFQLTPTRTRYDLVISANGKTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TVERF+RFVST
Sbjct  61   ILEPESGSDATWFTKSTVERFVRFVST  87



>ref|XP_009401936.1| PREDICTED: uncharacterized protein LOC103985817 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1266

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL S+VFQLTPTRTRCDLIIIAN K++KIA+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRSEARLESLVFQLTPTRTRCDLIIIANGKRQKIASGLLTPFLAHLKFAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    +A+WFTKGTVERF+RFVST
Sbjct  61   ILEPDPETEAAWFTKGTVERFVRFVST  87



>ref|XP_009401933.1| PREDICTED: uncharacterized protein LOC103985817 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401934.1| PREDICTED: uncharacterized protein LOC103985817 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1291

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL S+VFQLTPTRTRCDLIIIAN K++KIA+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRSEARLESLVFQLTPTRTRCDLIIIANGKRQKIASGLLTPFLAHLKFAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    +A+WFTKGTVERF+RFVST
Sbjct  61   ILEPDPETEAAWFTKGTVERFVRFVST  87



>ref|XP_009401935.1| PREDICTED: uncharacterized protein LOC103985817 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1286

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL S+VFQLTPTRTRCDLIIIAN K++KIA+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRSEARLESLVFQLTPTRTRCDLIIIANGKRQKIASGLLTPFLAHLKFAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    +A+WFTKGTVERF+RFVST
Sbjct  61   ILEPDPETEAAWFTKGTVERFVRFVST  87



>gb|KJB38393.1| hypothetical protein B456_006G252900 [Gossypium raimondii]
Length=1230

 Score =   125 bits (313),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K +K+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTQKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA+WF+KGTVERF+RFVST
Sbjct  61   ILQPDPTIDATWFSKGTVERFVRFVST  87



>ref|XP_007145900.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
 gb|ESW17894.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
Length=1244

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+SV+FQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSVMFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL PK   DASWFTKGT+ERF+RFVST
Sbjct  61   VLVPKLDTDASWFTKGTIERFVRFVST  87



>ref|XP_007145901.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
 gb|ESW17895.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
Length=1249

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+SV+FQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSVMFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL PK   DASWFTKGT+ERF+RFVST
Sbjct  61   VLVPKLDTDASWFTKGTIERFVRFVST  87



>ref|XP_007145902.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
 gb|ESW17896.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
Length=1250

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+SV+FQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSVMFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL PK   DASWFTKGT+ERF+RFVST
Sbjct  61   VLVPKLDTDASWFTKGTIERFVRFVST  87



>ref|XP_007145899.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
 gb|ESW17893.1| hypothetical protein PHAVU_007G277200g [Phaseolus vulgaris]
Length=1243

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+SV+FQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSVMFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL PK   DASWFTKGT+ERF+RFVST
Sbjct  61   VLVPKLDTDASWFTKGTIERFVRFVST  87



>ref|XP_003519712.1| PREDICTED: uncharacterized protein LOC100776852 isoform X1 [Glycine 
max]
Length=1243

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+S VFQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSAVFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+  +DASWFTKGTVERF+RFVST
Sbjct  61   VLVPEHGSDASWFTKGTVERFVRFVST  87



>gb|KJB38391.1| hypothetical protein B456_006G252900 [Gossypium raimondii]
Length=1282

 Score =   124 bits (312),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K +K+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTQKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA+WF+KGTVERF+RFVST
Sbjct  61   ILQPDPTIDATWFSKGTVERFVRFVST  87



>ref|XP_009383975.1| PREDICTED: uncharacterized protein LOC103971636 [Musa acuminata 
subsp. malaccensis]
Length=1299

 Score =   124 bits (312),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL+S VFQLTPTRTRCDL+IIAN+K EKIA+GLL+PFLAHLK AQDQIAK GYSI
Sbjct  1    MRSEARLDSAVFQLTPTRTRCDLVIIANDKTEKIASGLLNPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    DA+WFTKGTVERF+RFVST
Sbjct  61   ILEPDPETDAAWFTKGTVERFVRFVST  87



>gb|KJB38390.1| hypothetical protein B456_006G252900 [Gossypium raimondii]
Length=1285

 Score =   124 bits (312),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K +K+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTQKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA+WF+KGTVERF+RFVST
Sbjct  61   ILQPDPTIDATWFSKGTVERFVRFVST  87



>gb|KHN00274.1| hypothetical protein glysoja_022878 [Glycine soja]
Length=1243

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+S VFQLTPTRTR DL+I  N KKEK+A+GLL+PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSAVFQLTPTRTRFDLVITVNGKKEKVASGLLNPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+  +DASWFTKGTVERF+RFVST
Sbjct  61   VLVPEHGSDASWFTKGTVERFVRFVST  87



>ref|XP_004296379.1| PREDICTED: uncharacterized protein LOC101304269 [Fragaria vesca 
subsp. vesca]
Length=1291

 Score =   124 bits (312),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+SSTRL+S +FQLTPTRTRCDL+I AN K EKIA+GLL+PFL+HLKTAQ+Q+AK GYSI
Sbjct  1    MRSSTRLDSALFQLTPTRTRCDLVISANGKTEKIASGLLNPFLSHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK TVERF+RFVST
Sbjct  61   ILEPESGSDAAWFTKSTVERFVRFVST  87



>ref|XP_011091290.1| PREDICTED: uncharacterized protein LOC105171767 isoform X2 [Sesamum 
indicum]
Length=1305

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+STRL+S VFQLTPTRTRCDL IIAN KKEKIA+GLL+PFL HLK AQDQIAK GYSI
Sbjct  1    MKASTRLSSAVFQLTPTRTRCDLFIIANGKKEKIASGLLNPFLDHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++  DA+WFTK T+ERF+RFVST
Sbjct  61   LLEPETDVDAAWFTKATMERFVRFVST  87



>ref|XP_011091292.1| PREDICTED: uncharacterized protein LOC105171767 isoform X4 [Sesamum 
indicum]
Length=1267

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+STRL+S VFQLTPTRTRCDL IIAN KKEKIA+GLL+PFL HLK AQDQIAK GYSI
Sbjct  1    MKASTRLSSAVFQLTPTRTRCDLFIIANGKKEKIASGLLNPFLDHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++  DA+WFTK T+ERF+RFVST
Sbjct  61   LLEPETDVDAAWFTKATMERFVRFVST  87



>ref|XP_011091289.1| PREDICTED: uncharacterized protein LOC105171767 isoform X1 [Sesamum 
indicum]
Length=1306

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+STRL+S VFQLTPTRTRCDL IIAN KKEKIA+GLL+PFL HLK AQDQIAK GYSI
Sbjct  1    MKASTRLSSAVFQLTPTRTRCDLFIIANGKKEKIASGLLNPFLDHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++  DA+WFTK T+ERF+RFVST
Sbjct  61   LLEPETDVDAAWFTKATMERFVRFVST  87



>ref|XP_011091291.1| PREDICTED: uncharacterized protein LOC105171767 isoform X3 [Sesamum 
indicum]
Length=1273

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+STRL+S VFQLTPTRTRCDL IIAN KKEKIA+GLL+PFL HLK AQDQIAK GYSI
Sbjct  1    MKASTRLSSAVFQLTPTRTRCDLFIIANGKKEKIASGLLNPFLDHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++  DA+WFTK T+ERF+RFVST
Sbjct  61   LLEPETDVDAAWFTKATMERFVRFVST  87



>ref|XP_010523166.1| PREDICTED: uncharacterized protein LOC104801554 [Tarenaya hassleriana]
Length=1217

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S VFQLTPTRTRCDL++ AN K EKIA+GL+ PFLAHLKTAQDQ+ K GYSI
Sbjct  1    MKSSTRLDSAVFQLTPTRTRCDLLVTANGKTEKIASGLVKPFLAHLKTAQDQVDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ +DA+WFTK T+ RF+RFVST
Sbjct  61   ILKPEAGDDATWFTKRTIARFVRFVST  87



>ref|XP_011030481.1| PREDICTED: uncharacterized protein LOC105129915 isoform X3 [Populus 
euphratica]
 ref|XP_011030482.1| PREDICTED: uncharacterized protein LOC105129915 isoform X4 [Populus 
euphratica]
Length=1314

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDLII  N K EKIA+GL  PFL HLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSAIFQLTPTRTRCDLIICVNGKTEKIASGLAQPFLDHLKTAQDQLAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP +  DA+WFTKGT+ERF+RFVST
Sbjct  61   ILEPGT--DAAWFTKGTIERFVRFVST  85



>ref|XP_010906787.1| PREDICTED: uncharacterized protein LOC105033613 [Elaeis guineensis]
Length=1325

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS  RL+S VFQLTPTRTRCDL+I+AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKSEARLDSAVFQLTPTRTRCDLVIVANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFTKGTVERF+RFVST
Sbjct  61   TLEPDPKIDAVWFTKGTVERFVRFVST  87



>emb|CDY47813.1| BnaC07g17040D [Brassica napus]
Length=1144

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL++ AN K EKIATGLLDPFLAHLKTAQDQ++K GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLLVTANGKTEKIATGLLDPFLAHLKTAQDQVSKGGYSI  60

Query  518  VLEPKSHND-ASWFTKGTVER-FIRFVST  598
            +L+P   +D A WFTK T+ER F+RFVS 
Sbjct  61   ILKPPEDSDIAVWFTKATIERWFVRFVSN  89



>gb|KHN10069.1| hypothetical protein glysoja_034311 [Glycine soja]
Length=1239

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SSTRL+S VFQLTPTRTR DL I  N KKEK+A+GLL PFL+HLK AQDQIAK GYSI
Sbjct  1    MNSSTRLDSAVFQLTPTRTRFDLFITVNGKKEKVASGLLKPFLSHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+  +DASWFTKGT+ERF+RFVST
Sbjct  61   VLVPEHGSDASWFTKGTIERFVRFVST  87



>gb|KHG12236.1| Protein lifeguard 1 [Gossypium arboreum]
Length=1277

 Score =   122 bits (307),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SVVFQLTPTRTRCDL+I AN K EK+A+GLL+PFLAHLKTAQ+Q+AK GYSI
Sbjct  1    MKSSTRLDSVVFQLTPTRTRCDLVISANGKTEKMASGLLNPFLAHLKTAQEQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA+WF+KGTVE F+RFVST
Sbjct  61   ILQPDPTIDATWFSKGTVESFVRFVST  87



>ref|XP_010934302.1| PREDICTED: uncharacterized protein LOC105054479 isoform X2 [Elaeis 
guineensis]
Length=1159

 Score =   121 bits (304),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK   RL+SVVF LTPTRTRCDL+I+AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKPEARLDSVVFHLTPTRTRCDLVIVANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFTKGTVERF+RFVST
Sbjct  61   KLEPDPKIDAGWFTKGTVERFVRFVST  87



>ref|XP_006279941.1| hypothetical protein CARUB_v10025805mg [Capsella rubella]
 gb|EOA12839.1| hypothetical protein CARUB_v10025805mg [Capsella rubella]
Length=1018

 Score =   121 bits (303),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+SV FQLTPTRTR DL++ AN K EKIATGLLDPFL HL TA+DQ+AK GYSI
Sbjct  1    MKSSTRLDSVAFQLTPTRTRFDLLVTANGKTEKIATGLLDPFLPHLNTAKDQLAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P++ ++A+WFTKGT+ERF+RFVST
Sbjct  61   ILKPEASDNAAWFTKGTIERFVRFVST  87



>gb|EPS65746.1| hypothetical protein M569_09031, partial [Genlisea aurea]
Length=358

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+ ST L S VFQLTPTRTRC+LIII+N KKEKIA+GL++PFLAHLK AQ++IAK GYSI
Sbjct  7    MRPSTLLTSAVFQLTPTRTRCELIIISNGKKEKIASGLINPFLAHLKVAQNEIAKGGYSI  66

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +DA+WFTK T+ERF+RFVST
Sbjct  67   LLEPESGSDATWFTKATMERFVRFVST  93



>ref|XP_010934301.1| PREDICTED: uncharacterized protein LOC105054479 isoform X1 [Elaeis 
guineensis]
Length=1321

 Score =   121 bits (303),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK   RL+SVVF LTPTRTRCDL+I+AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKPEARLDSVVFHLTPTRTRCDLVIVANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFTKGTVERF+RFVST
Sbjct  61   KLEPDPKIDAGWFTKGTVERFVRFVST  87



>ref|XP_010069119.1| PREDICTED: uncharacterized protein LOC104456093 [Eucalyptus grandis]
 ref|XP_010069120.1| PREDICTED: uncharacterized protein LOC104456093 [Eucalyptus grandis]
 ref|XP_010069121.1| PREDICTED: uncharacterized protein LOC104456093 [Eucalyptus grandis]
 gb|KCW57364.1| hypothetical protein EUGRSUZ_H00149 [Eucalyptus grandis]
Length=1314

 Score =   120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRCDL+I+AN K  KIA+GLL PFLAHLK AQ+Q+A+ GYSI
Sbjct  1    MKPSTRLDSAVFQLTPTRTRCDLVIVANGKTLKIASGLLSPFLAHLKAAQEQMARGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP+  +DA+WFTKGTVERF+RFVST
Sbjct  61   NLEPEPGSDATWFTKGTVERFVRFVST  87



>ref|XP_003590837.1| COP1-interacting protein [Medicago truncatula]
Length=1358

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SS RL+S VFQLTPTRTR DLII  + KKEKIA+GLL+PFL+HLK AQDQI K GYSI
Sbjct  1    MNSSMRLDSAVFQLTPTRTRFDLIITVHGKKEKIASGLLNPFLSHLKAAQDQIDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VLEP+  +DA+WFTKGT+ERF+RFV+T
Sbjct  61   VLEPEGGSDATWFTKGTLERFVRFVNT  87



>ref|XP_006650936.1| PREDICTED: uncharacterized protein LOC102700882 [Oryza brachyantha]
Length=1248

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S VFQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ+QIAK GYSI
Sbjct  1    MRPETRLDSAVFQLTPTRTRCDLVVIANGQKEKIASGLLNPFVAHLKDAQEQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE +   DA WFT+GTVERF+RFVST
Sbjct  61   TLEAEPEIDAPWFTRGTVERFVRFVST  87



>ref|XP_002528832.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33566.1| conserved hypothetical protein [Ricinus communis]
Length=1280

 Score =   119 bits (299),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRC+L+I AN K EKIA+GL++PFLAHLKTAQDQ+AK GYSI
Sbjct  1    MKYSTRLDSAVFQLTPTRTRCELVISANGKTEKIASGLVNPFLAHLKTAQDQMAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+    A+WFTK TVERF+RFVST
Sbjct  61   ILEPEPGTGATWFTKETVERFVRFVST  87



>ref|XP_011030478.1| PREDICTED: uncharacterized protein LOC105129915 isoform X1 [Populus 
euphratica]
 ref|XP_011030479.1| PREDICTED: uncharacterized protein LOC105129915 isoform X2 [Populus 
euphratica]
Length=1319

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDLII  N K EKIA+GL  PFL HLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSAIFQLTPTRTRCDLIICVNGKTEKIASGLAQPFLDHLKTAQDQLAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP +  DA+WFTKGT+ERF+RFVST
Sbjct  61   ILEPGT--DAAWFTKGTIERFVRFVST  85



>gb|KHG23764.1| Methylmalonyl-CoA mutase large subunit [Gossypium arboreum]
Length=1272

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST+L+S VFQLTPTRTR +L+I AN K EK+A+GLL+PFL HLK AQDQI+K GYSI
Sbjct  1    MKSSTQLDSAVFQLTPTRTRFELVISANGKSEKMASGLLNPFLTHLKIAQDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGT+ERF+RFVST
Sbjct  61   ILQPEPGIDATWFTKGTMERFVRFVST  87



>ref|XP_004956087.1| PREDICTED: uncharacterized protein LOC101774245 [Setaria italica]
Length=883

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+SVVFQLTPTRTR DL++IAN +KEK A+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDSVVFQLTPTRTRFDLVLIANGRKEKFASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S  DA WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGFDAPWFTRGTVERFVRFVST  87



>ref|XP_008460655.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103499428 
[Cucumis melo]
Length=1304

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S  FQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLK AQ+Q+A+ GYSI
Sbjct  1    MKSSTVLDSATFQLTPTRTRCDLIISANGKSEKIASGLLNPFLAHLKIAQEQMARGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP+S +D++WFTKGT+ERF+RFV T
Sbjct  61   ILEPESRSDSTWFTKGTMERFVRFVCT  87



>ref|XP_002466054.1| hypothetical protein SORBIDRAFT_01g000280 [Sorghum bicolor]
 gb|EER93052.1| hypothetical protein SORBIDRAFT_01g000280 [Sorghum bicolor]
Length=1257

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL S VFQLTPTRTRCDL+++AN +KEKIA+GLL+PF+ HLK AQ+QIAK GYSI
Sbjct  1    MRPDTRLESAVFQLTPTRTRCDLVVVANGRKEKIASGLLNPFVTHLKVAQEQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    D  WFT+GTVERF+RFVST
Sbjct  61   TLEPDPEIDVPWFTRGTVERFVRFVST  87



>ref|XP_009382002.1| PREDICTED: uncharacterized protein LOC103970089 [Musa acuminata 
subsp. malaccensis]
Length=1287

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+S VFQLTPTRTRCDL+IIAN K EKIATGLL+PFLAHLK AQDQI K GYSI
Sbjct  1    MRLDARLDSAVFQLTPTRTRCDLVIIANGKTEKIATGLLNPFLAHLKAAQDQIDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL+P   +DA+WFTKGT+ERF+RFVST
Sbjct  61   VLKPDLESDAAWFTKGTMERFVRFVST  87



>ref|XP_008785220.1| PREDICTED: uncharacterized protein LOC103703928 [Phoenix dactylifera]
Length=1324

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK   RL+S+VF LTPTRTRCDL+I+AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKQEARLDSLVFHLTPTRTRCDLVIVANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFTKG VERF+RFVST
Sbjct  61   KLEPDPKIDAVWFTKGIVERFVRFVST  87



>ref|XP_008652311.1| PREDICTED: uncharacterized protein LOC103632278 [Zea mays]
 tpg|DAA60443.1| TPA: hypothetical protein ZEAMMB73_072037 [Zea mays]
Length=884

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S  RL+SVVFQLTPTRTR DL++IAN +KEK A+GLL PF+AHLK AQDQIAK GYSI
Sbjct  1    MRSDARLDSVVFQLTPTRTRFDLVLIANGRKEKFASGLLKPFVAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S  D  WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGFDVPWFTRGTVERFVRFVST  87



>gb|EMT26204.1| hypothetical protein F775_01959 [Aegilops tauschii]
Length=1302

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S  FQLTPTRTRCDLI+IAN +KEKIA+GLL+PF+AHLK AQDQIAK GY+I
Sbjct  1    MRPETRLDSAAFQLTPTRTRCDLIVIANGRKEKIASGLLNPFVAHLKAAQDQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    DA WFT+GTVERF+RFVST
Sbjct  61   LLEPDPGADAPWFTRGTVERFVRFVST  87



>ref|NP_001051978.1| Os03g0861100 [Oryza sativa Japonica Group]
 gb|ABG00027.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13892.1| Os03g0861100 [Oryza sativa Japonica Group]
 dbj|BAG94729.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1256

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S VFQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ QIAK GYSI
Sbjct  1    MRPETRLDSAVFQLTPTRTRCDLVVIANGRKEKIASGLLNPFVAHLKVAQQQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE     DA WFT+GTVERF+RFVST
Sbjct  61   TLEVDPEIDAPWFTRGTVERFVRFVST  87



>gb|EEC76590.1| hypothetical protein OsI_14439 [Oryza sativa Indica Group]
Length=1275

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S VFQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ QIAK GYSI
Sbjct  1    MRPETRLDSAVFQLTPTRTRCDLVVIANGRKEKIASGLLNPFVAHLKVAQQQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE     DA WFT+GTVERF+RFVST
Sbjct  61   TLEVDPEIDAPWFTRGTVERFVRFVST  87



>gb|EEE60346.1| hypothetical protein OsJ_13460 [Oryza sativa Japonica Group]
Length=1275

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S VFQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ QIAK GYSI
Sbjct  1    MRPETRLDSAVFQLTPTRTRCDLVVIANGRKEKIASGLLNPFVAHLKVAQQQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE     DA WFT+GTVERF+RFVST
Sbjct  61   TLEVDPEIDAPWFTRGTVERFVRFVST  87



>gb|KHN30584.1| hypothetical protein glysoja_030021 [Glycine soja]
Length=1293

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+S VFQLTPTRTR DLII  N KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNTSTRLDSAVFQLTPTRTRFDLIITVNGKKEKIASGLLNPFLSHLKAAQNQMDKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNTDTSWFTKGTVERFVRFVST  88



>ref|XP_004980952.1| PREDICTED: uncharacterized protein LOC101783885 [Setaria italica]
Length=1255

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL S VFQLTPTRTRCDL+++AN  KEKIA+GLL+PF+AHLK AQ+QIAK GYSI
Sbjct  1    MRPETRLESAVFQLTPTRTRCDLVVVANGWKEKIASGLLNPFVAHLKVAQEQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFT+GTVERF+RFVST
Sbjct  61   TLEPDPEIDAPWFTRGTVERFVRFVST  87



>gb|KJB28480.1| hypothetical protein B456_005G050900 [Gossypium raimondii]
Length=1236

 Score =   115 bits (289),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST+L+S VFQLTPTRTR +L+I AN K EK+A+GLL+PFLAHLK AQDQI+K GYSI
Sbjct  1    MKSSTQLDSAVFQLTPTRTRFELVISANGKSEKMASGLLNPFLAHLKIAQDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P+   DA+WFTKGT+ERF+RFVST
Sbjct  61   ILQPEPGIDATWFTKGTMERFVRFVST  87



>ref|XP_004497981.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Cicer arietinum]
Length=1172

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK S RL SVVFQLTPTRTR DL+I  N K EKIA+GLL PFL+ LK AQDQI K GYSI
Sbjct  1    MKFSVRLESVVFQLTPTRTRFDLVITVNGKTEKIASGLLSPFLSQLKAAQDQIGKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+  +DA+WFTKGT+ERF+RFVST
Sbjct  61   VLVPEHASDATWFTKGTIERFVRFVST  87



>ref|NP_001059533.1| Os07g0445600 [Oryza sativa Japonica Group]
 dbj|BAC79948.1| COP1-interacting protein 7 (CIP7)-like protein [Oryza sativa 
Japonica Group]
 dbj|BAD31401.1| COP1-interacting protein 7 (CIP7)-like protein [Oryza sativa 
Japonica Group]
 dbj|BAF21447.1| Os07g0445600 [Oryza sativa Japonica Group]
Length=814

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL++ VFQLTPTRTR DL++I N +KEKIA+GLL+PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDAAVFQLTPTRTRFDLVVIVNGRKEKIASGLLNPFLAHLKVAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S   A WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGVGAPWFTRGTVERFVRFVST  87



>gb|EMS67669.1| hypothetical protein TRIUR3_15284 [Triticum urartu]
Length=1272

 Score =   115 bits (287),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S  FQLTPTRTRCDLI+IAN +KEKIA+GLL+PF+AHLK AQ+QIAK GY+I
Sbjct  1    MRPETRLDSAAFQLTPTRTRCDLIVIANGRKEKIASGLLNPFVAHLKAAQEQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP    DA WFT+GT+ERF+RFVST
Sbjct  61   LLEPDPGADAPWFTRGTLERFVRFVST  87



>gb|AES61088.2| COP1-interacting-like protein [Medicago truncatula]
Length=1267

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SS RL+S VFQLTPTRTR DLII  + KKEKIA+GLL+PFL+HLK AQDQI K GYSI
Sbjct  1    MNSSMRLDSAVFQLTPTRTRFDLIITVHGKKEKIASGLLNPFLSHLKAAQDQIDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VLEP+  +DA+WFTKGT+ERF+RFV+T
Sbjct  61   VLEPEGGSDATWFTKGTLERFVRFVNT  87



>ref|XP_003563185.1| PREDICTED: uncharacterized protein LOC100821282 [Brachypodium 
distachyon]
Length=884

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+S VFQLTPTRTR DL++I N +KEKIA+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDSAVFQLTPTRTRFDLVLIVNGRKEKIASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S  +A WFT+GTVERF+RFVST
Sbjct  61   TLEPNSGVEAPWFTRGTVERFVRFVST  87



>ref|XP_010228578.1| PREDICTED: uncharacterized protein LOC100826686 isoform X2 [Brachypodium 
distachyon]
Length=1116

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S  FQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ+QIAK GY+I
Sbjct  1    MRPETRLDSAAFQLTPTRTRCDLVVIANGRKEKIASGLLNPFIAHLKVAQEQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE     DA WFT+GTVERF+RFVST
Sbjct  61   SLELDPETDAPWFTRGTVERFVRFVST  87



>gb|EEE67090.1| hypothetical protein OsJ_24074 [Oryza sativa Japonica Group]
Length=876

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL++ VFQLTPTRTR DL++I N +KEKIA+GLL+PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDAAVFQLTPTRTRFDLVVIVNGRKEKIASGLLNPFLAHLKVAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S   A WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGVGAPWFTRGTVERFVRFVST  87



>ref|XP_008665790.1| PREDICTED: microtubule-associated protein futsch-like [Zea mays]
 ref|XP_008665791.1| PREDICTED: microtubule-associated protein futsch-like [Zea mays]
 tpg|DAA52612.1| TPA: hypothetical protein ZEAMMB73_862643 [Zea mays]
Length=1234

 Score =   114 bits (285),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL S VFQLTPTRTRCDL+++AN +KEKIA+GLL+PF+AHLK AQ+QIAK GYSI
Sbjct  1    MRPDTRLESAVFQLTPTRTRCDLVVVANGRKEKIASGLLNPFVAHLKVAQEQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP    DA WFT+GT++RF+RFVST
Sbjct  61   TLEPDPEIDAPWFTRGTLDRFVRFVST  87



>gb|EEC81954.1| hypothetical protein OsI_25833 [Oryza sativa Indica Group]
Length=877

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL++ VFQLTPTRTR DL++I N +KEKIA+GLL+PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDARLDAAVFQLTPTRTRFDLVVIVNGRKEKIASGLLNPFLAHLKVAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S   A WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGVGAPWFTRGTVERFVRFVST  87



>ref|XP_006857334.1| hypothetical protein AMTR_s00067p00089960 [Amborella trichopoda]
 gb|ERN18801.1| hypothetical protein AMTR_s00067p00089960 [Amborella trichopoda]
Length=1357

 Score =   113 bits (283),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+ T+L+S VFQLTPTRTRCDL+I AN   EKI +GLLDPFL H++TAQ QIAK GYSI
Sbjct  1    MKAETKLDSAVFQLTPTRTRCDLVIFANGTSEKIVSGLLDPFLTHMRTAQHQIAKGGYSI  60

Query  518  VLEPKSHND--ASWFTKGTVERFIRFVST  598
             LEP   N+   +WFTKGTVERF+RFVST
Sbjct  61   QLEPGPGNNQGVAWFTKGTVERFVRFVST  89



>gb|EMT12062.1| hypothetical protein F775_32660 [Aegilops tauschii]
Length=885

 Score =   112 bits (280),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+S  FQLTPTRTRCDL+++ N +KEKIA+GLL+PF+AHLK AQ+QIAK GY+I
Sbjct  1    MRPEMRLDSAAFQLTPTRTRCDLVVVVNGRKEKIASGLLNPFVAHLKVAQEQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA WFT+GT+ERF+RFVST
Sbjct  61   LLQPDPGADAPWFTRGTIERFVRFVST  87



>emb|CDP05883.1| unnamed protein product [Coffea canephora]
Length=1099

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+ V+FQLTPTRTRCDL+I A  K EK A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDSRTHLDYVLFQLTPTRTRCDLVIFAGNKNEKFASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S+N ASWFTK T+ERF+RFVST
Sbjct  61   TLRPTSNN-ASWFTKATLERFVRFVST  86



>ref|XP_006658517.1| PREDICTED: uncharacterized protein LOC102703415 [Oryza brachyantha]
Length=871

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL++ VFQLTPTRTR DL+++ N +KEKIA+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPDVRLDAAVFQLTPTRTRFDLVVVVNGRKEKIASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP S   A WFT+GTVERF+RFVST
Sbjct  61   TLEPSSGVVAPWFTRGTVERFVRFVST  87



>ref|XP_007144033.1| hypothetical protein PHAVU_007G123500g [Phaseolus vulgaris]
 ref|XP_007144034.1| hypothetical protein PHAVU_007G123500g [Phaseolus vulgaris]
 gb|ESW16027.1| hypothetical protein PHAVU_007G123500g [Phaseolus vulgaris]
 gb|ESW16028.1| hypothetical protein PHAVU_007G123500g [Phaseolus vulgaris]
Length=1290

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+S VFQLTPTRTR DL+I AN KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNASTRLDSAVFQLTPTRTRFDLVITANGKKEKIASGLLNPFLSHLKAAQNQMEKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNSDTSWFTKGTVERFVRFVST  88



>ref|XP_004168400.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101205835 
[Cucumis sativus]
Length=1257

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S  FQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLK AQ+Q+A+ GYSI
Sbjct  1    MKSSTVLDSATFQLTPTRTRCDLIISANGKSEKIASGLLNPFLAHLKIAQEQMARGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP   + ++WFTKGT+ERF+RFV T
Sbjct  61   TLEPDPRSGSTWFTKGTMERFVRFVCT  87



>gb|KGN61590.1| hypothetical protein Csa_2G173580 [Cucumis sativus]
Length=1303

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S  FQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLK AQ+Q+A+ GYSI
Sbjct  1    MKSSTVLDSATFQLTPTRTRCDLIISANGKSEKIASGLLNPFLAHLKIAQEQMARGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP   + ++WFTKGT+ERF+RFV T
Sbjct  61   TLEPDPRSGSTWFTKGTMERFVRFVCT  87



>ref|XP_004147152.1| PREDICTED: uncharacterized protein LOC101205835 [Cucumis sativus]
Length=1303

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+S  FQLTPTRTRCDLII AN K EKIA+GLL+PFLAHLK AQ+Q+A+ GYSI
Sbjct  1    MKSSTVLDSATFQLTPTRTRCDLIISANGKSEKIASGLLNPFLAHLKIAQEQMARGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP   + ++WFTKGT+ERF+RFV T
Sbjct  61   TLEPDPRSGSTWFTKGTMERFVRFVCT  87



>ref|XP_003557289.1| PREDICTED: uncharacterized protein LOC100826686 isoform X1 [Brachypodium 
distachyon]
Length=1256

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S  FQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ+QIAK GY+I
Sbjct  1    MRPETRLDSAAFQLTPTRTRCDLVVIANGRKEKIASGLLNPFIAHLKVAQEQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LE     DA WFT+GTVERF+RFVST
Sbjct  61   SLELDPETDAPWFTRGTVERFVRFVST  87



>gb|EMS50566.1| hypothetical protein TRIUR3_31968 [Triticum urartu]
Length=887

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+S  FQLTPTRTRCDL+++ N +KEKIA+GLL+PF+AHLK AQ+QIAK GY+I
Sbjct  1    MRPEARLDSAAFQLTPTRTRCDLVVVVNGRKEKIASGLLNPFVAHLKVAQEQIAKGGYTI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +L+P    DA WFT+GT++RF+RFVST
Sbjct  61   LLQPDPGADAPWFTRGTIQRFVRFVST  87



>gb|EPS66126.1| hypothetical protein M569_08650, partial [Genlisea aurea]
Length=342

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            + S + L+  VFQLTPTRTRCDL+I   +  EKIA+GLLDPF++HLK+A+D+I+K GYSI
Sbjct  8    IDSGSVLDYAVFQLTPTRTRCDLMIFDGKNSEKIASGLLDPFVSHLKSARDEISKGGYSI  67

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S +D SWFTK T+ERF+RFV+T
Sbjct  68   TLRPHSSHDDSWFTKATLERFVRFVNT  94



>gb|EYU18308.1| hypothetical protein MIMGU_mgv1a000492mg [Erythranthe guttata]
Length=1121

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 8/87 (9%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRCDLIIIAN+KKEKIA+GLL+PFLAHLKTAQDQIAK GYSI
Sbjct  1    MKRSTRLSSAVFQLTPTRTRCDLIIIANDKKEKIASGLLNPFLAHLKTAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEPK+  DA+W        F+RFVST
Sbjct  61   LLEPKNGTDAAW--------FVRFVST  79



>ref|XP_011098337.1| PREDICTED: uncharacterized protein LOC105177021 [Sesamum indicum]
Length=1154

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I A +K EKIA+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDSRTLLDYALFQLTPTRTRCDLVIFAGKKNEKIASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + +SWFTK T+ERF+RFVST
Sbjct  61   TLRPASSDSSSWFTKATLERFVRFVST  87



>ref|XP_006606379.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
Length=1116

 Score =   109 bits (273),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+  VFQLTPTRTR DLII  N KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNTSTRLDLAVFQLTPTRTRFDLIITVNGKKEKIASGLLNPFLSHLKAAQNQMDKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNTDTSWFTKGTVERFVRFVST  88



>ref|XP_006606378.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=1240

 Score =   109 bits (273),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+  VFQLTPTRTR DLII  N KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNTSTRLDLAVFQLTPTRTRFDLIITVNGKKEKIASGLLNPFLSHLKAAQNQMDKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNTDTSWFTKGTVERFVRFVST  88



>ref|XP_002965831.1| hypothetical protein SELMODRAFT_85048 [Selaginella moellendorffii]
 gb|EFJ33251.1| hypothetical protein SELMODRAFT_85048 [Selaginella moellendorffii]
Length=128

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+   L+  VFQLTPTRTRC+L+I ++   EK+A+GLL PFLAHL+ A++QIA  GYSI
Sbjct  1    MKADIVLDFAVFQLTPTRTRCELLISSHGVSEKLASGLLKPFLAHLRAAEEQIAVGGYSI  60

Query  518  VLEP---KSHNDASWFTKGTVERFIRFVST  598
             LEP    +   ASWFTKGT++RF+RFVST
Sbjct  61   RLEPPIDGNQGKASWFTKGTMQRFVRFVST  90



>gb|KDO74141.1| hypothetical protein CISIN_1g001001mg [Citrus sinensis]
Length=841

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A +  EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + ASWFTK T++RF+RFVST
Sbjct  61   TLRPVSSSAASWFTKATLQRFVRFVST  87



>ref|XP_006451934.1| hypothetical protein CICLE_v10007365mg [Citrus clementina]
 gb|ESR65174.1| hypothetical protein CICLE_v10007365mg [Citrus clementina]
Length=956

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A +  EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + ASWFTK T++RF+RFVST
Sbjct  61   TLRPVSSSAASWFTKATLQRFVRFVST  87



>ref|XP_006606377.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
Length=1282

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+  VFQLTPTRTR DLII  N KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNTSTRLDLAVFQLTPTRTRFDLIITVNGKKEKIASGLLNPFLSHLKAAQNQMDKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNTDTSWFTKGTVERFVRFVST  88



>gb|KHN05080.1| hypothetical protein glysoja_013987 [Glycine soja]
Length=1282

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +STRL+  VFQLTPTRTR DLII  N KKEKIA+GLL+PFL+HLK AQ+Q+ K GYSI
Sbjct  1    MNTSTRLDLAVFQLTPTRTRFDLIITVNGKKEKIASGLLNPFLSHLKAAQNQMDKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
            VLEP   N D SWFTKGTVERF+RFVST
Sbjct  61   VLEPPEGNTDTSWFTKGTVERFVRFVST  88



>ref|XP_006464713.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=1193

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A +  EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + ASWFTK T++RF+RFVST
Sbjct  61   TLRPVSSSAASWFTKATLQRFVRFVST  87



>gb|KDO74140.1| hypothetical protein CISIN_1g001001mg [Citrus sinensis]
Length=1193

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A +  EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + ASWFTK T++RF+RFVST
Sbjct  61   TLRPVSSSAASWFTKATLQRFVRFVST  87



>gb|AAP44760.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1269

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 11/98 (11%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+  TRL+S VFQLTPTRTRCDL++IAN +KEKIA+GLL+PF+AHLK AQ QIAK GYSI
Sbjct  1    MRPETRLDSAVFQLTPTRTRCDLVVIANGRKEKIASGLLNPFVAHLKVAQQQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVE-----------RFIRFVST  598
             LE     DA WFT+GTVE           RF+RFVST
Sbjct  61   TLEVDPEIDAPWFTRGTVERWWSFAWLVSGRFVRFVST  98



>gb|EYU32568.1| hypothetical protein MIMGU_mgv1a000420mg [Erythranthe guttata]
Length=1167

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 8/87 (9%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK STRL+S VFQLTPTRTRCDLIIIAN KKEKIA+GLL PFLAHLKTAQDQIA+ GYSI
Sbjct  1    MKQSTRLSSAVFQLTPTRTRCDLIIIANGKKEKIASGLLSPFLAHLKTAQDQIAEGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP++ +DA W        F+RFVST
Sbjct  61   LLEPETGSDAPW--------FVRFVST  79



>ref|XP_002983080.1| hypothetical protein SELMODRAFT_179883, partial [Selaginella 
moellendorffii]
 gb|EFJ15889.1| hypothetical protein SELMODRAFT_179883, partial [Selaginella 
moellendorffii]
Length=257

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+   L+  VFQLTPTRTRC+L+I ++   EK+A+GLL PFLAHL+ A++QIA  GYSI
Sbjct  1    MKADIVLDFAVFQLTPTRTRCELLISSHGVSEKLASGLLKPFLAHLRAAEEQIAVGGYSI  60

Query  518  VLEP---KSHNDASWFTKGTVERFIRFVST  598
             LEP    +   ASWFTKGT++RF+RFVST
Sbjct  61   RLEPPIDGNQGKASWFTKGTMQRFVRFVST  90



>ref|XP_003596469.1| COP1-interacting protein [Medicago truncatula]
Length=1205

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SS RL+S VFQLTPTRTR DL+I  N K+EKIA+GLL PFL HLK AQDQ+ K GYSI
Sbjct  1    MNSSPRLDSAVFQLTPTRTRFDLVITVNGKQEKIASGLLSPFLCHLKAAQDQMDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+   D +WFT+ T+ERF+RFVST
Sbjct  61   VLVPEHGCDVTWFTRRTIERFVRFVST  87



>gb|KEH41075.1| COP1-interacting-like protein [Medicago truncatula]
Length=1197

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SS RL+S VFQLTPTRTR DL+I  N K+EKIA+GLL PFL HLK AQDQ+ K GYSI
Sbjct  1    MNSSPRLDSAVFQLTPTRTRFDLVITVNGKQEKIASGLLSPFLCHLKAAQDQMDKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            VL P+   D +WFT+ T+ERF+RFVST
Sbjct  61   VLVPEHGCDVTWFTRRTIERFVRFVST  87



>gb|EYU26404.1| hypothetical protein MIMGU_mgv1a000705mg [Erythranthe guttata]
Length=1011

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T+L+  +FQLTPTRTRCDL+I A +K EKIA+GLL+PF++HLK+A+DQI K GYSI
Sbjct  1    MDSRTQLDYALFQLTPTRTRCDLVIFAGKKSEKIASGLLEPFVSHLKSAKDQIFKGGYSI  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
             L+P S N D+SWFTK T+E F+RFVST
Sbjct  61   TLKPASPNDDSSWFTKATLESFVRFVST  88



>gb|KHG27241.1| mRNA transport [Gossypium arboreum]
 gb|KHG29205.1| mRNA transport [Gossypium arboreum]
Length=245

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+ V+FQLTPT+TRC+L+I A ++ EK+ +GLLDPF++HLKTA+DQI+K GYSI
Sbjct  19   MDLRTRLDYVLFQLTPTKTRCELVIFAGKESEKLESGLLDPFISHLKTAKDQISKGGYSI  78

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P      SWFTK T++RF+RFVST
Sbjct  79   TLRPVGLT-PSWFTKATLQRFVRFVST  104



>ref|XP_010675617.1| PREDICTED: uncharacterized protein LOC104891607 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1057

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/88 (64%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+SSTRL+ V+FQLTPTRTRC+L I A +  EK+A GLL+PF+AHL++A+DQI+K GYS+
Sbjct  1    MESSTRLDYVLFQLTPTRTRCELAIFAGKSNEKLAYGLLEPFIAHLRSAKDQISKGGYSV  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
             L P S + +A WFTKGT+ RF+RFVST
Sbjct  61   TLRPPSSSVNAHWFTKGTLLRFVRFVST  88



>ref|XP_010675616.1| PREDICTED: uncharacterized protein LOC104891607 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1184

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/88 (64%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+SSTRL+ V+FQLTPTRTRC+L I A +  EK+A GLL+PF+AHL++A+DQI+K GYS+
Sbjct  1    MESSTRLDYVLFQLTPTRTRCELAIFAGKSNEKLAYGLLEPFIAHLRSAKDQISKGGYSV  60

Query  518  VLEPKSHN-DASWFTKGTVERFIRFVST  598
             L P S + +A WFTKGT+ RF+RFVST
Sbjct  61   TLRPPSSSVNAHWFTKGTLLRFVRFVST  88



>emb|CBI38326.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I +    EK+A+GLL+PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRTHLDYALFQLTPTRTRCDLVIFSGAITEKLASGLLEPFISHLKFAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P +  DASWFTK T ERF+RFVST
Sbjct  61   KLLPPA-TDASWFTKATFERFVRFVST  86



>ref|XP_010099013.1| hypothetical protein L484_025673 [Morus notabilis]
 gb|EXB76315.1| hypothetical protein L484_025673 [Morus notabilis]
Length=1159

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLii-ianekkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M   TRL+  +FQLTPTRTRCDL+I   N   EK+A+GLL+PFLAHLK+A+DQI+K GYS
Sbjct  1    MDPRTRLDHALFQLTPTRTRCDLVIFAVNGGNEKLASGLLEPFLAHLKSAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P + + + WFTK T++RF+RFVST
Sbjct  61   ITLRPSASDSSHWFTKSTLQRFVRFVST  88



>ref|XP_004141235.1| PREDICTED: uncharacterized protein LOC101209039 [Cucumis sativus]
 ref|XP_004160598.1| PREDICTED: uncharacterized protein LOC101224470 [Cucumis sativus]
 gb|KGN55150.1| hypothetical protein Csa_4G638390 [Cucumis sativus]
Length=982

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane-kkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M   TRL+  +FQLTPTRTRC+L+I AN    EK+A+GLL PFL+HLK A+DQI+K GYS
Sbjct  1    MDPRTRLDHALFQLTPTRTRCELVISANGGATEKLASGLLQPFLSHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P S ++ASWFTKGT++RF+RFVST
Sbjct  61   ITLRPVSGSNASWFTKGTLQRFVRFVST  88



>ref|XP_006348387.1| PREDICTED: microtubule-associated protein futsch-like [Solanum 
tuberosum]
Length=1110

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A E  EK+A+GLL+PFL HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIFAGENSEKLASGLLEPFLIHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S  + SWFTK T++RF++FVST
Sbjct  61   TLRP-SITNVSWFTKATLQRFVKFVST  86



>ref|XP_008452483.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Cucumis melo]
Length=1203

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane-kkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M   TRL+  +FQLTPTRTRC+L+I AN   KEK+A+GLL PFL+HLK A+DQI+K GYS
Sbjct  1    MDPRTRLDHALFQLTPTRTRCELVISANGGVKEKLASGLLQPFLSHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P S ++ASWFTKGT++RF+RFVST
Sbjct  61   ITLRPVSGSNASWFTKGTLQRFVRFVST  88



>ref|XP_008452486.1| PREDICTED: dentin sialophosphoprotein isoform X3 [Cucumis melo]
Length=982

 Score =   103 bits (258),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane-kkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M   TRL+  +FQLTPTRTRC+L+I AN   KEK+A+GLL PFL+HLK A+DQI+K GYS
Sbjct  1    MDPRTRLDHALFQLTPTRTRCELVISANGGVKEKLASGLLQPFLSHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P S ++ASWFTKGT++RF+RFVST
Sbjct  61   ITLRPVSGSNASWFTKGTLQRFVRFVST  88



>ref|XP_008452485.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Cucumis melo]
Length=1041

 Score =   103 bits (258),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane-kkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M   TRL+  +FQLTPTRTRC+L+I AN   KEK+A+GLL PFL+HLK A+DQI+K GYS
Sbjct  1    MDPRTRLDHALFQLTPTRTRCELVISANGGVKEKLASGLLQPFLSHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P S ++ASWFTKGT++RF+RFVST
Sbjct  61   ITLRPVSGSNASWFTKGTLQRFVRFVST  88



>ref|XP_010060529.1| PREDICTED: uncharacterized protein LOC104448416 [Eucalyptus grandis]
 gb|KCW67306.1| hypothetical protein EUGRSUZ_F01094 [Eucalyptus grandis]
Length=1273

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+ V+FQLTPTRTRCDL+I A +  EK+A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  3    MDSRTHLDYVLFQLTPTRTRCDLVIYAGKANEKLASGLLEPFLSHLKSAKDQISKGGYSI  62

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L     +DASWFTK T+ERF+ FV T
Sbjct  63   TL----RSDASWFTKATLERFVSFVRT  85



>emb|CAN80688.1| hypothetical protein VITISV_021551 [Vitis vinifera]
Length=1351

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  395  RCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSIVLEPKSHNDASWFTKGTVE  574
            RCDLII AN K EKIA+GLL+PFLAHLKTAQDQIAK GYSI+LEPK  +DA+WF KGTVE
Sbjct  27   RCDLIITANGKTEKIASGLLNPFLAHLKTAQDQIAKGGYSIILEPKPGSDATWFAKGTVE  86

Query  575  RFIRFVST  598
            RF+RFVST
Sbjct  87   RFVRFVST  94



>ref|XP_010245324.1| PREDICTED: uncharacterized protein LOC104588898 [Nelumbo nucifera]
Length=1021

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S  RL+  +FQLTPTRTRCD ++    K EK+A+GLL+PF++HLK A+++I+K GYSI
Sbjct  1    MDSRIRLDYALFQLTPTRTRCDFVVFYGGKNEKLASGLLEPFISHLKFAKEKISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + +DASWFTKGT+ERF+RFVST
Sbjct  61   ALRPPT-SDASWFTKGTLERFVRFVST  86



>ref|XP_009378487.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103966972 
[Pyrus x bretschneideri]
Length=1184

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane--kkekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M S TRL+ V+FQLTPTRTRC+L+I A      EK+A+GLL+PFL HLK A+DQI+K GY
Sbjct  1    MDSRTRLDHVLFQLTPTRTRCELVIFAAGGGANEKLASGLLEPFLGHLKCAKDQISKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI+L P S + ASWFTK T++RF+RFVST
Sbjct  61   SIILRP-SASGASWFTKATLQRFVRFVST  88



>ref|XP_003541853.1| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=1189

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   +RL+  +FQLTPTRTRCDL+++     E++A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDPYSRLDHALFQLTPTRTRCDLVVVGGGVSERLASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   + A WFTK T++RF+RF+ST
Sbjct  61   TLRPPGEH-AHWFTKATLQRFVRFIST  86



>gb|KHN36797.1| hypothetical protein glysoja_001528 [Glycine soja]
Length=1189

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   +RL+  +FQLTPTRTRCDL+++     E++A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDPYSRLDHALFQLTPTRTRCDLVVVGGGVSERLASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   + A WFTK T++RF+RF+ST
Sbjct  61   TLRPPGEH-AHWFTKATLQRFVRFIST  86



>ref|XP_009782944.1| PREDICTED: uncharacterized protein LOC104231622 [Nicotiana sylvestris]
Length=1184

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A    EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLASGLLEPFITHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   N ASWFTK T++RF+ FVST
Sbjct  61   TLRPSPTN-ASWFTKATLQRFVGFVST  86



>ref|XP_007149609.1| hypothetical protein PHAVU_005G084000g [Phaseolus vulgaris]
 gb|ESW21603.1| hypothetical protein PHAVU_005G084000g [Phaseolus vulgaris]
Length=1175

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  +TRL+  +FQLTPTRTRCDL++      E++A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDPNTRLDHALFQLTPTRTRCDLVVAGGGVTERLASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P     A WFTK T++RF+RF+S+
Sbjct  61   TLRPPGGY-APWFTKATLQRFVRFISS  86



>ref|XP_006592902.1| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=810

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  +TRL+  +FQLTPTRTRCDL+++     E++A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDPNTRLDHALFQLTPTRTRCDLVVVGGGVSERLASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   +   WFTK T++RF+RF+ST
Sbjct  61   TLRPPGGH-PHWFTKATLQRFVRFIST  86



>ref|XP_011042495.1| PREDICTED: uncharacterized protein LOC105138171 [Populus euphratica]
Length=1168

 Score =   100 bits (250),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I A    E++A+GLL+PFL HLKTA+DQI+K GYSI
Sbjct  1    MDSRTFLDHALFQLTPTRTRCDLVIYAGGLNERLASGLLEPFLQHLKTAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S N A WFTK T++RF+RFVS+
Sbjct  61   SLRPLSPN-AFWFTKATLQRFVRFVSS  86



>ref|XP_007021335.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao]
 ref|XP_007021337.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao]
 gb|EOY12860.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao]
 gb|EOY12862.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao]
Length=1192

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKETEKLASGLLEPFILHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   +  SWFTKGT++RF+RFVST
Sbjct  61   TLRPVG-STPSWFTKGTLQRFVRFVST  86



>ref|XP_007021336.1| COP1-interacting protein 7, putative isoform 2 [Theobroma cacao]
 gb|EOY12861.1| COP1-interacting protein 7, putative isoform 2 [Theobroma cacao]
Length=1147

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKETEKLASGLLEPFILHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   +  SWFTKGT++RF+RFVST
Sbjct  61   TLRPVG-STPSWFTKGTLQRFVRFVST  86



>ref|XP_008366718.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Malus 
domestica]
Length=1177

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane--kkekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M S TRL+ V+FQLTPTRTRC+L+I A      EK+A+GLL+PFL HLK A+DQI+K GY
Sbjct  1    MDSRTRLDHVLFQLTPTRTRCELVIFAAGGGANEKLASGLLEPFLGHLKCAKDQISKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI+L P S + ASWFTK T++RF++FVST
Sbjct  61   SIILRP-SDSGASWFTKATLQRFVKFVST  88



>ref|XP_008366710.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=1178

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiiane--kkekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M S TRL+ V+FQLTPTRTRC+L+I A      EK+A+GLL+PFL HLK A+DQI+K GY
Sbjct  1    MDSRTRLDHVLFQLTPTRTRCELVIFAAGGGANEKLASGLLEPFLGHLKCAKDQISKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI+L P S + ASWFTK T++RF++FVST
Sbjct  61   SIILRP-SDSGASWFTKATLQRFVKFVST  88



>gb|EYU27942.1| hypothetical protein MIMGU_mgv1a001202mg [Erythranthe guttata]
Length=867

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+  +FQLTPTRTRCDL++ + +K EK+A+GL++PF+AHLK A+DQI K GYSI
Sbjct  1    MDSKALLDYALFQLTPTRTRCDLVVFSGKKNEKLASGLVEPFIAHLKYAKDQIPKGGYSI  60

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             L  P + +DASWFTK T +RF+RFVST
Sbjct  61   TLRPPATGDDASWFTKATFQRFVRFVST  88



>ref|XP_006378327.1| hypothetical protein POPTR_0010s08090g [Populus trichocarpa]
 gb|ERP56124.1| hypothetical protein POPTR_0010s08090g [Populus trichocarpa]
Length=1281

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 67/87 (77%), Gaps = 10/87 (11%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSSTRL+S +FQLTPTRTRCDLII  N K EKIA+GL  PFL HLKTAQDQ+AK GYSI
Sbjct  1    MKSSTRLDSAIFQLTPTRTRCDLIICVNGKIEKIASGLAQPFLDHLKTAQDQLAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
            +LEP +  DA+W        F+RFVST
Sbjct  61   ILEPGT--DAAW--------FVRFVST  77



>ref|XP_004291665.1| PREDICTED: uncharacterized protein LOC101305821 [Fragaria vesca 
subsp. vesca]
Length=1202

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianek-kekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S TRL+ V+FQLTPTRTRC+LI+ A     EK+A+G L+PFL HLK A+DQI+K GYS
Sbjct  1    MDSRTRLDHVLFQLTPTRTRCELIMFAAAGGSEKLASGFLEPFLTHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I L P S + ASWFTK T++RF+RFVST
Sbjct  61   ITLRP-SGSGASWFTKATLQRFVRFVST  87



>ref|XP_009592524.1| PREDICTED: uncharacterized protein LOC104089362 isoform X1 [Nicotiana 
tomentosiformis]
Length=1181

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A    EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLASGLLEPFITHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   N A WFTK T++RF+ FVST
Sbjct  61   TLRPSPTN-AYWFTKATLQRFVGFVST  86



>ref|XP_009592525.1| PREDICTED: uncharacterized protein LOC104089362 isoform X2 [Nicotiana 
tomentosiformis]
Length=1172

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S TRL+  +FQLTPTRTRCDL+I A    EK+A+GLL+PF+ HLK+A+DQI+K GYSI
Sbjct  1    MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLASGLLEPFITHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   N A WFTK T++RF+ FVST
Sbjct  61   TLRPSPTN-AYWFTKATLQRFVGFVST  86



>tpg|DAA39718.1| TPA: hypothetical protein ZEAMMB73_933797, partial [Zea mays]
Length=726

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+SVVFQLTPTRTR DL++IAN +KEK A+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPGARLDSVVFQLTPTRTRFDLVLIANGRKEKFASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVER  577
             LEP S  D S FT+G VER
Sbjct  61   TLEPISEFDVSLFTRGAVER  80



>gb|KDP27022.1| hypothetical protein JCGZ_20957 [Jatropha curcas]
Length=1118

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   T L+  +FQLTPTRTRCDL+I A    EK+A+GLLDPF+ HL TA+DQI+K GYSI
Sbjct  1    MDPRTLLDHALFQLTPTRTRCDLVIFAGGASEKLASGLLDPFILHLTTAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   N A WFTK T++RF+RFVST
Sbjct  61   SLRPPPPN-AYWFTKATLQRFVRFVST  86



>tpg|DAA39719.1| TPA: hypothetical protein ZEAMMB73_933797 [Zea mays]
Length=823

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+   RL+SVVFQLTPTRTR DL++IAN +KEK A+GLL PFLAHLK AQDQIAK GYSI
Sbjct  1    MRPGARLDSVVFQLTPTRTRFDLVLIANGRKEKFASGLLKPFLAHLKAAQDQIAKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVER  577
             LEP S  D S FT+G VER
Sbjct  61   TLEPISEFDVSLFTRGAVER  80



>ref|XP_010061862.1| PREDICTED: uncharacterized protein LOC104449412 [Eucalyptus grandis]
 gb|KCW68892.1| hypothetical protein EUGRSUZ_F02477 [Eucalyptus grandis]
Length=1416

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS   L+  VFQL+P R+RC+LI+ +N   EK+A+GL+ PF+AHLK A++Q A+A  SI
Sbjct  1    MKSEMPLDHAVFQLSPKRSRCELIVSSNGNSEKLASGLVKPFVAHLKVAEEQFARAAQSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             LE + HND  +WFTKGT+ERF+RFVST
Sbjct  61   KLETRKHNDGETWFTKGTLERFVRFVST  88



>gb|KDO75855.1| hypothetical protein CISIN_1g038419mg [Citrus sinensis]
Length=940

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S++RL+  +FQLTPTRTR DL++      EK+A+GL +PF++HLK A+D+I+K GYSI
Sbjct  1    MDSASRLDYALFQLTPTRTRFDLVLFYGRNSEKLASGLFEPFISHLKFARDEISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P SH  A WFTK T ERF+RFVST
Sbjct  61   TLRPPSHA-APWFTKATFERFVRFVST  86



>gb|KJB13423.1| hypothetical protein B456_002G073400 [Gossypium raimondii]
Length=836

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF++HLK A+DQI+K GYS+
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKENEKLASGLLEPFISHLKAAKDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + +   WFTKGT+ RF+RFVST
Sbjct  61   TLRPLA-SSPPWFTKGTLLRFVRFVST  86



>ref|XP_004487682.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=1107

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  S+ L+  +FQLTPTRTRCDL+I+     E++A+GLL+PFL HLK A+DQI+K GYSI
Sbjct  1    MDPSSYLDHALFQLTPTRTRCDLVIVGGGVSERLASGLLEPFLCHLKFAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P S   A WFTK T++RF+RFVST
Sbjct  61   TLQPVS-TYAPWFTKATLQRFVRFVST  86



>gb|KHN28039.1| hypothetical protein glysoja_007771 [Glycine soja]
Length=1187

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  +TRL+  +FQLTPTRTRCDL+++     E++A+GLL+PFL+HLK+A+DQI+K GYSI
Sbjct  1    MDPNTRLDHALFQLTPTRTRCDLVVVGGGVSERLASGLLEPFLSHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   +   WFTK T++RF+RF+ST
Sbjct  61   TLRPPGGH-PHWFTKATLQRFVRFIST  86



>ref|XP_004244206.1| PREDICTED: uncharacterized protein LOC101248895 [Solanum lycopersicum]
 ref|XP_010324356.1| PREDICTED: uncharacterized protein LOC101248895 [Solanum lycopersicum]
Length=1105

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S  RL+  +FQLTPTRTRCDL+I A EK EK+A+GLL+PFL HLK+A+DQI+K GYSI
Sbjct  1    MDSRIRLDYALFQLTPTRTRCDLVIFAGEKSEKLASGLLEPFLIHLKSAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P   N   WFTK T++RF++FVST
Sbjct  61   TLRPLIAN-VCWFTKATLQRFVKFVST  86



>ref|XP_002317227.2| hypothetical protein POPTR_0011s04670g [Populus trichocarpa]
 gb|EEE97839.2| hypothetical protein POPTR_0011s04670g [Populus trichocarpa]
Length=927

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SST L+  +FQLTPTRTRCDL++    K EK+A+GL +PF++HL+  +DQI+K GYSI
Sbjct  4    MNSSTLLDYALFQLTPTRTRCDLVLFYGGKNEKLASGLFEPFISHLEYIKDQISKGGYSI  63

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + N A WFTKGT ERF+RFVST
Sbjct  64   KLCPPTKN-APWFTKGTFERFVRFVST  89



>ref|XP_002317515.2| COP1-interacting protein 7 [Populus trichocarpa]
 gb|EEE98127.2| COP1-interacting protein 7 [Populus trichocarpa]
Length=1095

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I A    EK+A+GLL+PFL HLKTA+DQI+K GYSI
Sbjct  1    MDSRTLLDHALFQLTPTRTRCDLVIYAGGVNEKLASGLLEPFLQHLKTAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S N A WFTK T++RF+ FVS+
Sbjct  61   SLRPLSPN-AFWFTKATLQRFVWFVSS  86



>ref|XP_011047845.1| PREDICTED: uncharacterized protein LOC105142085 [Populus euphratica]
Length=929

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SST L+  +FQLTPTRTRCDL++    K EK+A+GL +PF++HL+  +DQI+K GYSI
Sbjct  4    MNSSTLLDYALFQLTPTRTRCDLVLFNGGKNEKLASGLFEPFISHLEFIKDQISKGGYSI  63

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + N A WFTKGT ERF+RFVST
Sbjct  64   KLCPPTKN-APWFTKGTFERFVRFVST  89



>ref|XP_002305012.2| hypothetical protein POPTR_0004s03850g [Populus trichocarpa]
 gb|EEE85523.2| hypothetical protein POPTR_0004s03850g [Populus trichocarpa]
Length=931

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SST L+  +FQLTPTRTRCDL++    K EK+A+GL +PF+ HLK  +DQI+K GYSI
Sbjct  1    MDSSTLLDYALFQLTPTRTRCDLVLFCGGKNEKLASGLFEPFILHLKFIKDQISKVGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + N A WFTKGT ERF+RFVST
Sbjct  61   KLCPPTKN-APWFTKGTFERFVRFVST  86



>ref|XP_006449289.1| hypothetical protein CICLE_v10014177mg [Citrus clementina]
 gb|ESR62529.1| hypothetical protein CICLE_v10014177mg [Citrus clementina]
Length=940

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S +RL+  +FQLTPTRTR DL++      EK+A+GL +PF++HLK A+D+I+K GYSI
Sbjct  1    MDSVSRLDYALFQLTPTRTRFDLVLFYGRNSEKLASGLFEPFISHLKFARDEISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P SH  A WFTK T ERF+RFVST
Sbjct  61   TLRPPSHA-APWFTKATFERFVRFVST  86



>ref|XP_011027902.1| PREDICTED: uncharacterized protein LOC105128082 [Populus euphratica]
Length=932

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SST L+  +FQLTPTRTRCDL++    K EK+A+GL +PF+ HLK  +DQI+K GYSI
Sbjct  1    MDSSTLLDYALFQLTPTRTRCDLVLFCGGKNEKLASGLFEPFILHLKFIKDQISKVGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + N A WFTKGT ERF+RFVST
Sbjct  61   KLCPPNKN-APWFTKGTFERFVRFVST  86



>ref|XP_006370300.1| COP1-interacting protein 7 [Populus trichocarpa]
 gb|ERP66869.1| COP1-interacting protein 7 [Populus trichocarpa]
Length=1118

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I A    E++A+GLL+PFL HLKTA+DQI+K GYSI
Sbjct  1    MDSRTFLDHALFQLTPTRTRCDLVIYAGGVNERLASGLLEPFLQHLKTAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S N A WFTK T++ F+RFVS+
Sbjct  61   SLRPLSPN-AFWFTKATLQIFVRFVSS  86



>ref|XP_011029438.1| PREDICTED: uncharacterized protein LOC105129180 [Populus euphratica]
Length=1172

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL+I A    EK+A+GLL+PFL HLKTA+DQI+K GYSI
Sbjct  1    MDSRTLLDHALFQLTPTRTRCDLVIYAGGVNEKLASGLLEPFLQHLKTAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S N A WFTK T++RF+ FVS+
Sbjct  61   SLRPLSPN-AFWFTKATLQRFVCFVSS  86



>ref|XP_002967692.1| hypothetical protein SELMODRAFT_88956 [Selaginella moellendorffii]
 gb|EFJ31039.1| hypothetical protein SELMODRAFT_88956 [Selaginella moellendorffii]
Length=180

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M++   L+   F LTPTRTRC+L++ + ++ EK+A+GLL PF +H+K   ++I K G SI
Sbjct  1    MEADAPLDCAHFLLTPTRTRCELVVSSGDQTEKLASGLLQPFSSHIKAVNEEIDKGGCSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP   + ASWFTKGT+ERF+RFVST
Sbjct  61   KLEPSGDDAASWFTKGTMERFVRFVST  87



>ref|XP_002964342.1| hypothetical protein SELMODRAFT_82306 [Selaginella moellendorffii]
 gb|EFJ34675.1| hypothetical protein SELMODRAFT_82306 [Selaginella moellendorffii]
Length=180

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M++   L+   F LTPTRTRC+L++ + ++ EK+A+GLL PF +H+K   ++I K G SI
Sbjct  1    MEADAPLDCAHFLLTPTRTRCELVVSSGDQTEKLASGLLQPFSSHIKAVNEEIDKGGCSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             LEP   + ASWFTKGT+ERF+RFVST
Sbjct  61   KLEPSGDDAASWFTKGTMERFVRFVST  87



>ref|XP_006841675.1| hypothetical protein AMTR_s00003p00244690 [Amborella trichopoda]
 gb|ERN03350.1| hypothetical protein AMTR_s00003p00244690 [Amborella trichopoda]
Length=959

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  ST L+ VVFQLTPTRTRCDL++ +  K EK+A+GL  PF+ HL+ A++QI+K GYSI
Sbjct  1    MDPSTLLDYVVFQLTPTRTRCDLVVFSGGKGEKLASGLFQPFVTHLEAAREQISKGGYSI  60

Query  518  VLEPKSHND--ASWFTKGTVERFIRFVST  598
             L+  S ++  A+WFTKGT+ERF+RFVST
Sbjct  61   RLQVPSGSERVATWFTKGTLERFVRFVST  89



>gb|KEH38782.1| COP1-interacting protein, putative [Medicago truncatula]
Length=1095

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  S+ L+  +FQLTPTRTRCDL+I+A+   E++A+GLL+PF++HLK A+DQI+K GYSI
Sbjct  1    MDPSSYLDHALFQLTPTRTRCDLMIVASGVSERLASGLLEPFVSHLKCAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P+S   A WFTK T++RF+RFVST
Sbjct  61   TLCPES-TYAPWFTKATLQRFVRFVST  86



>gb|KJB13424.1| hypothetical protein B456_002G073400 [Gossypium raimondii]
Length=948

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF++HLK A+DQI+K GYS+
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKENEKLASGLLEPFISHLKAAKDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + +   WFTKGT+ RF+RFVST
Sbjct  61   TLRPLA-SSPPWFTKGTLLRFVRFVST  86



>gb|KHG16266.1| ABC transporter D family member 2, chloroplastic [Gossypium arboreum]
Length=1156

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF++HLK A+DQI+K GYS+
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKENEKLASGLLEPFISHLKAAKDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + +   WFTKGT+ RF+RFVST
Sbjct  61   TLRPVA-SSPPWFTKGTLLRFVRFVST  86



>gb|KJB13422.1| hypothetical protein B456_002G073400 [Gossypium raimondii]
Length=1156

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I A ++ EK+A+GLL+PF++HLK A+DQI+K GYS+
Sbjct  1    MDFRTRLDYALFQLTPTRTRCDLVIFAGKENEKLASGLLEPFISHLKAAKDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + +   WFTKGT+ RF+RFVST
Sbjct  61   TLRPLA-SSPPWFTKGTLLRFVRFVST  86



>ref|XP_007213724.1| hypothetical protein PRUPE_ppa000375mg [Prunus persica]
 gb|EMJ14923.1| hypothetical protein PRUPE_ppa000375mg [Prunus persica]
Length=1231

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianek-kekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S TRL+  +FQLTPTRTRC+L+I A     EK+A+GLL+PFL HLK A+DQI+K GYS
Sbjct  1    MDSRTRLDHALFQLTPTRTRCELVIFAAAGGSEKLASGLLEPFLVHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I+L P   + ASWFTK T++RF++FV+T
Sbjct  61   IILRPPG-SGASWFTKATLQRFVKFVTT  87



>ref|XP_008224997.1| PREDICTED: uncharacterized protein LOC103324676 [Prunus mume]
Length=838

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S  RLN  +FQLTPTRTRCDL+I    K EK+A+GL  PF++HLK+ +D+I++ GYSI
Sbjct  1    MDSGARLNYALFQLTPTRTRCDLVIFYGGKSEKLASGLFQPFVSHLKSVKDEISRGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + A WFTK T +RF+RFVST
Sbjct  61   TLRPPTPH-APWFTKSTFQRFVRFVST  86



>ref|XP_008226668.1| PREDICTED: dentin sialophosphoprotein [Prunus mume]
Length=1231

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianek-kekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S TRL+  +FQLTPTRTRC+L+I A     EK+A+GLL+PFL HLK A+DQI+K GYS
Sbjct  1    MDSRTRLDHALFQLTPTRTRCELVIFAAGGGSEKLASGLLEPFLVHLKCAKDQISKGGYS  60

Query  515  IVLEPKSHNDASWFTKGTVERFIRFVST  598
            I+L P   + ASWFTK T++RF++FV+T
Sbjct  61   IILRPPG-SGASWFTKATLQRFVKFVTT  87



>ref|XP_002529180.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33194.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK +T L+  VFQL+P  +RC+L + ++   EK+A+GL+ PF+AHLK A++Q+A+A +SI
Sbjct  1    MKPNTPLDYAVFQLSPRHSRCELFVSSSGSTEKLASGLVKPFVAHLKVAEEQVAQAVHSI  60

Query  518  VLEPKSHNDA---SWFTKGTVERFIRFVST  598
             LE + H +A   +WFTKGT+ERF+RFVST
Sbjct  61   KLEVERHRNANPETWFTKGTLERFVRFVST  90



>ref|XP_011096264.1| PREDICTED: uncharacterized protein LOC105175509 [Sesamum indicum]
Length=914

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M  +  L+  +FQLTPTRTRCDLI+ + +K EK+A+GL++PF++HL+ A+DQI K GYSI
Sbjct  1    MDPNALLDYALFQLTPTRTRCDLIVFSGKKSEKLASGLVEPFVSHLRYAKDQIPKGGYSI  60

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             L  P + +DASWFTK T +RF+RFVST
Sbjct  61   TLRPPPTADDASWFTKVTFQRFVRFVST  88



>emb|CBI20343.3| unnamed protein product [Vitis vinifera]
Length=537

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLii-ianekkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S   L+  +FQLTPTRTRCDL+I  A    EK+A+GL++PFL+HLK A++QIAK GYS
Sbjct  1    MDSRAPLDYALFQLTPTRTRCDLVIFAAGGASEKLASGLVEPFLSHLKCAKEQIAKGGYS  60

Query  515  IVLE-PKSHNDASWFTKGTVERFIRFVST  598
            I L  P +   ASWFTK T++RF+RFVST
Sbjct  61   ITLRSPPTAGAASWFTKATLQRFVRFVST  89



>ref|XP_010537005.1| PREDICTED: uncharacterized protein LOC104811855 [Tarenaya hassleriana]
Length=1110

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TR++  +FQLTPTRTRCDL+I +  + EK+A+GL  PF++HLK+A+DQI++ GYS+
Sbjct  1    MDPRTRIDYALFQLTPTRTRCDLVIFSGGESEKLASGLFQPFVSHLKSARDQISRGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + + WFTK T++RF+RFVST
Sbjct  61   TLRPSS-SASPWFTKATLQRFVRFVST  86



>ref|XP_009389585.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103976118 
[Musa acuminata subsp. malaccensis]
Length=1426

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  VFQL+P R+RC+L +  N K EK+A+G L PF+AHLK A+DQ A+AG SI
Sbjct  2    MNSDTPLDYAVFQLSPRRSRCELFVSGNGKTEKLASGFLKPFIAHLKVAEDQAAQAGNSI  61

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  ++ N +SWF KGT+ERF+RFVST
Sbjct  62   KLEVERAKNSSSWFKKGTLERFVRFVST  89



>dbj|BAA31739.1| COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana]
Length=235

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I +  + EK+A+G+  PF+ HLK+  DQI+K GYS+
Sbjct  1    MDPRTRLDYALFQLTPTRTRCDLVIFSGGENEKLASGIFQPFVTHLKSVSDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S     WFTK T++RF+RFV+T
Sbjct  61   TLRPSSVG-VPWFTKVTLQRFVRFVTT  86



>ref|XP_006465838.1| PREDICTED: uncharacterized protein LOC102629330 isoform X1 [Citrus 
sinensis]
Length=1419

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+ TRL+  VFQLTP R+RC+L + +    EK+A+GL+ PF+ HLK A++Q+A+A  SI
Sbjct  1    MKADTRLDYAVFQLTPKRSRCELFVSSEGHTEKLASGLVKPFVTHLKVAEEQVARAVQSI  60

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  K  N  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVGKRDNAETWFTKGTIERFVRFVST  88



>ref|XP_009388078.1| PREDICTED: uncharacterized protein LOC103974899 [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  VF+L+P R+RC+L +  N K EKIA+G L PF+ HLK A +Q A+   SI
Sbjct  2    MNSDTSLDCAVFKLSPRRSRCELFVSGNGKTEKIASGFLKPFITHLKVADEQAARVDKSI  61

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  KSH+  SWF KGT+ERF+RFVST
Sbjct  62   KLELEKSHDAGSWFNKGTLERFVRFVST  89



>ref|XP_006426753.1| hypothetical protein CICLE_v10024713mg [Citrus clementina]
 gb|ESR39993.1| hypothetical protein CICLE_v10024713mg [Citrus clementina]
Length=1409

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+ TRL+  VFQLTP R+RC+L + +    EK+A+GL+ PF+ HLK A++Q+A+A  SI
Sbjct  1    MKADTRLDYAVFQLTPKRSRCELFVSSEGHTEKLASGLVKPFVTHLKVAEEQVARAVQSI  60

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  K  N  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVGKRDNAETWFTKGTIERFVRFVST  88



>emb|CAN69737.1| hypothetical protein VITISV_008338 [Vitis vinifera]
Length=1129

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLii-ianekkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S   L+  +FQLTPTRTRCDL+I  A    EK+A+GL++PFL+HLK A++QIAK GYS
Sbjct  1    MDSRAPLDYALFQLTPTRTRCDLVIFAAGGASEKLASGLVEPFLSHLKCAKEQIAKGGYS  60

Query  515  IVLE-PKSHNDASWFTKGTVERFIRFVST  598
            I L  P +   ASWFTK T++RF+RFVST
Sbjct  61   ITLRSPPTAGAASWFTKATLQRFVRFVST  89



>ref|XP_010644218.1| PREDICTED: uncharacterized protein LOC100252162 [Vitis vinifera]
Length=1205

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLii-ianekkekiaTGLLDPFLAHLKTAQDQIAKAGYS  514
            M S   L+  +FQLTPTRTRCDL+I  A    EK+A+GL++PFL+HLK A++QIAK GYS
Sbjct  1    MDSRAPLDYALFQLTPTRTRCDLVIFAAGGASEKLASGLVEPFLSHLKCAKEQIAKGGYS  60

Query  515  IVLE-PKSHNDASWFTKGTVERFIRFVST  598
            I L  P +   ASWFTK T++RF+RFVST
Sbjct  61   ITLRSPPTAGAASWFTKATLQRFVRFVST  89



>ref|XP_006347084.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum]
Length=897

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL++ +  K EK+A+GL++PF++HLK A+DQI K GYSI
Sbjct  1    MDSKTLLDYALFQLTPTRTRCDLVVFSGGKNEKLASGLVEPFISHLKFAKDQIPKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             + P S + A WFTK T  RF+RFVST
Sbjct  61   TMRPPSTH-AYWFTKATFLRFVRFVST  86



>emb|CDY29309.1| BnaC01g19610D [Brassica napus]
Length=1018

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRC+L+I +  + EK+A+G+  PF+ HLK+ +DQI+K GYS+
Sbjct  1    MDPRTRLDYALFQLTPTRTRCELMIFSGGENEKLASGIFQPFVTHLKSVRDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S    +WFTK T++RF+RFV+T
Sbjct  61   TLRPSSGAGVNWFTKVTLQRFVRFVTT  87



>ref|XP_004232832.1| PREDICTED: uncharacterized protein LOC101263075 [Solanum lycopersicum]
Length=896

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  +FQLTPTRTRCDL++ +  K EK+A+GL++PF++HLK A+DQI K GYSI
Sbjct  1    MDSKTLLDYALFQLTPTRTRCDLVVFSGGKNEKLASGLVEPFISHLKFAKDQIPKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             + P S + A WFTK T  RF+RFVST
Sbjct  61   TMRPPSTH-AYWFTKATFLRFVRFVST  86



>ref|XP_009143431.1| PREDICTED: muscle M-line assembly protein unc-89 [Brassica rapa]
Length=1020

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+ V+FQLTPTRTRC+L+I +  + EK+A+G+  PF+ HLK+ +DQI+K GYS+
Sbjct  1    MDPRTRLDYVLFQLTPTRTRCELVIFSGGENEKLASGIFQPFVTHLKSVRDQISKGGYSV  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             L P S N   +WFTK T++RF+RFV+T
Sbjct  61   TLRPSSVNGGVNWFTKVTLQRFVRFVTT  88



>emb|CDX89251.1| BnaA01g16420D [Brassica napus]
Length=1020

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+ V+FQLTPTRTRC+L+I +  + EK+A+G+  PF+ HLK+ +DQI+K GYS+
Sbjct  1    MDPRTRLDYVLFQLTPTRTRCELVIFSGGENEKLASGIFQPFVTHLKSVRDQISKGGYSV  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             L P S N   +WFTK T++RF+RFV+T
Sbjct  61   TLRPSSVNGGVNWFTKVTLQRFVRFVTT  88



>ref|XP_008799214.1| PREDICTED: uncharacterized protein LOC103713937 isoform X2 [Phoenix 
dactylifera]
Length=1041

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekk--ekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M     L   +FQLTPTRTRCDL++ +      EKIA+GLL+PFL+HL+ A+D+I K GY
Sbjct  1    MDPDAPLARALFQLTPTRTRCDLVVFSVAGGGGEKIASGLLEPFLSHLRCARDEIPKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI L P S +  +WFTK T+ERF+RFVST
Sbjct  61   SITLRPHSASPPAWFTKATLERFVRFVST  89



>ref|XP_008799213.1| PREDICTED: uncharacterized protein LOC103713937 isoform X1 [Phoenix 
dactylifera]
Length=1053

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekk--ekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M     L   +FQLTPTRTRCDL++ +      EKIA+GLL+PFL+HL+ A+D+I K GY
Sbjct  1    MDPDAPLARALFQLTPTRTRCDLVVFSVAGGGGEKIASGLLEPFLSHLRCARDEIPKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI L P S +  +WFTK T+ERF+RFVST
Sbjct  61   SITLRPHSASPPAWFTKATLERFVRFVST  89



>ref|XP_010552256.1| PREDICTED: uncharacterized protein LOC104822667 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010552257.1| PREDICTED: uncharacterized protein LOC104822667 isoform X2 [Tarenaya 
hassleriana]
Length=1296

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKSST L+  +FQL+P R+RC+L + +    EK+A+GL+ PF+AHLK A++Q+A+A  SI
Sbjct  1    MKSSTPLDYAIFQLSPRRSRCELFVSSAGITEKLASGLVKPFVAHLKVAKEQVAEAVQSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             LE +S+  A +WFTKGT+ERF+RFVST
Sbjct  61   RLEVESNKHAETWFTKGTLERFVRFVST  88



>ref|XP_006465839.1| PREDICTED: uncharacterized protein LOC102629330 isoform X2 [Citrus 
sinensis]
Length=1374

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK+ TRL+  VFQLTP R+RC+L + +    EK+A+GL+ PF+ HLK A++Q+A+A  SI
Sbjct  1    MKADTRLDYAVFQLTPKRSRCELFVSSEGHTEKLASGLVKPFVTHLKVAEEQVARAVQSI  60

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  K  N  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVGKRDNAETWFTKGTIERFVRFVST  88



>gb|KJB57557.1| hypothetical protein B456_009G170400 [Gossypium raimondii]
Length=872

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S+T L+  +FQLTPTRTR DL++    K EK+A+GL +PF+ HLK A+DQI+K GYSI
Sbjct  1    MDSATLLDRALFQLTPTRTRFDLVLFYKGKNEKLASGLFEPFICHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P +     WFTK T ERF+RFVST
Sbjct  61   TLQPPAPA-TPWFTKATFERFVRFVST  86



>ref|XP_009613827.1| PREDICTED: uncharacterized protein LOC104106880 isoform X1 [Nicotiana 
tomentosiformis]
Length=189

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+SST L+  VFQL+P R+RC+L + ++   EK+A+GLL PF+ HLK A++Q A A  SI
Sbjct  1    MESSTLLDYAVFQLSPKRSRCELFVSSDGNTEKLASGLLKPFVTHLKVAEEQAALAVQSI  60

Query  518  VLEPKSH-NDASWFTKGTVERFIRFVST  598
             LE K   N  +WFTKGT+ RF+RFVST
Sbjct  61   KLEVKGRKNSETWFTKGTLGRFVRFVST  88



>ref|XP_002519011.1| hypothetical protein RCOM_0934860 [Ricinus communis]
 gb|EEF43222.1| hypothetical protein RCOM_0934860 [Ricinus communis]
Length=903

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M +ST L+  +FQLTPTRTRCDL++    K EK+A+GL +PF++HL+ A+DQI+K GYSI
Sbjct  1    MGTSTLLDYALFQLTPTRTRCDLVLFYGGKTEKLASGLFEPFVSHLEFAKDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P +   A WFTK T ERF+RFVST
Sbjct  61   KLCPPTTY-APWFTKATFERFVRFVST  86



>dbj|BAB02983.1| COP1-interacting protein 7 (CIP7)-like [Arabidopsis thaliana]
Length=188

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+ +  L+  VFQL+P R+RC+L +      EK+A+GL+ PF+AHLK A++Q+++   SI
Sbjct  1    MRPAIPLDYAVFQLSPKRSRCELFVSTTGNTEKLASGLVKPFVAHLKVAEEQVSREVQSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             LE +S+ +A +WFTKGT+ERF+RFVST
Sbjct  61   RLEVESNKNAGTWFTKGTLERFVRFVST  88



>gb|KJB57556.1| hypothetical protein B456_009G170400 [Gossypium raimondii]
Length=950

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S+T L+  +FQLTPTRTR DL++    K EK+A+GL +PF+ HLK A+DQI+K GYSI
Sbjct  1    MDSATLLDRALFQLTPTRTRFDLVLFYKGKNEKLASGLFEPFICHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P +     WFTK T ERF+RFVST
Sbjct  61   TLQPPAPA-TPWFTKATFERFVRFVST  86



>ref|XP_009613829.1| PREDICTED: uncharacterized protein LOC104106880 isoform X3 [Nicotiana 
tomentosiformis]
Length=167

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+SST L+  VFQL+P R+RC+L + ++   EK+A+GLL PF+ HLK A++Q A A  SI
Sbjct  1    MESSTLLDYAVFQLSPKRSRCELFVSSDGNTEKLASGLLKPFVTHLKVAEEQAALAVQSI  60

Query  518  VLEPKSH-NDASWFTKGTVERFIRFVST  598
             LE K   N  +WFTKGT+ RF+RFVST
Sbjct  61   KLEVKGRKNSETWFTKGTLGRFVRFVST  88



>gb|KJB57554.1| hypothetical protein B456_009G170400 [Gossypium raimondii]
Length=928

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S+T L+  +FQLTPTRTR DL++    K EK+A+GL +PF+ HLK A+DQI+K GYSI
Sbjct  1    MDSATLLDRALFQLTPTRTRFDLVLFYKGKNEKLASGLFEPFICHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P +     WFTK T ERF+RFVST
Sbjct  61   TLQPPAPA-TPWFTKATFERFVRFVST  86



>ref|XP_010921151.1| PREDICTED: uncharacterized protein LOC105044820 [Elaeis guineensis]
Length=1045

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekk--ekiaTGLLDPFLAHLKTAQDQIAKAGY  511
            M  +  L   +FQLTPTRTRCDL++ +      EKIA+GLL+PFL+HL+ A+D+I K GY
Sbjct  1    MDPNAPLAYALFQLTPTRTRCDLVVFSVAGGGGEKIASGLLEPFLSHLRCARDEIPKGGY  60

Query  512  SIVLEPKSHNDASWFTKGTVERFIRFVST  598
            SI L P S    +WFTK T+ERF+RFVST
Sbjct  61   SITLRPHSTPPPAWFTKATLERFVRFVST  89



>ref|XP_010261738.1| PREDICTED: uncharacterized protein LOC104600482 isoform X2 [Nelumbo 
nucifera]
Length=1518

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P R+RC+L +  + K EK+A+GLL PF  HLK A++Q+A+A  SI
Sbjct  1    MKSDTLLDYAVFQLSPKRSRCELFVSGDGKTEKLASGLLKPFATHLKVAEEQLAQAAPSI  60

Query  518  VLEPKSH-NDASWFTKGTVERFIRFVST  598
             LE + H +  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVEKHISSGTWFTKGTLERFVRFVST  88



>ref|XP_010261739.1| PREDICTED: uncharacterized protein LOC104600482 isoform X3 [Nelumbo 
nucifera]
Length=1491

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P R+RC+L +  + K EK+A+GLL PF  HLK A++Q+A+A  SI
Sbjct  1    MKSDTLLDYAVFQLSPKRSRCELFVSGDGKTEKLASGLLKPFATHLKVAEEQLAQAAPSI  60

Query  518  VLEPKSH-NDASWFTKGTVERFIRFVST  598
             LE + H +  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVEKHISSGTWFTKGTLERFVRFVST  88



>ref|XP_010261736.1| PREDICTED: uncharacterized protein LOC104600482 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261737.1| PREDICTED: uncharacterized protein LOC104600482 isoform X1 [Nelumbo 
nucifera]
Length=1519

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P R+RC+L +  + K EK+A+GLL PF  HLK A++Q+A+A  SI
Sbjct  1    MKSDTLLDYAVFQLSPKRSRCELFVSGDGKTEKLASGLLKPFATHLKVAEEQLAQAAPSI  60

Query  518  VLEPKSH-NDASWFTKGTVERFIRFVST  598
             LE + H +  +WFTKGT+ERF+RFVST
Sbjct  61   KLEVEKHISSGTWFTKGTLERFVRFVST  88



>gb|KDP40661.1| hypothetical protein JCGZ_24660 [Jatropha curcas]
Length=1419

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P  +RC+L +  +   EK+A+GL+ PF+ HLK A++Q+A+A +SI
Sbjct  1    MKSDTPLDYAVFQLSPKHSRCELFVSRSGNTEKLASGLVKPFVTHLKVAEEQVAQAVHSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             LE + H +A +WFTKGT+ERF+RFVST
Sbjct  61   KLEVERHKNADTWFTKGTLERFVRFVST  88



>ref|XP_010533898.1| PREDICTED: uncharacterized protein LOC104809566 [Tarenaya hassleriana]
Length=887

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M+S+  L+S +FQLTPTRTR DL++    KKEK+A+GL +PF++HLK A++QI++ GYSI
Sbjct  41   MESAALLDSALFQLTPTRTRFDLVLFCGSKKEKLASGLFEPFISHLKFAREQISRGGYSI  100

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + +SWFTK T +RF+RFV+T
Sbjct  101  SLRPPSSH-SSWFTKSTFDRFVRFVNT  126



>ref|XP_008371326.1| PREDICTED: dentin sialophosphoprotein-like [Malus domestica]
Length=751

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  353  RLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSIVLEPK  532
            RL+  +FQLTPTRTRCDL+I    K EK+A+GL  PF++HLK  +D+I++AGYSI L P 
Sbjct  4    RLDYALFQLTPTRTRCDLVIFYGGKSEKLASGLFQPFVSHLKYVKDEISRAGYSITLRPP  63

Query  533  SHNDASWFTKGTVERFIRFVST  598
            +   A WFTK T +RF+RFVST
Sbjct  64   TQM-APWFTKSTFQRFVRFVST  84



>ref|XP_009334256.1| PREDICTED: uncharacterized protein LOC103927051 [Pyrus x bretschneideri]
Length=844

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  353  RLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSIVLEPK  532
            RL+  +FQLTPTRTRCDL+I    K EK+A+GL  PF++HLK  +D+I++AGYSI L P 
Sbjct  4    RLDCALFQLTPTRTRCDLVIFCGGKSEKLASGLFQPFVSHLKYVKDEISRAGYSITLRPP  63

Query  533  SHNDASWFTKGTVERFIRFVST  598
            +   A WFTK T +RF+RFVST
Sbjct  64   TQM-APWFTKSTFQRFVRFVST  84



>ref|XP_006843854.1| hypothetical protein AMTR_s00007p00263470 [Amborella trichopoda]
 gb|ERN05529.1| hypothetical protein AMTR_s00007p00263470 [Amborella trichopoda]
Length=1529

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P R+RC+L +    K EK+A+GLL PF + LK A++Q+A+A  SI
Sbjct  1    MKSDTPLDYAVFQLSPRRSRCELFVSGEGKIEKLASGLLKPFTSQLKVAEEQVARAVQSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVST  598
             LE + + DA +WFTKGT+ERF+RFVST
Sbjct  61   KLEIQKNEDAGTWFTKGTIERFVRFVST  88



>gb|KHG07859.1| tRNA-specific 2-thiouridylase mnmA [Gossypium arboreum]
Length=926

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S+T L+  +FQLTPTRTR +L++    K EK+A+GL +PF+ HLK A+DQI+K GYSI
Sbjct  1    MDSATLLDRALFQLTPTRTRFNLVLFYKGKNEKLASGLFEPFICHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P + +   WFTK T ERF+RFVST
Sbjct  61   TLQPPAPS-TPWFTKATFERFVRFVST  86



>ref|XP_009104349.1| PREDICTED: uncharacterized protein LOC103830324 [Brassica rapa]
Length=766

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRAILDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + +SWFTK T +RF+RFV+T
Sbjct  61   SLHPPTSH-SSWFTKSTFDRFVRFVNT  86



>emb|CDY52491.1| BnaA01g36080D [Brassica napus]
Length=769

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRAILDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + +SWFTK T +RF+RFV+T
Sbjct  61   SLHPPTSH-SSWFTKSTFDRFVRFVNT  86



>ref|XP_006392061.1| hypothetical protein EUTSA_v10023296mg [Eutrema salsugineum]
 gb|ESQ29347.1| hypothetical protein EUTSA_v10023296mg [Eutrema salsugineum]
Length=768

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSKAMLDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + +SWFTK T +RF+RFV+T
Sbjct  61   SLHPPTSH-SSWFTKSTFDRFVRFVNT  86



>ref|XP_009408909.1| PREDICTED: uncharacterized protein LOC103991246 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1422

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+  +F+L+P R+RC+L +  N K EKIA+G L PF+ HLK A+ Q+A+AG SI
Sbjct  2    MNSDASLDCALFELSPRRSRCELFVSGNGKTEKIASGFLKPFVTHLKVAEAQVARAGKSI  61

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  +S ND SWF KGT+ERF+RFVST
Sbjct  62   KLEVDRSTNDGSWFNKGTLERFVRFVST  89



>ref|XP_009408901.1| PREDICTED: uncharacterized protein LOC103991246 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1423

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+  +F+L+P R+RC+L +  N K EKIA+G L PF+ HLK A+ Q+A+AG SI
Sbjct  2    MNSDASLDCALFELSPRRSRCELFVSGNGKTEKIASGFLKPFVTHLKVAEAQVARAGKSI  61

Query  518  VLE-PKSHNDASWFTKGTVERFIRFVST  598
             LE  +S ND SWF KGT+ERF+RFVST
Sbjct  62   KLEVDRSTNDGSWFNKGTLERFVRFVST  89



>ref|XP_006467843.1| PREDICTED: uncharacterized protein LOC102614489 isoform X1 [Citrus 
sinensis]
Length=944

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query  368  VFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSIVLEPKSHNDA  547
            +FQLTPTRTR DL++      EK+A+GL +PF++HLK A+D+I+K GYSI L P SH  A
Sbjct  15   LFQLTPTRTRFDLVLFYGRNSEKLASGLFEPFISHLKFARDEISKGGYSITLRPPSHA-A  73

Query  548  SWFTKGTVERFIRFVST  598
             WFTK T ERF+RFVST
Sbjct  74   PWFTKATFERFVRFVST  90



>ref|NP_176305.2| TIR class disease resistance protein [Arabidopsis thaliana]
 gb|AEE33780.1| TIR class disease resistance protein [Arabidopsis thaliana]
 dbj|BAM75185.1| CSL1 [Arabidopsis thaliana]
Length=808

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRAILDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFVSHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + +SWFTK T +RF+RFV+T
Sbjct  61   SLTPPSSH-SSWFTKSTFDRFVRFVNT  86



>ref|NP_001185276.1| TIR class disease resistance protein [Arabidopsis thaliana]
 gb|AEE33781.1| TIR class disease resistance protein [Arabidopsis thaliana]
Length=807

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRAILDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFVSHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S + +SWFTK T +RF+RFV+T
Sbjct  61   SLTPPSSH-SSWFTKSTFDRFVRFVNT  86



>dbj|BAJ34413.1| unnamed protein product [Thellungiella halophila]
Length=809

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSKAMLDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + +SWFTK T +RF+RFV+T
Sbjct  61   SLHPPTSH-SSWFTKSTFDRFVRFVNT  86



>ref|XP_002976104.1| hypothetical protein SELMODRAFT_104230 [Selaginella moellendorffii]
 gb|EFJ23009.1| hypothetical protein SELMODRAFT_104230 [Selaginella moellendorffii]
Length=182

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MK  T L+SVVFQL  +R+RC+L + A E  E++A+G L PFLAHL+TAQ+Q+A    SI
Sbjct  1    MKPDTPLDSVVFQLDESRSRCELWVAAGESTERLASGSLMPFLAHLRTAQEQLANDCSSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L    H  ASWFTK T+ERF+RFVST
Sbjct  61   ELHCP-HQGASWFTKRTIERFVRFVST  86



>gb|KDP20927.1| hypothetical protein JCGZ_21398 [Jatropha curcas]
Length=909

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M SS  L+  +FQLTPTRTR DL++    K EK+A+GL +PF++HLK A+DQI++ GYSI
Sbjct  1    MASSAILDYALFQLTPTRTRFDLVLFYGGKTEKLASGLFEPFISHLKFAKDQISRGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + A WFTK T ERF+RFVST
Sbjct  61   KLCPPT-SGAPWFTKATFERFVRFVST  86



>ref|XP_007025709.1| Uncharacterized protein TCM_029927 [Theobroma cacao]
 gb|EOY28331.1| Uncharacterized protein TCM_029927 [Theobroma cacao]
Length=1791

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S+  L+  +FQLTPTRTR DL++ +  K EK+A+GL DPF++HLK A+DQI+K GYSI
Sbjct  1    MDSTVLLDRALFQLTPTRTRFDLVLFSKGKNEKLASGLFDPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L+P +   A WFTK T ERF+ FVST
Sbjct  61   TLQPPAPG-APWFTKATFERFVCFVST  86



>ref|XP_001780764.1| predicted protein [Physcomitrella patens]
 gb|EDQ54403.1| predicted protein [Physcomitrella patens]
Length=197

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 13/97 (13%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKA----  505
            MKS   L+  VFQLTP+R RC+L+++  E+ E++A+GLL PFL H+K A+DQ A      
Sbjct  1    MKSDVALDHAVFQLTPSRNRCELVVVCGEETERLASGLLKPFLVHVKAAEDQYATGTKEI  60

Query  506  ------GYSIVLEPKSHNDASWFTKGTVERFIRFVST  598
                  GY  V +P++   ++WFTKGT+ERF+RFVST
Sbjct  61   KLKPPPGYGYVSKPET---SAWFTKGTIERFVRFVST  94



>ref|XP_009763783.1| PREDICTED: uncharacterized protein LOC104215637 [Nicotiana sylvestris]
Length=896

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  + +LTPTRTRCDL++ +  K EK+A+GL++PF++HL+ A+DQI K GYSI
Sbjct  1    MDSRTLLDYALLKLTPTRTRCDLVVFSGGKSEKLASGLVEPFISHLQFAKDQIPKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             + P S + A WFTK T +RF+RFVST
Sbjct  61   TMRPPSTH-AYWFTKSTFQRFVRFVST  86



>gb|KHN39597.1| hypothetical protein glysoja_020675 [Glycine soja]
Length=1108

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            MKS T L+  VFQL+P R+RC+L++ ++   EK+A+GL+ PFL HLK A++Q+A+A  SI
Sbjct  1    MKSDTFLDYAVFQLSPRRSRCELLVSSDGNTEKLASGLVKPFLTHLKVAEEQVARASSSI  60

Query  518  VLEPKSHNDA-SWFTKGTVERFIRFVS  595
             LE   H +A +WFTKGT ERF+R+VS
Sbjct  61   KLEIDRHKNAETWFTKGTFERFVRYVS  87



>ref|NP_194473.1| COP1-interacting protein 7 [Arabidopsis thaliana]
 ref|NP_001119068.1| COP1-interacting protein 7 [Arabidopsis thaliana]
 dbj|BAA31738.1| COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana]
 emb|CAB43875.1| COP1-interacting protein 7 (CIP7) [Arabidopsis thaliana]
 emb|CAB81393.1| COP1-interacting protein 7 (CIP7) [Arabidopsis thaliana]
 gb|AEE85339.1| COP1-interacting protein 7 [Arabidopsis thaliana]
 gb|AEE85340.1| COP1-interacting protein 7 [Arabidopsis thaliana]
Length=1058

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M   TRL+  +FQLTPTRTRCDL+I +  + EK+A+G+  PF+ HLK+  DQI+K GYS+
Sbjct  1    MDPRTRLDYALFQLTPTRTRCDLVIFSGGENEKLASGIFQPFVTHLKSVSDQISKGGYSV  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P S     WFTK T++RF+RFV+T
Sbjct  61   TLRPSSVG-VPWFTKVTLQRFVRFVTT  86



>ref|XP_004293497.1| PREDICTED: uncharacterized protein LOC101305638 [Fragaria vesca 
subsp. vesca]
Length=872

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  353  RLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSIVLEPK  532
            +L+   FQLTPTRTRCDL+I    K EK+A+GL  PF++HLK+ +D+I++ GYSI L P 
Sbjct  3    QLDHASFQLTPTRTRCDLVIFYGGKSEKLASGLFQPFVSHLKSLRDEISRGGYSITLRPP  62

Query  533  SHNDASWFTKGTVERFIRFVST  598
            +  DA WFTK T +RF+RFVST
Sbjct  63   TR-DAHWFTKPTFQRFVRFVST  83



>emb|CDY03786.1| BnaC01g29030D [Brassica napus]
Length=777

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S   L+S +FQLTPTRTR DL++    KKEK+A+G+ +PF++HLK A+DQI+K GYSI
Sbjct  1    MDSRAILDSALFQLTPTRTRFDLVLFCGSKKEKLASGIFEPFISHLKFARDQISKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             L P + + +SWFTK T +RF+RFV+T
Sbjct  61   SLHPPTSH-SSWFTKSTFDRFVRFVNT  86



>ref|XP_009597624.1| PREDICTED: uncharacterized protein LOC104093569 [Nicotiana tomentosiformis]
Length=895

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  MKSSTRLNSVVFQLTPTRTRCDLiiianekkekiaTGLLDPFLAHLKTAQDQIAKAGYSI  517
            M S T L+  + +LTPTRTRCDL++ +  K EK+A+GL++PF++HL+ A+DQI K GYSI
Sbjct  1    MDSRTLLDYALLKLTPTRTRCDLVVFSGGKSEKLASGLVEPFISHLQFAKDQIPKGGYSI  60

Query  518  VLEPKSHNDASWFTKGTVERFIRFVST  598
             + P S + A WFTK T +RF+RFVST
Sbjct  61   TMRPPSTH-AYWFTKSTFQRFVRFVST  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940