BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003E03 470 bp,:Filtered

Length=430
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072435.1|  PREDICTED: clavaminate synthase-like protein...    134   9e-35   Sesamum indicum [beniseed]
ref|XP_009786567.1|  PREDICTED: clavaminate synthase-like protein...    133   1e-34   Nicotiana sylvestris
ref|XP_009606566.1|  PREDICTED: clavaminate synthase-like protein...    132   4e-34   Nicotiana tomentosiformis
ref|XP_006343036.1|  PREDICTED: clavaminate synthase-like protein...    132   4e-34   Solanum tuberosum [potatoes]
gb|KFK39444.1|  hypothetical protein AALP_AA3G245700                    132   5e-34   Arabis alpina [alpine rockcress]
ref|XP_009353541.1|  PREDICTED: clavaminate synthase-like protein...    131   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_009342539.1|  PREDICTED: clavaminate synthase-like protein...    131   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_004236398.2|  PREDICTED: clavaminate synthase-like protein...    130   1e-33   Solanum lycopersicum
ref|XP_010510157.1|  PREDICTED: clavaminate synthase-like protein...    130   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006298007.1|  hypothetical protein CARUB_v10014052mg             130   3e-33   Capsella rubella
ref|XP_007215671.1|  hypothetical protein PRUPE_ppa008628mg             129   4e-33   Prunus persica
ref|NP_188773.1|  clavaminate synthase-like protein                     129   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348492.1|  PREDICTED: clavaminate synthase-like protein...    129   5e-33   Malus domestica [apple tree]
ref|XP_010033835.1|  PREDICTED: clavaminate synthase-like protein...    129   6e-33   Eucalyptus grandis [rose gum]
ref|XP_007024316.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    129   6e-33   Theobroma cacao [chocolate]
ref|XP_004141667.1|  PREDICTED: clavaminate synthase-like protein...    129   7e-33   Cucumis sativus [cucumbers]
ref|XP_002883301.1|  predicted protein                                  129   8e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_008462414.1|  PREDICTED: clavaminate synthase-like protein...    128   1e-32   Cucumis melo [Oriental melon]
ref|XP_008228422.1|  PREDICTED: clavaminate synthase-like protein...    128   1e-32   Prunus mume [ume]
emb|CDO97972.1|  unnamed protein product                                128   1e-32   Coffea canephora [robusta coffee]
ref|XP_006406277.1|  hypothetical protein EUTSA_v10021117mg             128   1e-32   Eutrema salsugineum
ref|XP_010466377.1|  PREDICTED: clavaminate synthase-like protein...    128   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010488150.1|  PREDICTED: clavaminate synthase-like protein...    128   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002298245.1|  hypothetical protein POPTR_0001s19100g             127   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011008104.1|  PREDICTED: clavaminate synthase-like protein...    127   2e-32   Populus euphratica
ref|XP_008365701.1|  PREDICTED: clavaminate synthase-like protein...    127   2e-32   Malus domestica [apple tree]
ref|XP_010535192.1|  PREDICTED: clavaminate synthase-like protein...    127   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010098147.1|  Clavaminate synthase-like protein                  127   3e-32   Morus notabilis
ref|XP_002515961.1|  conserved hypothetical protein                     127   3e-32   Ricinus communis
emb|CDY51445.1|  BnaA05g36620D                                          127   3e-32   Brassica napus [oilseed rape]
ref|XP_002283642.1|  PREDICTED: clavaminate synthase-like protein...    127   4e-32   Vitis vinifera
emb|CBI36054.3|  unnamed protein product                                127   5e-32   Vitis vinifera
ref|XP_010665891.1|  PREDICTED: clavaminate synthase-like protein...    126   6e-32   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009145480.1|  PREDICTED: clavaminate synthase-like protein...    126   7e-32   Brassica rapa
ref|XP_006465698.1|  PREDICTED: clavaminate synthase-like protein...    127   7e-32   Citrus sinensis [Valencia orange]
ref|XP_006426873.1|  hypothetical protein CICLE_v10025881mg             127   7e-32   Citrus clementina
gb|KDP40857.1|  hypothetical protein JCGZ_24856                         126   8e-32   Jatropha curcas
gb|KDO51792.1|  hypothetical protein CISIN_1g019661mg                   126   8e-32   Citrus sinensis [Valencia orange]
gb|KDO51793.1|  hypothetical protein CISIN_1g019661mg                   125   1e-31   Citrus sinensis [Valencia orange]
emb|CDY55285.1|  BnaC05g51790D                                          125   1e-31   Brassica napus [oilseed rape]
gb|KHG05955.1|  hypothetical protein F383_32718                         125   2e-31   Gossypium arboreum [tree cotton]
gb|KJB68188.1|  hypothetical protein B456_010G231000                    121   2e-31   Gossypium raimondii
gb|EYU21517.1|  hypothetical protein MIMGU_mgv1a009800mg                125   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_009383473.1|  PREDICTED: clavaminate synthase-like protein...    125   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008387431.1|  PREDICTED: LOW QUALITY PROTEIN: clavaminate ...    123   3e-31   Malus domestica [apple tree]
ref|XP_004302856.1|  PREDICTED: clavaminate synthase-like protein...    123   7e-31   Fragaria vesca subsp. vesca
ref|XP_008789286.1|  PREDICTED: clavaminate synthase-like protein...    123   9e-31   Phoenix dactylifera
ref|XP_010915385.1|  PREDICTED: clavaminate synthase-like protein...    121   4e-30   Elaeis guineensis
gb|EPS60476.1|  hypothetical protein M569_14325                         121   4e-30   Genlisea aurea
ref|XP_004486787.1|  PREDICTED: clavaminate synthase-like protein...    121   6e-30   Cicer arietinum [garbanzo]
ref|XP_010267146.1|  PREDICTED: clavaminate synthase-like protein...    121   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_003597673.1|  Clavaminate synthase-like protein                  120   8e-30   Medicago truncatula
ref|XP_007150604.1|  hypothetical protein PHAVU_005G166000g             119   3e-29   Phaseolus vulgaris [French bean]
ref|XP_006853694.1|  hypothetical protein AMTR_s00056p00140230          119   3e-29   Amborella trichopoda
emb|CDM81749.1|  unnamed protein product                                117   2e-28   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001240991.1|  uncharacterized protein LOC100797326               116   3e-28   Glycine max [soybeans]
ref|NP_001140643.1|  hypothetical protein                               113   3e-28   Zea mays [maize]
ref|XP_006645588.1|  PREDICTED: clavaminate synthase-like protein...    115   6e-28   Oryza brachyantha
ref|XP_004968463.1|  PREDICTED: clavaminate synthase-like protein...    115   6e-28   
gb|EEE54029.1|  hypothetical protein OsJ_00697                          114   7e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564672.2|  PREDICTED: clavaminate synthase-like protein...    115   9e-28   Brachypodium distachyon [annual false brome]
ref|NP_001146576.1|  hypothetical protein                               115   1e-27   Zea mays [maize]
gb|EEC70089.1|  hypothetical protein OsI_00718                          114   2e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001042262.1|  Os01g0190000                                       114   3e-27   
ref|XP_009352919.1|  PREDICTED: clavaminate synthase-like protein...    114   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_002457202.1|  hypothetical protein SORBIDRAFT_03g003210          113   4e-27   Sorghum bicolor [broomcorn]
ref|XP_008672371.1|  PREDICTED: hypothetical protein isoform X1         112   9e-27   Zea mays [maize]
ref|XP_008383739.1|  PREDICTED: clavaminate synthase-like protein...    112   1e-26   Malus domestica [apple tree]
ref|XP_006465697.1|  PREDICTED: clavaminate synthase-like protein...    108   2e-25   Citrus sinensis [Valencia orange]
ref|XP_001778974.1|  predicted protein                                  107   4e-25   Physcomitrella patens
ref|XP_002968731.1|  hypothetical protein SELMODRAFT_90998              106   2e-24   Selaginella moellendorffii
emb|CDX88947.1|  BnaA04g02390D                                          105   2e-24   Brassica napus [oilseed rape]
emb|CDX88855.1|  BnaA03g07940D                                          105   2e-24   Brassica napus [oilseed rape]
emb|CDY70280.1|  BnaAnng33200D                                          105   3e-24   Brassica napus [oilseed rape]
emb|CBI36055.3|  unnamed protein product                                102   6e-24   Vitis vinifera
ref|XP_002445051.1|  hypothetical protein SORBIDRAFT_07g003385          104   9e-24   Sorghum bicolor [broomcorn]
gb|EPS67856.1|  hypothetical protein M569_06917                         103   1e-23   Genlisea aurea
ref|XP_009112100.1|  PREDICTED: clavaminate synthase-like protein...    102   2e-23   Brassica rapa
ref|XP_009123824.1|  PREDICTED: clavaminate synthase-like protein...    102   2e-23   Brassica rapa
gb|KDO36029.1|  hypothetical protein CISIN_1g020626mg                   102   3e-23   Citrus sinensis [Valencia orange]
ref|XP_002283654.1|  PREDICTED: clavaminate synthase-like protein...    102   4e-23   Vitis vinifera
gb|KDO36028.1|  hypothetical protein CISIN_1g020626mg                   102   6e-23   Citrus sinensis [Valencia orange]
ref|XP_006426874.1|  hypothetical protein CICLE_v10026083mg             102   6e-23   Citrus clementina
gb|EPS67855.1|  hypothetical protein M569_06916                       97.8    2e-21   Genlisea aurea
gb|EPS60477.1|  hypothetical protein M569_14326                       95.9    8e-21   Genlisea aurea
ref|XP_009065528.1|  hypothetical protein LOTGIDRAFT_196958           92.0    2e-19   Lottia gigantea
ref|XP_005706462.1|  electron carrier/ oxidoreductase                 92.0    2e-19   Galdieria sulphuraria
ref|XP_006595473.1|  PREDICTED: clavaminate synthase-like protein...  85.1    7e-18   
gb|EYU24122.1|  hypothetical protein MIMGU_mgv1a0197361mg             84.3    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_011442945.1|  PREDICTED: clavaminate synthase-like protein...  82.0    7e-16   Crassostrea gigas
ref|WP_011413713.1|  SyrP protein                                     81.6    8e-16   Erythrobacter litoralis
gb|EKC43220.1|  hypothetical protein CGI_10027319                     82.0    8e-16   Crassostrea gigas
ref|WP_015245893.1|  SyrP protein                                     81.6    1e-15   Singulisphaera acidiphila
gb|ETO13900.1|  hypothetical protein RFI_23465                        82.0    1e-15   Reticulomyxa filosa
ref|XP_008360163.1|  PREDICTED: clavaminate synthase-like protein...  77.8    3e-15   Malus domestica [apple tree]
ref|XP_003572155.1|  PREDICTED: clavaminate synthase-like protein...  79.7    5e-15   Brachypodium distachyon [annual false brome]
ref|XP_010044303.1|  PREDICTED: clavaminate synthase-like protein...  79.7    5e-15   Eucalyptus grandis [rose gum]
gb|KCW86383.1|  hypothetical protein EUGRSUZ_B03062                   79.3    5e-15   Eucalyptus grandis [rose gum]
gb|EPS67858.1|  hypothetical protein M569_06919                       76.3    6e-15   Genlisea aurea
ref|XP_011008738.1|  PREDICTED: clavaminate synthase-like protein...  79.3    7e-15   Populus euphratica
ref|XP_002445444.1|  hypothetical protein SORBIDRAFT_07g019340        79.0    8e-15   Sorghum bicolor [broomcorn]
gb|EMT27634.1|  Clavaminate synthase-like protein                     79.0    8e-15   Aegilops tauschii
ref|XP_002974377.1|  hypothetical protein SELMODRAFT_414524           77.8    1e-14   Selaginella moellendorffii
ref|XP_007222712.1|  hypothetical protein PRUPE_ppa008704mg           78.6    1e-14   Prunus persica
ref|XP_008243156.1|  PREDICTED: clavaminate synthase-like protein...  78.6    1e-14   Prunus mume [ume]
ref|WP_007165225.1|  SyrP protein                                     77.4    2e-14   Erythrobacter sp. NAP1
ref|XP_008678543.1|  PREDICTED: clavaminate synthase-like protein...  77.4    3e-14   Zea mays [maize]
gb|EYU40851.1|  hypothetical protein MIMGU_mgv1a018757mg              77.4    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_008389321.1|  PREDICTED: clavaminate synthase-like protein...  77.4    3e-14   Malus domestica [apple tree]
ref|XP_008351024.1|  PREDICTED: clavaminate synthase-like protein...  77.4    3e-14   Malus domestica [apple tree]
ref|XP_009336638.1|  PREDICTED: clavaminate synthase-like protein...  77.4    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_002324809.2|  hypothetical protein POPTR_0018s00590g           73.2    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_002990802.1|  hypothetical protein SELMODRAFT_448192           77.4    4e-14   Selaginella moellendorffii
ref|XP_010044302.1|  PREDICTED: clavaminate synthase-like protein...  76.6    7e-14   Eucalyptus grandis [rose gum]
ref|WP_034952094.1|  SyrP protein                                     76.3    7e-14   Erythrobacter sp. JL475
ref|XP_006858496.1|  hypothetical protein AMTR_s00071p00129300        72.8    7e-14   
ref|XP_006378505.1|  hypothetical protein POPTR_0010s14110g           76.3    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004974652.1|  PREDICTED: clavaminate synthase-like protein...  76.3    8e-14   Setaria italica
ref|XP_006858502.1|  hypothetical protein AMTR_s00071p00132190        73.9    9e-14   
ref|XP_002314891.1|  hypothetical protein POPTR_0010s14120g           75.9    1e-13   Populus trichocarpa [western balsam poplar]
gb|ACN40806.1|  unknown                                               75.9    1e-13   Picea sitchensis
ref|XP_009418433.1|  PREDICTED: clavaminate synthase-like protein...  75.1    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005766892.1|  hypothetical protein EMIHUDRAFT_416307           76.3    2e-13   Emiliania huxleyi CCMP1516
gb|AFK36473.1|  unknown                                               75.1    2e-13   Lotus japonicus
ref|XP_002524391.1|  conserved hypothetical protein                   75.1    2e-13   Ricinus communis
gb|KCW86384.1|  hypothetical protein EUGRSUZ_B03063                   74.7    2e-13   Eucalyptus grandis [rose gum]
gb|AFK43267.1|  unknown                                               73.9    3e-13   Medicago truncatula
ref|XP_010044304.1|  PREDICTED: clavaminate synthase-like protein...  74.7    3e-13   Eucalyptus grandis [rose gum]
ref|XP_002965817.1|  hypothetical protein SELMODRAFT_66708            73.9    3e-13   Selaginella moellendorffii
ref|XP_003576427.1|  PREDICTED: clavaminate synthase-like protein...  75.1    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_002960924.1|  hypothetical protein SELMODRAFT_74242            74.3    4e-13   Selaginella moellendorffii
gb|ACN40106.1|  unknown                                               73.6    4e-13   Picea sitchensis
ref|XP_002967085.1|  hypothetical protein SELMODRAFT_87833            74.3    4e-13   Selaginella moellendorffii
ref|XP_005768829.1|  hypothetical protein EMIHUDRAFT_436587           75.5    4e-13   Emiliania huxleyi CCMP1516
gb|EEE68610.1|  hypothetical protein OsJ_27145                        73.6    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KEH17356.1|  clavaminate synthase-like plant protein               73.9    5e-13   Medicago truncatula
dbj|BAD05823.1|  putative Signal peptidase I                          73.9    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006437754.1|  hypothetical protein CICLE_v10033372mg           73.6    8e-13   Citrus clementina
gb|KJB50797.1|  hypothetical protein B456_008G187300                  73.6    8e-13   Gossypium raimondii
ref|XP_006484570.1|  PREDICTED: clavaminate synthase-like protein...  73.6    9e-13   Citrus sinensis [Valencia orange]
ref|WP_003615168.1|  Taurine catabolism dioxygenase TauD/TfdA         73.2    1e-12   Methylosinus
gb|KDP29349.1|  hypothetical protein JCGZ_18270                       73.2    1e-12   Jatropha curcas
ref|XP_002983066.1|  hypothetical protein SELMODRAFT_117522           72.8    1e-12   Selaginella moellendorffii
ref|WP_034388097.1|  SyrP protein                                     72.8    2e-12   
gb|AFG63213.1|  hypothetical protein 0_1803_01                        70.5    2e-12   Pinus taeda
ref|XP_008467203.1|  PREDICTED: clavaminate synthase-like protein...  72.8    2e-12   Cucumis melo [Oriental melon]
ref|XP_004490256.1|  PREDICTED: clavaminate synthase-like protein...  72.4    2e-12   Cicer arietinum [garbanzo]
ref|XP_006858500.1|  hypothetical protein AMTR_s00071p00131570        72.4    2e-12   Amborella trichopoda
gb|AFG63219.1|  hypothetical protein 0_1803_01                        69.7    2e-12   Pinus taeda
ref|XP_004297149.1|  PREDICTED: clavaminate synthase-like protein...  72.0    3e-12   Fragaria vesca subsp. vesca
ref|WP_022599044.1|  putative Clavaminate synthase                    71.6    4e-12   Vibrio nigripulchritudo
ref|WP_022552116.1|  putative Clavaminate synthase                    71.6    4e-12   Vibrio nigripulchritudo
ref|WP_022607050.1|  putative Clavaminate synthase                    71.6    4e-12   Vibrio nigripulchritudo
ref|WP_004399145.1|  SyrP                                             71.6    4e-12   Vibrio nigripulchritudo
ref|WP_022610463.1|  putative Clavaminate synthase                    71.6    4e-12   Vibrio nigripulchritudo
ref|WP_022590254.1|  putative Clavaminate synthase                    71.6    4e-12   Vibrio nigripulchritudo
ref|XP_006660097.1|  PREDICTED: clavaminate synthase-like protein...  70.1    6e-12   
ref|XP_010925014.1|  PREDICTED: clavaminate synthase-like protein...  70.9    6e-12   Elaeis guineensis
ref|XP_004147109.1|  PREDICTED: clavaminate synthase-like protein...  70.9    8e-12   Cucumis sativus [cucumbers]
gb|ABR18170.1|  unknown                                               70.9    8e-12   Picea sitchensis
ref|XP_008779099.1|  PREDICTED: clavaminate synthase-like protein...  70.5    9e-12   Phoenix dactylifera
ref|XP_004162029.1|  PREDICTED: clavaminate synthase-like protein...  70.5    1e-11   
gb|KDP29350.1|  hypothetical protein JCGZ_18271                       70.5    1e-11   Jatropha curcas
ref|WP_040965438.1|  SyrP protein                                     70.1    1e-11   
ref|XP_006858504.1|  hypothetical protein AMTR_s00071p00133840        70.1    1e-11   Amborella trichopoda
gb|EMT25595.1|  Clavaminate synthase-like protein                     69.3    2e-11   Aegilops tauschii
ref|XP_002505882.1|  predicted protein                                69.3    2e-11   Micromonas commoda
ref|WP_040655297.1|  hypothetical protein                             69.7    2e-11   
ref|WP_043969598.1|  regulatory protein                               69.3    3e-11   
ref|WP_012189424.1|  taurine catabolism dioxygenase TauD/TfdA         69.7    3e-11   
gb|ERN42083.1|  putative taurine catabolism dioxygenase               69.7    3e-11   Rubidibacter lacunae KORDI 51-2
gb|ABR17432.1|  unknown                                               68.9    4e-11   Picea sitchensis
ref|XP_002278552.1|  PREDICTED: clavaminate synthase-like protein...  68.6    4e-11   Vitis vinifera
ref|WP_034959538.1|  SyrP protein                                     68.6    4e-11   Erythrobacter longus
ref|WP_008347633.1|  MULTISPECIES: taurine catabolism dioxygenase...  68.6    5e-11   Burkholderiaceae
ref|WP_020683821.1|  hypothetical protein                             68.6    5e-11   Marinobacterium rhizophilum
ref|WP_041398990.1|  SyrP protein                                     67.8    6e-11   
ref|WP_041311823.1|  SyrP                                             68.2    7e-11   
ref|WP_027778120.1|  hypothetical protein                             68.2    7e-11   Paraburkholderia caledonica
ref|WP_007236400.1|  SyrP protein                                     68.2    7e-11   marine gamma proteobacterium HTCC2080
gb|ADJ63841.1|  clavaminic acid synthetase (CAS)-like protein         68.2    8e-11   Herbaspirillum seropedicae SmR1
gb|ADY58679.1|  Taurine catabolism dioxygenase TauD/TfdA              68.2    9e-11   Rubinisphaera brasiliensis DSM 5305
emb|CDZ79741.1|  peptide synthase                                     68.2    9e-11   Candidatus Rubidus massiliensis
ref|XP_010490000.1|  PREDICTED: clavaminate synthase-like protein...  67.8    9e-11   Camelina sativa [gold-of-pleasure]
ref|WP_039770085.1|  SyrP                                             67.8    9e-11   Pseudomonas fluorescens
gb|ABK26347.1|  unknown                                               67.8    1e-10   Picea sitchensis
ref|WP_015866525.1|  Taurine catabolism dioxygenase TauD/TfdA         67.8    1e-10   Variovorax paradoxus
ref|WP_013795423.1|  SyrP                                             67.4    1e-10   Marinomonas posidonica
ref|WP_019701171.1|  syrP protein                                     67.4    1e-10   Acidovorax avenae
ref|WP_031048272.1|  hypothetical protein                             67.4    1e-10   Streptomyces
ref|WP_026432248.1|  SyrP                                             67.4    2e-10   Acidovorax oryzae
ref|WP_026196734.1|  SyrP                                             67.0    2e-10   Fangia hongkongensis
ref|WP_005455406.1|  SyrP                                             67.0    2e-10   Saccharomonospora cyanea
ref|WP_013596030.1|  taurine catabolism dioxygenase tauD/TfdA         67.0    2e-10   Acidovorax avenae
ref|WP_043733042.1|  hypothetical protein                             66.6    2e-10   Kutzneria sp. 744
ref|WP_018905478.1|  syrP protein                                     67.0    2e-10   Variovorax paradoxus
ref|WP_037018633.1|  SyrP                                             67.0    2e-10   
ref|WP_024764720.1|  SyrP                                             67.0    2e-10   Pseudomonas nitroreducens
ref|WP_040560018.1|  hypothetical protein                             65.9    2e-10   
ref|WP_027784410.1|  hypothetical protein                             67.0    2e-10   Burkholderia cepacia
ref|WP_043182787.1|  hypothetical protein                             67.0    2e-10   Burkholderia cepacia
ref|XP_006362521.1|  PREDICTED: clavaminate synthase-like protein...  66.6    2e-10   Solanum tuberosum [potatoes]
ref|WP_034184138.1|  hypothetical protein                             67.0    2e-10   Burkholderia pyrrocinia
emb|CDP00560.1|  unnamed protein product                              66.6    2e-10   Coffea canephora [robusta coffee]
ref|WP_021163603.1|  MULTISPECIES: SyrP-like protein                  66.6    2e-10   Burkholderia
ref|XP_011077364.1|  PREDICTED: clavaminate synthase-like protein...  66.6    3e-10   Sesamum indicum [beniseed]
ref|WP_025989814.1|  hypothetical protein                             66.6    3e-10   Burkholderia oklahomensis
ref|WP_011351934.1|  hypothetical protein                             66.6    3e-10   Burkholderia lata
ref|WP_034186925.1|  hypothetical protein                             66.6    3e-10   Burkholderia cepacia complex
ref|WP_012425965.1|  taurine catabolism dioxygenase tauD/tfdA         66.6    3e-10   Paraburkholderia phytofirmans
ref|WP_010103778.1|  syringomycin biosynthesis enzyme, putative       66.6    3e-10   Burkholderia oklahomensis
ref|WP_039358661.1|  hypothetical protein                             66.6    3e-10   Burkholderia contaminans
ref|WP_011656819.1|  taurine catabolism dioxygenase TauD/TfdA         66.6    3e-10   Burkholderia ambifaria
ref|WP_006753775.1|  Taurine catabolism dioxygenase TauD/TfdA         66.6    3e-10   Burkholderia ambifaria
gb|ABV56595.1|  KtzO                                                  66.6    3e-10   Kutzneria sp. 744
ref|WP_006760383.1|  Taurine catabolism dioxygenase TauD/TfdA         66.6    3e-10   Burkholderia ambifaria
ref|WP_013342378.1|  Taurine catabolism dioxygenase TauD/TfdA         66.6    3e-10   Burkholderia sp. CCGE1003
ref|WP_017520931.1|  hypothetical protein                             66.6    3e-10   Pseudomonas nitroreducens
ref|WP_037055677.1|  SyrP                                             66.2    3e-10   Pseudomonas oleovorans
ref|WP_017320426.1|  hypothetical protein                             66.6    3e-10   cyanobacterium PCC 7702
ref|WP_026044726.1|  hypothetical protein                             66.6    3e-10   Burkholderia pyrrocinia
ref|WP_029967000.1|  hypothetical protein                             66.6    3e-10   Burkholderia sp. URHA0054
gb|EDP95518.1|  Condensation domain                                   66.2    3e-10   Kordia algicida OT-1
ref|WP_039221883.1|  hypothetical protein                             66.2    4e-10   Burkholderia multivorans
ref|WP_006476051.1|  Hypothetical protein                             66.2    4e-10   Burkholderia cenocepacia
ref|WP_006486082.1|  MULTISPECIES: taurine catabolism dioxygenase...  66.2    4e-10   Burkholderia cepacia complex
ref|WP_027807406.1|  hypothetical protein                             66.2    4e-10   Burkholderia cenocepacia
ref|WP_012403341.1|  taurine catabolism dioxygenase TauD/TfdA         66.2    4e-10   Paraburkholderia phymatum
ref|WP_010092425.1|  hypothetical protein                             66.2    4e-10   Burkholderia ubonensis
ref|WP_012328451.1|  taurine catabolism dioxygenase TauD/TfdA         66.2    4e-10   Burkholderia cenocepacia
ref|WP_006047208.1|  Taurine catabolism dioxygenase TauD/TfdA         66.2    4e-10   Paraburkholderia graminis
ref|WP_039415740.1|  SyrP                                             65.9    4e-10   
ref|WP_016347862.1|  putative syringomycin biosynthesis enzyme        66.2    4e-10   Burkholderia sp. RPE64
ref|WP_011796775.1|  taurine catabolism dioxygenase TauD/TfdA         66.2    4e-10   Acidovorax citrulli
ref|WP_042583995.1|  hypothetical protein                             66.2    4e-10   Burkholderia sp. MSHR3999
ref|WP_015201410.1|  taurine catabolism dioxygenase tauD/tfdA         66.2    4e-10   Crinalium epipsammum
ref|XP_004239424.1|  PREDICTED: clavaminate synthase-like protein...  65.9    5e-10   Solanum lycopersicum
ref|WP_020193356.1|  hypothetical protein                             64.3    5e-10   
ref|WP_035481516.1|  hypothetical protein                             65.9    5e-10   Paraburkholderia phenoliruptrix
ref|WP_015477303.1|  pyoverdine biosynthesis regulatory protein-T...  65.9    5e-10   Pseudomonas denitrificans
ref|WP_014972481.1|  taurine catabolism dioxygenase TauD/TfdA         65.9    5e-10   Paraburkholderia phenoliruptrix
gb|ENO99089.1|  taurine catabolism dioxygenase TauD, TfdA family ...  65.1    5e-10   Thauera phenylacetica B4P
ref|WP_039737043.1|  taurine catabolism dioxygenase TauD              65.9    5e-10   Hassallia byssoidea
ref|WP_016773893.1|  syrP protein                                     65.9    5e-10   Pseudomonas sp. R62
ref|WP_042608395.1|  SyrP                                             65.9    5e-10   Pseudomonas fluorescens
ref|WP_024012352.1|  syrP protein                                     65.9    5e-10   Pseudomonas moraviensis
dbj|BAO91577.1|  taurine catabolism dioxygenase TauD/TfdA             65.9    5e-10   Burkholderia sp. RPE67
ref|WP_013591052.1|  Taurine catabolism dioxygenase TauD/TfdA         65.9    5e-10   Burkholderia sp. CCGE1001
ref|WP_014252022.1|  taurine catabolism dioxygenase tauD/tfdA         65.9    5e-10   Burkholderia sp. YI23
ref|WP_035488733.1|  SyrP protein                                     65.9    5e-10   Gammaproteobacteria bacterium MOLA455
ref|WP_041479063.1|  SyrP                                             65.9    6e-10   Pseudomonas
ref|WP_028362763.1|  hypothetical protein                             65.9    6e-10   Burkholderia sp. JPY366
ref|WP_039763054.1|  SyrP                                             65.9    6e-10   Pseudomonas fluorescens
ref|XP_002965813.1|  hypothetical protein SELMODRAFT_439273           65.1    6e-10   Selaginella moellendorffii
ref|WP_035505000.1|  hypothetical protein                             65.5    6e-10   Burkholderia jiangsuensis
ref|XP_002993228.1|  hypothetical protein SELMODRAFT_449058           65.1    6e-10   Selaginella moellendorffii
ref|WP_034207280.1|  hypothetical protein                             65.5    6e-10   Burkholderia cepacia
ref|WP_034845203.1|  SyrP                                             65.5    7e-10   Inquilinus limosus
ref|WP_039920407.1|  SyrP                                             65.5    7e-10   Thauera phenylacetica
ref|WP_041493826.1|  hypothetical protein                             65.5    7e-10   Burkholderia
ref|WP_011884793.1|  taurine catabolism dioxygenase TauD/TfdA         65.5    7e-10   Burkholderia vietnamiensis
ref|WP_036566261.1|  taurine catabolism dioxygenase TauD              65.5    7e-10   
ref|WP_034193113.1|  hypothetical protein                             65.5    8e-10   Burkholderia
ref|WP_021619365.1|  taurine catabolism dioxygenase, TauD/TfdA fa...  65.5    8e-10   Aneurinibacillus aneurinilyticus
gb|EWM27159.1|  clavaminate synthase-like protein                     65.9    8e-10   Nannochloropsis gaditana
ref|XP_004996054.1|  hypothetical protein PTSG_03469                  65.5    8e-10   Salpingoeca rosetta
ref|WP_027214850.1|  hypothetical protein                             65.5    8e-10   Burkholderia sp. WSM2232
ref|WP_035915375.1|  hypothetical protein                             64.7    9e-10   
ref|WP_028692199.1|  SyrP                                             65.1    9e-10   Pseudomonas mosselii
ref|WP_006764341.1|  hypothetical protein                             65.1    9e-10   Burkholderia cepacia complex
gb|EGC98903.1|  taurine catabolism dioxygenase TauD/TfdA              65.1    9e-10   Burkholderia sp. TJI49
ref|WP_006404844.1|  putative syringomycin biosynthesis enzyme        65.1    1e-09   Burkholderia multivorans
ref|WP_044843582.1|  hypothetical protein                             65.1    1e-09   Burkholderia sp. USM B20
ref|WP_006400108.1|  putative syringomycin biosynthesis enzyme        65.1    1e-09   Burkholderia
ref|WP_012213369.1|  taurine catabolism dioxygenase TauD/TfdA         65.1    1e-09   Burkholderia multivorans
ref|WP_040127389.1|  hypothetical protein                             65.1    1e-09   Burkholderia cenocepacia
ref|WP_044250092.1|  hypothetical protein                             65.1    1e-09   
ref|WP_006414159.1|  taurine catabolism dioxygenase, TauD/TfdA fa...  65.1    1e-09   Burkholderia multivorans
ref|WP_014897074.1|  taurine catabolism dioxygenase TauD/TfdA         65.1    1e-09   Burkholderia cepacia
gb|EYF01037.1|  SyrP-like protein                                     65.1    1e-09   
ref|WP_005372396.1|  MULTISPECIES: putative taurine catabolism di...  65.1    1e-09   
ref|WP_035519478.1|  hypothetical protein                             65.1    1e-09   
emb|CDG82374.1|  taurine catabolism dioxygenase TauD, TfdA family...  64.7    1e-09   
ref|WP_026038066.1|  SyrP                                             65.1    1e-09   
ref|WP_027812957.1|  hypothetical protein                             65.1    1e-09   
ref|WP_020068861.1|  syrP protein                                     65.1    1e-09   
ref|WP_038499118.1|  SyrP                                             64.7    1e-09   
gb|KFC08261.1|  Taurine catabolism dioxygenase TauD/TfdA              65.1    1e-09   
ref|WP_035564244.1|  SyrP                                             64.7    1e-09   
ref|WP_038982316.1|  SyrP                                             64.7    1e-09   
ref|WP_028195022.1|  hypothetical protein                             65.1    1e-09   
ref|WP_022522941.1|  Taurine catabolism dioxygenase TauD, TfdA fa...  64.7    1e-09   
ref|XP_010241670.1|  PREDICTED: clavaminate synthase-like protein...  63.2    1e-09   
ref|WP_039859003.1|  SyrP                                             64.7    1e-09   
ref|WP_035999681.1|  hypothetical protein                             64.7    1e-09   
ref|WP_027957181.1|  MULTISPECIES: SyrP                               64.7    1e-09   
ref|WP_041158104.1|  SyrP                                             64.7    1e-09   
ref|WP_035583104.1|  SyrP                                             64.7    1e-09   
ref|WP_016951655.1|  hypothetical protein                             64.7    1e-09   
ref|WP_025599423.1|  hypothetical protein                             64.7    1e-09   
ref|WP_007917125.1|  MULTISPECIES: putative taurine catabolism di...  64.7    1e-09   
ref|WP_044221788.1|  taurine catabolism dioxygenase TauD              63.9    1e-09   
ref|WP_012596276.1|  peptide synthetase                               66.2    1e-09   
ref|WP_015784516.1|  peptide synthetase                               66.2    1e-09   
ref|WP_035938996.1|  hypothetical protein                             64.7    2e-09   
ref|WP_003223422.1|  Taurine catabolism dioxygenase                   64.3    2e-09   
ref|XP_010093379.1|  Clavaminate synthase-like protein                64.3    2e-09   
ref|WP_042558559.1|  SyrP                                             64.3    2e-09   
ref|WP_008448568.1|  taurine catabolism dioxygenase TauD              64.3    2e-09   
ref|WP_007178209.1|  putative taurine catabolism dioxygenase          64.3    2e-09   
ref|WP_036161445.1|  SyrP                                             64.3    2e-09   
ref|WP_014590247.1|  SyrP protein, putative                           64.3    2e-09   
ref|WP_027527618.1|  hypothetical protein                             64.3    2e-09   
ref|WP_040144165.1|  hypothetical protein                             64.3    2e-09   
ref|WP_039402821.1|  SyrP                                             64.3    2e-09   
gb|ETX10831.1|  SyrP                                                  64.3    2e-09   
ref|WP_003337657.1|  condensation domain protein                      64.3    2e-09   
ref|WP_010954977.1|  syrP protein                                     64.3    2e-09   
ref|WP_012363849.1|  taurine catabolism dioxygenase TauD/TfdA         64.3    2e-09   
ref|WP_011492714.1|  hypothetical protein                             64.3    2e-09   
ref|WP_026185374.1|  SyrP                                             63.9    2e-09   
ref|XP_002993231.1|  hypothetical protein SELMODRAFT_449061           62.4    2e-09   
gb|ERM18960.1|  taurine catabolism dioxygenase TauD/TfdA              64.3    2e-09   
ref|WP_037009301.1|  SyrP                                             64.3    2e-09   
ref|XP_003518691.1|  PREDICTED: clavaminate synthase-like protein...  63.9    2e-09   
ref|WP_031309118.1|  taurine catabolism dioxygenase TauD              64.3    2e-09   
ref|XP_003516861.1|  PREDICTED: clavaminate synthase-like protein...  63.9    2e-09   
ref|WP_003339389.1|  taurine catabolism dioxygenase TauD, TfdA fa...  64.3    2e-09   
gb|EGU10974.1|  hypothetical protein RTG_03193                        64.3    2e-09   
ref|WP_011316893.1|  condensation domain-containing protein           65.5    2e-09   
ref|WP_044356753.1|  hypothetical protein                             63.2    2e-09   
ref|WP_027801857.1|  hypothetical protein                             64.3    2e-09   
ref|WP_017320416.1|  hypothetical protein                             63.9    2e-09   
gb|ACU60874.1|  Taurine catabolism dioxygenase TauD/TfdA              63.9    2e-09   
ref|WP_033366237.1|  taurine catabolism dioxygenase TauD              63.9    3e-09   
ref|WP_043441167.1|  SyrP                                             63.5    3e-09   
ref|WP_007895670.1|  syrP protein                                     63.9    3e-09   
ref|XP_007046337.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  63.5    3e-09   
ref|WP_004583267.1|  taurine catabolism dioxygenase TauD/TfdA         63.9    3e-09   
ref|XP_009782162.1|  PREDICTED: clavaminate synthase-like protein...  63.5    3e-09   
gb|ESH99296.1|  syrP protein                                          63.5    3e-09   
ref|XP_009596840.1|  PREDICTED: clavaminate synthase-like protein...  63.5    3e-09   
ref|WP_013393235.1|  taurine catabolism dioxygenase TauD, TfdA fa...  63.5    3e-09   
ref|WP_026723917.1|  taurine catabolism dioxygenase TauD              63.9    3e-09   
ref|WP_015122072.1|  putative taurine catabolism dioxygenase          63.5    3e-09   
ref|WP_015188198.1|  Taurine catabolism dioxygenase TauD/TfdA         63.5    3e-09   
ref|WP_015155704.1|  taurine catabolism dioxygenase tauD/tfdA         63.5    3e-09   
ref|WP_012189648.1|  taurine catabolism dioxygenase TauD/TfdA         63.9    3e-09   
ref|WP_008071251.1|  putative taurine catabolism dioxygenase          63.5    3e-09   
gb|AJP59797.1|  SyrP                                                  63.5    3e-09   
ref|WP_044458248.1|  SyrP                                             63.5    3e-09   
ref|WP_038743065.1|  hypothetical protein                             63.5    3e-09   
ref|WP_017679123.1|  syrP protein                                     63.5    4e-09   
ref|WP_003247049.1|  taurine catabolism dioxygenase TauD/TfdA         63.5    4e-09   
ref|WP_021489663.1|  syrP protein                                     63.5    4e-09   
ref|WP_031415077.1|  taurine catabolism dioxygenase TauD              63.5    4e-09   
gb|AGH69813.1|  taurine catabolism dioxygenase TauD/TfdA              63.5    4e-09   
ref|WP_035799573.1|  regulatory protein                               63.5    4e-09   
ref|WP_012019052.1|  taurine catabolism dioxygenase TauD/TfdA         63.5    4e-09   
ref|XP_007153325.1|  hypothetical protein PHAVU_003G025800g           63.2    4e-09   
ref|WP_009912423.1|  putative syringomycin biosynthesis enzyme        63.2    4e-09   
ref|WP_017361893.1|  syrP protein                                     63.2    4e-09   
ref|WP_007232941.1|  SyrP protein                                     63.2    4e-09   
ref|WP_043390817.1|  taurine catabolism dioxygenase TauD              63.5    4e-09   
ref|WP_038794985.1|  hypothetical protein                             63.2    4e-09   
ref|WP_038182266.1|  hypothetical protein                             63.2    4e-09   
ref|WP_018748833.1|  syrP protein                                     63.2    4e-09   
gb|KGV69444.1|  taurine catabolism dioxygenase TauD, TfdA family ...  63.2    4e-09   
emb|CCQ61735.1|  SyrP-like protein                                    63.2    4e-09   
ref|WP_042304273.1|  hypothetical protein                             63.2    5e-09   
gb|KHN05847.1|  Clavaminate synthase-like protein                     62.8    5e-09   
gb|AFK56329.1|  putative SyrP-like regulatory protein                 61.6    5e-09   
ref|WP_023630532.1|  syrP protein                                     63.2    5e-09   
ref|WP_021830540.1|  SyrP-like protein                                63.2    5e-09   
ref|WP_007578002.1|  taurine catabolism dioxygenase TauD/TfdA         63.2    5e-09   
ref|WP_009891213.1|  syringomycin biosynthesis enzyme, putative       63.2    5e-09   
ref|WP_007305680.1|  hypothetical protein                             63.2    5e-09   
ref|WP_025369387.1|  hypothetical protein                             63.2    5e-09   
gb|KHN45194.1|  Clavaminate synthase-like protein                     62.8    5e-09   
ref|WP_039716921.1|  taurine catabolism dioxygenase TauD              63.2    5e-09   
gb|KIJ83909.1|  taurine catabolism dioxygenase TauD                   63.2    5e-09   
ref|WP_006026675.1|  syringomycin biosynthesis enzyme, putative       63.2    5e-09   
ref|WP_034853906.1|  SyrP                                             62.8    5e-09   
ref|WP_019472800.1|  MULTISPECIES: hypothetical protein               63.2    5e-09   
ref|WP_015600397.1|  taurine catabolism dioxygenase TauD, TfdA fa...  63.2    5e-09   
ref|WP_015207065.1|  putative taurine catabolism dioxygenase          63.2    5e-09   
ref|WP_011402371.1|  syringomycin biosynthesis enzyme                 63.2    6e-09   
ref|WP_007737689.1|  putative taurine catabolism dioxygenase          63.2    6e-09   
ref|WP_043824407.1|  SyrP                                             62.8    6e-09   
ref|WP_012206556.1|  taurine catabolism dioxygenase TauD/TfdA         62.8    6e-09   
ref|WP_038741049.1|  hypothetical protein                             62.8    6e-09   
ref|WP_016450666.1|  hypothetical protein                             62.8    6e-09   
ref|WP_005081257.1|  taurine catabolism dioxygenase TauD              63.2    6e-09   
ref|WP_038799144.1|  hypothetical protein                             62.8    6e-09   
ref|WP_038797419.1|  hypothetical protein                             62.8    6e-09   
ref|WP_009973493.1|  putative syringomycin biosynthesis enzyme        62.8    6e-09   
ref|WP_003444936.1|  MULTISPECIES: pyoverdine biosynthesis regula...  62.8    6e-09   
ref|WP_016451433.1|  hypothetical protein                             62.8    6e-09   
gb|KGC51344.1|  taurine catabolism dioxygenase TauD, TfdA family ...  62.8    6e-09   
ref|WP_038723338.1|  hypothetical protein                             62.8    6e-09   
gb|KGS75461.1|  taurine catabolism dioxygenase TauD, TfdA family ...  62.8    6e-09   
ref|WP_038751704.1|  hypothetical protein                             62.8    6e-09   
ref|WP_038756670.1|  hypothetical protein                             62.8    6e-09   
ref|WP_013801597.1|  taurine catabolism dioxygenase tauD/tfdA         62.8    6e-09   
ref|WP_042971220.1|  hypothetical protein                             62.8    6e-09   
ref|WP_004556944.1|  MULTISPECIES: syringomycin biosynthesis enzyme   62.8    7e-09   
gb|KHE31077.1|  hypothetical protein LH31_31655                       59.7    7e-09   
ref|WP_038757918.1|  hypothetical protein                             62.8    7e-09   
ref|WP_038782896.1|  hypothetical protein                             62.8    7e-09   
ref|WP_004550503.1|  SyrP-like protein                                62.8    7e-09   
ref|WP_004531247.1|  MULTISPECIES: putative syringomycin biosynth...  62.8    7e-09   
ref|WP_004526940.1|  MULTISPECIES: putative syringomycin biosynth...  62.8    7e-09   
ref|WP_009905470.1|  syringomycin biosynthesis enzyme, putative       62.8    7e-09   
ref|WP_004543223.1|  putative syringomycin biosynthesis enzyme        62.8    7e-09   
gb|EDU07423.1|  putative syringomycin biosynthesis enzyme             62.8    7e-09   
ref|WP_004193563.1|  putative syringomycin biosynthesis enzyme        62.8    7e-09   
gb|KGD09458.1|  taurine catabolism dioxygenase TauD, TfdA family ...  62.8    7e-09   
ref|WP_033960887.1|  regulatory protein                               60.1    7e-09   
ref|WP_038776929.1|  hypothetical protein                             62.8    7e-09   
ref|WP_038744036.1|  hypothetical protein                             62.8    7e-09   
gb|ABN91633.1|  putative syringomycin biosynthesis enzyme             62.8    7e-09   
ref|WP_041196122.1|  hypothetical protein                             62.8    7e-09   
ref|WP_038785742.1|  hypothetical protein                             62.8    7e-09   
ref|WP_038761856.1|  hypothetical protein                             62.8    7e-09   
gb|KGS33277.1|  taurine catabolism dioxygenase TauD, TfdA family ...  62.8    7e-09   
ref|WP_036256619.1|  taurine catabolism dioxygenase TauD              62.8    8e-09   
gb|EAM50632.1|  hypothetical protein CwatDRAFT_3594                   60.8    8e-09   
ref|WP_038501012.1|  hypothetical protein                             62.4    8e-09   
ref|WP_012409813.1|  taurine catabolism dioxygenase TauD/TfdA         62.4    8e-09   
emb|CDG85847.1|  taurine catabolism dioxygenase TauD, TfdA family...  62.4    8e-09   
ref|WP_042951801.1|  regulatory protein                               59.7    8e-09   
ref|WP_036965221.1|  taurine catabolism dioxygenase TauD              62.4    8e-09   
ref|WP_042711535.1|  syrP protein                                     60.5    9e-09   
ref|XP_006858503.1|  hypothetical protein AMTR_s00071p00133060        60.1    9e-09   
ref|WP_036709457.1|  taurine catabolism dioxygenase TauD              62.0    9e-09   
ref|WP_027468176.1|  SyrP                                             62.4    9e-09   
ref|WP_012596274.1|  taurine catabolism dioxygenase tauD/tfdA         62.4    1e-08   
ref|WP_015784518.1|  taurine catabolism dioxygenase TauD/TfdA         62.4    1e-08   
ref|WP_042669771.1|  SyrP                                             62.0    1e-08   
ref|WP_017654191.1|  taurine catabolism dioxygenase TauD/TfdA         62.0    1e-08   
ref|WP_039491545.1|  taurine catabolism dioxygenase TauD              62.4    1e-08   
ref|WP_020094342.1|  hypothetical protein                             62.0    1e-08   
ref|WP_038823074.1|  regulatory protein                               59.3    1e-08   
dbj|BAM91289.1|  conserved hypothetical protein                       61.6    1e-08   
ref|XP_002287846.1|  predicted protein                                60.8    1e-08   
ref|WP_039578249.1|  SyrP                                             62.0    1e-08   
ref|XP_008714174.1|  hypothetical protein HMPREF1541_01593            62.4    1e-08   
ref|WP_002979693.1|  taurine catabolism dioxygenase, TauD/TfdA fa...  62.0    1e-08   
ref|XP_007275177.1|  taurine catabolism dioxygenase                   62.4    1e-08   
gb|EQL40562.1|  hypothetical protein M770_16060                       60.1    1e-08   
ref|WP_028346873.1|  SyrP                                             62.0    1e-08   
ref|WP_020118907.1|  SyrP                                             62.0    1e-08   
gb|KIX45473.1|  Polyketide synthase module                            63.5    1e-08   
ref|WP_013714928.1|  taurine catabolism dioxygenase TauD/TfdA         62.0    1e-08   
gb|AAN85494.1|AF484556_16  putative regulatory protein                61.6    1e-08   
ref|WP_041978289.1|  SyrP                                             61.6    1e-08   
ref|WP_012791045.1|  taurine catabolism dioxygenase TauD/TfdA         61.6    1e-08   
ref|WP_024307656.1|  SyrP                                             61.6    1e-08   
ref|WP_019437868.1|  syrP protein                                     61.6    2e-08   
ref|WP_020563495.1|  syrP protein                                     61.6    2e-08   
ref|WP_042340221.1|  SyrP                                             61.6    2e-08   
ref|WP_002971956.1|  taurine catabolism dioxygenase, TauD/TfdA fa...  61.6    2e-08   
ref|WP_016392700.1|  pyoverdine biosynthesis regulatory protein       61.6    2e-08   
ref|WP_009834755.1|  SyrP                                             61.6    2e-08   
ref|WP_015149445.1|  putative taurine catabolism dioxygenase          61.6    2e-08   
ref|WP_016953774.1|  hypothetical protein                             61.6    2e-08   
ref|WP_030320817.1|  SyrP                                             61.2    2e-08   
gb|EST36574.1|  hypothetical protein M878_01420                       62.8    2e-08   
ref|WP_036034521.1|  SyrP                                             61.2    2e-08   
ref|WP_034038079.1|  regulatory protein                               61.6    2e-08   
ref|WP_012487489.1|  putative syrP protein                            61.2    2e-08   
ref|WP_030469201.1|  SyrP                                             61.2    2e-08   
ref|WP_037830670.1|  MULTISPECIES: regulatory protein                 60.8    2e-08   
ref|WP_039491320.1|  hypothetical protein                             61.2    2e-08   
gb|KGY60535.1|  SyrP                                                  61.2    2e-08   
ref|WP_042783831.1|  SyrP                                             61.2    2e-08   
gb|EMS23157.1|  taurine catabolism dioxygenase TauD                   61.6    2e-08   
ref|WP_036023852.1|  SyrP                                             61.2    2e-08   
ref|WP_033651136.1|  SyrP                                             61.2    2e-08   
ref|WP_040663063.1|  hypothetical protein                             61.2    2e-08   
ref|WP_009684748.1|  peptide synthase                                 58.9    2e-08   
ref|WP_013182524.1|  hypothetical protein                             61.2    2e-08   
ref|WP_030456258.1|  hypothetical protein                             57.8    2e-08   
ref|WP_003058767.1|  SyrP protein                                     60.8    2e-08   
gb|EAR21802.1|  syrP protein, putative                                61.2    2e-08   
ref|WP_010386720.1|  SyrP protein                                     60.8    2e-08   
ref|WP_003174653.1|  pyoverdine biosynthesis regulator                61.2    2e-08   
ref|WP_043467879.1|  SyrP                                             60.8    3e-08   
ref|WP_041189931.1|  hypothetical protein                             61.2    3e-08   
ref|WP_036013450.1|  SyrP                                             60.8    3e-08   
ref|WP_030210750.1|  SyrP                                             60.8    3e-08   
ref|WP_032862970.1|  SyrP                                             60.8    3e-08   
ref|WP_007637399.1|  clavaminate synthase-like protein At3g21360      60.8    3e-08   
gb|AHD04740.1|  taurine catabolism dioxygenase TauD/TfdA              58.9    3e-08   
ref|WP_038994534.1|  taurine catabolism dioxygenase TauD              60.8    3e-08   
ref|WP_003182645.1|  syrP protein                                     60.8    3e-08   
ref|WP_039806858.1|  SyrP                                             60.8    3e-08   
ref|WP_033278125.1|  MULTISPECIES: SyrP                               60.5    3e-08   
ref|WP_036264173.1|  taurine catabolism dioxygenase TauD              60.8    3e-08   
ref|WP_020741475.1|  hypothetical protein                             60.8    3e-08   



>ref|XP_011072435.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Sesamum 
indicum]
Length=328

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDPKKAVTFGDG PLP +II+DCL ILEEESVA+PW+KGDVLLIDN+AVLH+R+PF
Sbjct  257  EDARNDPKKAVTFGDGNPLPGDIIYDCLKILEEESVAIPWQKGDVLLIDNLAVLHSRRPF  316

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  317  TPPRRILASLCK  328



>ref|XP_009786567.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Nicotiana 
sylvestris]
Length=323

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG+PLPAE+IHDCL ILE+ESVA+PWKKGDVLLIDN+AVLH+RKPF
Sbjct  252  KDARNDPVKAVTFGDGQPLPAEVIHDCLRILEDESVAIPWKKGDVLLIDNLAVLHSRKPF  311

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  312  NPPRRILASLCK  323



>ref|XP_009606566.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Nicotiana 
tomentosiformis]
Length=323

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG+PLPAE+IHDCL ILE+ESV +PWKKGDVLLIDN+AVLH+RKPF
Sbjct  252  KDARNDPVKAVTFGDGQPLPAEVIHDCLRILEDESVTIPWKKGDVLLIDNLAVLHSRKPF  311

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  312  NPPRRILASLCK  323



>ref|XP_006343036.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Solanum 
tuberosum]
Length=323

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG+PLPAE++HDCL+ILE+ESVA+PWKKGDVLLIDN+AVLH+RK F
Sbjct  252  KDARNDPVKAVTFGDGQPLPAEVVHDCLSILEDESVAIPWKKGDVLLIDNLAVLHSRKSF  311

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  312  NPPRRVLASLCK  323



>gb|KFK39444.1| hypothetical protein AALP_AA3G245700 [Arabis alpina]
Length=325

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+KAVTFGDGKPLPA+I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  254  EDKRNDPRKAVTFGDGKPLPADIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  313

Query  185  LPPRRVLASLCK  220
            +PPRRVLASLCK
Sbjct  314  VPPRRVLASLCK  325



>ref|XP_009353541.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Pyrus 
x bretschneideri]
Length=324

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+IIHDCL ILEEESVA PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  EDARNDPVKAVTFGDGSPLPADIIHDCLKILEEESVAFPWRKGDVLLLDNLAVLHSRKSF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  TPPRRVLASLCK  324



>ref|XP_009342539.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Pyrus 
x bretschneideri]
Length=324

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+IIHDCL ILEEESVA PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  EDARNDPVKAVTFGDGSPLPADIIHDCLKILEEESVAFPWRKGDVLLLDNLAVLHSRKSF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  TPPRRVLASLCK  324



>ref|XP_004236398.2| PREDICTED: clavaminate synthase-like protein At3g21360 [Solanum 
lycopersicum]
Length=323

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DA+NDP KAVTFGDG+PLPAE++HDCL+ILE+ESVA+PWKKGDVLLIDN+AVLH+RK F
Sbjct  252  KDAKNDPVKAVTFGDGQPLPAEVVHDCLSILEDESVAIPWKKGDVLLIDNLAVLHSRKSF  311

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  312  NPPRRVLASLCK  323



>ref|XP_010510157.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Camelina 
sativa]
Length=331

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA+I+HDCL +LEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  260  EDKRNDPTKAVTFGDGKPLPADIVHDCLRVLEEECVAVPWQRGDVLLIDNWAVLHSRRPF  319

Query  185  LPPRRVLASLCK  220
            +PPRRVLASLCK
Sbjct  320  VPPRRVLASLCK  331



>ref|XP_006298007.1| hypothetical protein CARUB_v10014052mg [Capsella rubella]
 gb|EOA30905.1| hypothetical protein CARUB_v10014052mg [Capsella rubella]
Length=357

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA+I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  286  EDKRNDPTKAVTFGDGKPLPADIVHDCLKILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  345

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  346  DPPRRVLASLCK  357



>ref|XP_007215671.1| hypothetical protein PRUPE_ppa008628mg [Prunus persica]
 gb|EMJ16870.1| hypothetical protein PRUPE_ppa008628mg [Prunus persica]
Length=324

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPAE I+DCL +LEEESVA+PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  EDARNDPVKAVTFGDGSPLPAETIYDCLKVLEEESVAIPWRKGDVLLLDNLAVLHSRKSF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  SPPRRVLASLCK  324



>ref|NP_188773.1| clavaminate synthase-like protein [Arabidopsis thaliana]
 sp|Q9LIG0.1|Y3136_ARATH RecName: Full=Clavaminate synthase-like protein At3g21360 [Arabidopsis 
thaliana]
 pdb|1Y0Z|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At3g21360
 pdb|1Y0Z|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At3g21360
 pdb|2Q4A|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At3g21360
 pdb|2Q4A|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At3g21360
 dbj|BAB03049.1| syringomycin biosynthesis enzyme-like protein [Arabidopsis thaliana]
 dbj|BAC42419.1| unknown protein [Arabidopsis thaliana]
 gb|ACB88834.1| At3g21360 [Arabidopsis thaliana]
 gb|AEE76500.1| clavaminate synthase-like protein [Arabidopsis thaliana]
Length=330

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+KAVTFGDGKPLPA+I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  259  EDKRNDPRKAVTFGDGKPLPADIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  318

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  319  DPPRRVLASLCK  330



>ref|XP_008348492.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=324

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+IIHDCL ILEEES A PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  ZDARNDPVKAVTFGDGSPLPADIIHDCLKILEEESXAFPWRKGDVLLLDNLAVLHSRKXF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  TPPRRVLASLCK  324



>ref|XP_010033835.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Eucalyptus 
grandis]
 gb|KCW53672.1| hypothetical protein EUGRSUZ_J02936 [Eucalyptus grandis]
Length=327

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLP ++IHDCL ILEEESVA+PWKKGDVLL+DN+AVLH+R+ F
Sbjct  256  EDARNDPVKAVTFGDGSPLPGDVIHDCLKILEEESVAIPWKKGDVLLVDNLAVLHSRRSF  315

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  316  DPPRRVLASLCK  327



>ref|XP_007024316.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY26938.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=329

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA+II+DCL ILEEE VA+PWKKGDVLLIDN AVLH+R+PF
Sbjct  258  EDERNDPVKAVTFGDGKPLPADIIYDCLKILEEECVAIPWKKGDVLLIDNWAVLHSRRPF  317

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  318  DPPRRVLASLCK  329



>ref|XP_004141667.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Cucumis 
sativus]
 gb|KGN45579.1| hypothetical protein Csa_7G452340 [Cucumis sativus]
Length=324

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+II+ CL ILEEESVA+PW+KGD+LLIDN AVLH+R+PF
Sbjct  253  EDARNDPVKAVTFGDGTPLPADIIYGCLRILEEESVAIPWQKGDILLIDNWAVLHSRRPF  312

Query  185  LPPRRVLASLCK  220
            LPPRR+LASLC+
Sbjct  313  LPPRRILASLCR  324



>ref|XP_002883301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59560.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+KAVTFGDGKPLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  259  EDKRNDPRKAVTFGDGKPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  318

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  319  EPPRRVLASLCK  330



>ref|XP_008462414.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Cucumis 
melo]
Length=324

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+I++ CL ILEEESVA+PW+KGD+LLIDN AVLH+R+PF
Sbjct  253  EDARNDPVKAVTFGDGTPLPADIVYGCLRILEEESVAIPWQKGDILLIDNWAVLHSRRPF  312

Query  185  LPPRRVLASLCK  220
            LPPRR+LASLC+
Sbjct  313  LPPRRILASLCR  324



>ref|XP_008228422.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Prunus 
mume]
Length=324

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA  IHDCL +LEEESVA+PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  EDARNDPVKAVTFGDGSPLPAVTIHDCLKVLEEESVAIPWRKGDVLLLDNLAVLHSRKSF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  SPPRRVLASLCK  324



>emb|CDO97972.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA II+DCL IL+EESVA+PW+KGDVLLIDN+AVLH+R+PF
Sbjct  259  EDKRNDPVKAVTFGDGKPLPAHIIYDCLRILDEESVAIPWQKGDVLLIDNLAVLHSRRPF  318

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  319  NPPRRILASLCK  330



>ref|XP_006406277.1| hypothetical protein EUTSA_v10021117mg [Eutrema salsugineum]
 gb|ESQ47730.1| hypothetical protein EUTSA_v10021117mg [Eutrema salsugineum]
Length=329

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+KAVTFGDGKPLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  258  EDKRNDPRKAVTFGDGKPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  317

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  318  DPPRRVLASLCK  329



>ref|XP_010466377.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Camelina 
sativa]
Length=331

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA+I+HDCL +LEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  260  EDKRNDPTKAVTFGDGKPLPADIVHDCLRVLEEECVAVPWQRGDVLLIDNWAVLHSRRPF  319

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  320  DPPRRVLASLCK  331



>ref|XP_010488150.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Camelina 
sativa]
Length=331

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDGKPLPA+I+HDCL +LEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  260  EDKRNDPTKAVTFGDGKPLPADIVHDCLRVLEEECVAVPWQRGDVLLIDNWAVLHSRRPF  319

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  320  DPPRRVLASLCK  331



>ref|XP_002298245.1| hypothetical protein POPTR_0001s19100g [Populus trichocarpa]
 gb|EEE83050.1| hypothetical protein POPTR_0001s19100g [Populus trichocarpa]
Length=327

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG+PLP +IIHDCL ILEEES+A+PW+KGDVLLIDN AVLHAR+ F
Sbjct  256  KDARNDPVKAVTFGDGQPLPGDIIHDCLKILEEESLAIPWQKGDVLLIDNWAVLHARRSF  315

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  316  NPPRRVLASLCK  327



>ref|XP_011008104.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Populus 
euphratica]
Length=327

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG+PLP +IIHDCL ILEEES+A+PW+KGDVLLIDN AVLHAR+ F
Sbjct  256  KDARNDPVKAVTFGDGEPLPGDIIHDCLKILEEESLAIPWQKGDVLLIDNWAVLHARRSF  315

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  316  NPPRRVLASLCK  327



>ref|XP_008365701.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=324

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+IIHDCL ILEEES A PW KGDVLL+DN+AVLH+RK F
Sbjct  253  ZDARNDPVKAVTFGDGSPLPADIIHDCLKILEEESXAXPWXKGDVLLLDNLAVLHSRKXF  312

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  313  TPPRRVLASLCK  324



>ref|XP_010535192.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Tarenaya 
hassleriana]
Length=326

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDPKKA+TFGDG+PLP +I+HDCL ILEEE VA+PW+KGDVLLIDN+AVLH+R+ F
Sbjct  255  KDARNDPKKAITFGDGQPLPEDIVHDCLGILEEECVAIPWQKGDVLLIDNLAVLHSRRSF  314

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  315  DPPRRVLASLCK  326



>ref|XP_010098147.1| Clavaminate synthase-like protein [Morus notabilis]
 gb|EXB74584.1| Clavaminate synthase-like protein [Morus notabilis]
Length=325

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFG+G PLP +IIHDCL ILEEESVA+PWKKGDVLLI+N+A LH+R+ F
Sbjct  254  EDARNDPIKAVTFGNGTPLPGDIIHDCLRILEEESVAIPWKKGDVLLINNLAALHSRRSF  313

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  314  TPPRRVLASLCK  325



>ref|XP_002515961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46381.1| conserved hypothetical protein [Ricinus communis]
Length=322

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFGDGKPLP +II+DCL ILEEES+A+PW+KGD+LLIDN AVLHARK F
Sbjct  251  KDMRNDPVKAVTFGDGKPLPGDIIYDCLKILEEESIAIPWQKGDILLIDNWAVLHARKSF  310

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  311  TPPRRVLASLCK  322



>emb|CDY51445.1| BnaA05g36620D [Brassica napus]
Length=324

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RN+P+KAVTFGDG+PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  253  EDKRNEPRKAVTFGDGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  312

Query  185  LPPRRVLASLCK  220
            +PPRRVLASLCK
Sbjct  313  VPPRRVLASLCK  324



>ref|XP_002283642.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Vitis 
vinifera]
Length=325

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+II+DCL ILEEE VAVPW+KGDVLL+DN AVLH+R+PF
Sbjct  254  EDARNDPVKAVTFGDGLPLPADIIYDCLKILEEECVAVPWQKGDVLLLDNWAVLHSRRPF  313

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  314  DPPRRVLASLCK  325



>emb|CBI36054.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+II+DCL ILEEE VAVPW+KGDVLL+DN AVLH+R+PF
Sbjct  284  EDARNDPVKAVTFGDGLPLPADIIYDCLKILEEECVAVPWQKGDVLLLDNWAVLHSRRPF  343

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  344  DPPRRVLASLCK  355



>ref|XP_010665891.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDG+PLPA+I++DCL ILEEESVA+PWKKGDVLL+DN AVLH+R+ F
Sbjct  256  EDERNDPVKAVTFGDGRPLPADIVYDCLNILEEESVAIPWKKGDVLLLDNWAVLHSRRSF  315

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  316  DPPRRVLASLCK  327



>ref|XP_009145480.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Brassica 
rapa]
Length=324

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RN+P+KAVTFGDG+PLP +I+HDCL ILEEE VAVPW+ GDVLLIDN AVLH+R+PF
Sbjct  253  EDKRNEPRKAVTFGDGEPLPEDIVHDCLRILEEECVAVPWQSGDVLLIDNWAVLHSRRPF  312

Query  185  LPPRRVLASLCK  220
            +PPRRVLASLCK
Sbjct  313  VPPRRVLASLCK  324



>ref|XP_006465698.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Citrus 
sinensis]
Length=374

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFG+GKPLPA+I+HDCL ILEEESVA+PW+KGDVLLIDN AVLHAR+ F
Sbjct  303  KDDRNDPVKAVTFGNGKPLPADIVHDCLNILEEESVAIPWQKGDVLLIDNWAVLHARRSF  362

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  363  NPPRRILASLCK  374



>ref|XP_006426873.1| hypothetical protein CICLE_v10025881mg [Citrus clementina]
 gb|ESR40113.1| hypothetical protein CICLE_v10025881mg [Citrus clementina]
Length=374

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFG+GKPLPA+I+HDCL ILEEESVA+PW+KGDVLLIDN AVLHAR+ F
Sbjct  303  KDDRNDPVKAVTFGNGKPLPADIVHDCLNILEEESVAIPWQKGDVLLIDNWAVLHARRSF  362

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  363  NPPRRILASLCK  374



>gb|KDP40857.1| hypothetical protein JCGZ_24856 [Jatropha curcas]
Length=326

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDGKPLP +II+DCL ILE+ESVA+PW+KGD LLIDN AVLHARKPF
Sbjct  255  EDARNDPVKAVTFGDGKPLPGDIIYDCLKILEDESVAIPWQKGDFLLIDNWAVLHARKPF  314

Query  185  LPPRRVLASLCK  220
              PRRVLASLCK
Sbjct  315  NLPRRVLASLCK  326



>gb|KDO51792.1| hypothetical protein CISIN_1g019661mg [Citrus sinensis]
Length=337

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFG+GKPLPA+I+HDCL ILEEESVA+PW+KGDVLLIDN AVLHAR+ F
Sbjct  266  KDDRNDPVKAVTFGNGKPLPADIVHDCLNILEEESVAIPWQKGDVLLIDNWAVLHARRSF  325

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  326  NPPRRILASLCK  337



>gb|KDO51793.1| hypothetical protein CISIN_1g019661mg [Citrus sinensis]
Length=330

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFG+GKPLPA+I+HDCL ILEEESVA+PW+KGDVLLIDN AVLHAR+ F
Sbjct  259  KDDRNDPVKAVTFGNGKPLPADIVHDCLNILEEESVAIPWQKGDVLLIDNWAVLHARRSF  318

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  319  NPPRRILASLCK  330



>emb|CDY55285.1| BnaC05g51790D [Brassica napus]
Length=324

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP+KA TFGDG+PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  253  DDKRNDPRKAATFGDGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  312

Query  185  LPPRRVLASLCK  220
            +PPRRVLASLCK
Sbjct  313  VPPRRVLASLCK  324



>gb|KHG05955.1| hypothetical protein F383_32718 [Gossypium arboreum]
Length=329

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG+PLPA+II+DCL ILE+E V +PWKKGDV+LIDN+A LH+R+PF
Sbjct  258  EDARNDPVKAVTFGDGQPLPADIIYDCLKILEDECVPIPWKKGDVMLIDNLATLHSRRPF  317

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  318  DPPRRVLASLCK  329



>gb|KJB68188.1| hypothetical protein B456_010G231000 [Gossypium raimondii]
Length=171

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED+RNDP KAVTFGDG+PLPA+II+DCL ILE+E V +PWKKGDV+LIDN+A LH+R+ F
Sbjct  100  EDSRNDPVKAVTFGDGQPLPADIIYDCLKILEDECVPIPWKKGDVMLIDNLATLHSRRSF  159

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  160  DPPRRVLASLCK  171



>gb|EYU21517.1| hypothetical protein MIMGU_mgv1a009800mg [Erythranthe guttata]
Length=331

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDPKKAVTFGDG  LP  I++DCL ILE+ESVA+PW+KGDVLLIDN+AVLH+RKPF
Sbjct  260  EDKRNDPKKAVTFGDGNVLPDNIMYDCLKILEDESVAIPWRKGDVLLIDNLAVLHSRKPF  319

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  320  TPPRRILASLCK  331



>ref|XP_009383473.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Musa 
acuminata subsp. malaccensis]
Length=326

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAVTFGDG PLPA+IIH+CL ILEEESVA+ WKKGD+LL+DN+AVLH+R+ F
Sbjct  255  EDARNDPVKAVTFGDGTPLPADIIHECLNILEEESVAIGWKKGDILLLDNLAVLHSRRSF  314

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  315  DPPRRILASLCK  326



>ref|XP_008387431.1| PREDICTED: LOW QUALITY PROTEIN: clavaminate synthase-like protein 
At3g21360 [Malus domestica]
Length=252

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+IIHDCL +LEEESVA PW +GDVL++DN+AVLH+RK F
Sbjct  181  KDARNDPVKAVTFGDGSPLPADIIHDCLKVLEEESVAFPWSRGDVLVLDNLAVLHSRKSF  240

Query  185  LPPRRVLASLCK  220
              PRRVLASLCK
Sbjct  241  AQPRRVLASLCK  252



>ref|XP_004302856.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I+DCL ILEEESVA+PW+KGDVLL+DN+AVLH+RK F
Sbjct  253  KDARNDPLKAVTFGDGNPLPADVIYDCLKILEEESVAIPWQKGDVLLLDNLAVLHSRKSF  312

Query  185  LPPRRVLASLCK  220
              PRRVLASLCK
Sbjct  313  SLPRRVLASLCK  324



>ref|XP_008789286.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Phoenix 
dactylifera]
 ref|XP_008789292.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Phoenix 
dactylifera]
 ref|XP_008789300.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Phoenix 
dactylifera]
Length=327

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPAEII +CL +LEEESVA+PWKKGD+LL+DN+AVLH+R+ F
Sbjct  256  KDARNDPVKAVTFGDGTPLPAEIIDECLKVLEEESVAIPWKKGDILLLDNLAVLHSRRSF  315

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  316  DPPRRILASLCK  327



>ref|XP_010915385.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Elaeis 
guineensis]
Length=327

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+II +CL ILEEESVA+PWK+GD+LL+DN+AVLH+R+ F
Sbjct  256  KDARNDPVKAVTFGDGTPLPADIIDECLKILEEESVAIPWKRGDILLLDNLAVLHSRRSF  315

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  316  DPPRRILASLCK  327



>gb|EPS60476.1| hypothetical protein M569_14325, partial [Genlisea aurea]
Length=319

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D RNDP KAVTFGDG PLPA  ++DCL ILEEESVA+PW+KGDVLL+DN+A LH+RKP+ 
Sbjct  250  DKRNDPTKAVTFGDGTPLPATAVYDCLKILEEESVAIPWEKGDVLLVDNLAALHSRKPYT  309

Query  188  PPRRVLASLC  217
            PPRR+LASLC
Sbjct  310  PPRRILASLC  319



>ref|XP_004486787.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Cicer 
arietinum]
Length=329

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFGDG PLPA++I+DCL ILEEESVA+PW+KGDV+L+DN AVLH+R+PF
Sbjct  258  KDERNDPVKAVTFGDGNPLPADVIYDCLNILEEESVAIPWRKGDVMLLDNWAVLHSRRPF  317

Query  185  LPPRRVLASLCK  220
             PPRRVLASL K
Sbjct  318  DPPRRVLASLVK  329



>ref|XP_010267146.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Nelumbo 
nucifera]
Length=325

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP+KAVTFGDG PLPA+II+DCL IL+EE VA+PW KGDVLL+DN+AVLH+R+ F
Sbjct  254  KDARNDPEKAVTFGDGTPLPADIIYDCLRILDEECVAIPWHKGDVLLLDNLAVLHSRRSF  313

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  314  DPPRRILASLCK  325



>ref|XP_003597673.1| Clavaminate synthase-like protein [Medicago truncatula]
 gb|AES67924.1| clavaminate synthase-like plant protein [Medicago truncatula]
Length=325

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFGDG PLPA++++DCL ILEEESVA+PW+KGDV+L+DN AVLH+R+PF
Sbjct  254  KDERNDPVKAVTFGDGSPLPADVVYDCLNILEEESVAIPWRKGDVMLLDNWAVLHSRRPF  313

Query  185  LPPRRVLASLCK  220
             PPRRVLASL K
Sbjct  314  DPPRRVLASLVK  325



>ref|XP_007150604.1| hypothetical protein PHAVU_005G166000g [Phaseolus vulgaris]
 gb|ESW22598.1| hypothetical protein PHAVU_005G166000g [Phaseolus vulgaris]
Length=320

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP KAVTFGDG+PLP +I++DCL ILEEESVA+PW+KGDVLLIDN AVLH+R+ F
Sbjct  249  KDERNDPVKAVTFGDGEPLPPDIVYDCLQILEEESVAIPWQKGDVLLIDNWAVLHSRRSF  308

Query  185  LPPRRVLASLCK  220
             PPRRVLASL K
Sbjct  309  HPPRRVLASLVK  320



>ref|XP_006853694.1| hypothetical protein AMTR_s00056p00140230 [Amborella trichopoda]
 gb|ERN15161.1| hypothetical protein AMTR_s00056p00140230 [Amborella trichopoda]
Length=330

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RNDP KAVTFGDG PLPA+II +CL ILEEESV +PW+KGDV+L+DN+AVLH+R+PF
Sbjct  259  KDSRNDPVKAVTFGDGAPLPADIILECLKILEEESVVIPWQKGDVILVDNLAVLHSRRPF  318

Query  185  LPPRRVLASLCK  220
             PPRR+L S+CK
Sbjct  319  EPPRRILVSICK  330



>emb|CDM81749.1| unnamed protein product [Triticum aestivum]
Length=334

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I +C  ILEEE VAVPW++GD+LLIDN AVLH+R+ F
Sbjct  263  KDARNDPVKAVTFGDGSPLPADVIEECGKILEEECVAVPWQQGDILLIDNWAVLHSRRSF  322

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  323  EPPRRVLASLCK  334



>ref|NP_001240991.1| uncharacterized protein LOC100797326 [Glycine max]
 gb|ACU18137.1| unknown [Glycine max]
Length=323

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP KAVTFGDG PLP  I++DCL ILE+ESVA+PW+KGD+LLIDN AVLH+R+ F
Sbjct  252  EDERNDPVKAVTFGDGLPLPFHIVYDCLHILEDESVAIPWQKGDILLIDNWAVLHSRRSF  311

Query  185  LPPRRVLASLCK  220
             PPRRVLASL K
Sbjct  312  DPPRRVLASLVK  323



>ref|NP_001140643.1| hypothetical protein [Zea mays]
 gb|ACF84242.1| unknown [Zea mays]
 tpg|DAA53051.1| TPA: hypothetical protein ZEAMMB73_785040 [Zea mays]
Length=171

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+++  C  +LEEE VAVPW++GD+LL+DN AVLH+R+ F
Sbjct  100  KDARNDPVKAVTFGDGSPLPADVVAACGRVLEEECVAVPWRRGDILLLDNWAVLHSRRSF  159

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  160  EPPRRILASLCK  171



>ref|XP_006645588.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Oryza 
brachyantha]
Length=294

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I  C  ILEEE VAVPW++GD+LLIDN AVLH+R+ F
Sbjct  223  KDARNDPVKAVTFGDGSPLPADVIAGCGEILEEECVAVPWRRGDILLIDNWAVLHSRRSF  282

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  283  EPPRRILASLCK  294



>ref|XP_004968463.1| PREDICTED: clavaminate synthase-like protein At3g21360-like isoform 
X1 [Setaria italica]
 ref|XP_004968464.1| PREDICTED: clavaminate synthase-like protein At3g21360-like isoform 
X2 [Setaria italica]
 ref|XP_004968465.1| PREDICTED: clavaminate synthase-like protein At3g21360-like isoform 
X3 [Setaria italica]
 ref|XP_004968466.1| PREDICTED: clavaminate synthase-like protein At3g21360-like isoform 
X4 [Setaria italica]
Length=328

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I +C  ILEEE VAVPW+ GD+LLIDN AVLH+R+ F
Sbjct  257  KDARNDPVKAVTFGDGSPLPADVIAECGKILEEECVAVPWQHGDILLIDNWAVLHSRRSF  316

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  317  EPPRRVLASLCK  328



>gb|EEE54029.1| hypothetical protein OsJ_00697 [Oryza sativa Japonica Group]
Length=252

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP +AVTFGDG PLPA++I  C  ILEEE VAVPW++GD+LLIDN AVLH+R+ F
Sbjct  181  KDARNDPVRAVTFGDGSPLPADVIAGCGEILEEECVAVPWRQGDILLIDNWAVLHSRRSF  240

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  241  EPPRRILASLCK  252



>ref|XP_003564672.2| PREDICTED: clavaminate synthase-like protein At3g21360 [Brachypodium 
distachyon]
Length=387

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I +C  ILEEE VA+PW++GD+LLIDN AVLH+R+ F
Sbjct  316  KDARNDPVKAVTFGDGSPLPADVIGECGKILEEECVAIPWQQGDILLIDNWAVLHSRRSF  375

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  376  EPPRRVLASLCK  387



>ref|NP_001146576.1| hypothetical protein [Zea mays]
 gb|ACL54316.1| unknown [Zea mays]
 tpg|DAA53055.1| TPA: hypothetical protein ZEAMMB73_080852 [Zea mays]
Length=328

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I  C  +LEEESVAVPW+ GD+LLIDN AVLH+R+ F
Sbjct  257  KDARNDPMKAVTFGDGSPLPADVIDACGQVLEEESVAVPWQHGDILLIDNWAVLHSRRSF  316

Query  185  LPPRRVLASLCK  220
             PPRR+LAS+CK
Sbjct  317  EPPRRILASICK  328



>gb|EEC70089.1| hypothetical protein OsI_00718 [Oryza sativa Indica Group]
Length=332

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP +AVTFGDG PLPA++I  C  ILEEE VAVPW++GD+LLIDN AVLH+R+ F
Sbjct  261  KDARNDPVRAVTFGDGSPLPADVIAGCGEILEEECVAVPWRQGDILLIDNWAVLHSRRSF  320

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  321  EPPRRILASLCK  332



>ref|NP_001042262.1| Os01g0190000 [Oryza sativa Japonica Group]
 dbj|BAD72217.1| syringomycin biosynthesis enzyme -like [Oryza sativa Japonica 
Group]
 dbj|BAF04176.1| Os01g0190000 [Oryza sativa Japonica Group]
Length=335

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP +AVTFGDG PLPA++I  C  ILEEE VAVPW++GD+LLIDN AVLH+R+ F
Sbjct  261  KDARNDPVRAVTFGDGSPLPADVIAGCGEILEEECVAVPWRQGDILLIDNWAVLHSRRSF  320

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  321  EPPRRILASLCK  332



>ref|XP_009352919.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Pyrus 
x bretschneideri]
Length=325

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    REDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKP  181
            + DARN+P+KAVTFGDG PL A+II+DC  ILE ESVA+PW+KGDVLL+DN+AVLH+R P
Sbjct  253  KGDARNEPEKAVTFGDGSPLAADIIYDCQKILEVESVAIPWRKGDVLLLDNLAVLHSRNP  312

Query  182  FLPPRRVLASLCK  220
               PRRVLA+LCK
Sbjct  313  CATPRRVLAALCK  325



>ref|XP_002457202.1| hypothetical protein SORBIDRAFT_03g003210 [Sorghum bicolor]
 gb|EES02322.1| hypothetical protein SORBIDRAFT_03g003210 [Sorghum bicolor]
Length=328

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA++I  C  +LEEE VAVPW+ GD+LLIDN AVLH+R+ F
Sbjct  257  KDARNDPVKAVTFGDGSPLPADVIAACGQVLEEECVAVPWRHGDILLIDNWAVLHSRRSF  316

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  317  EPPRRILASLCK  328



>ref|XP_008672371.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG24567.1| syringomycin biosynthesis enzyme [Zea mays]
 gb|ACN28241.1| unknown [Zea mays]
 gb|ACN29166.1| unknown [Zea mays]
 tpg|DAA53052.1| TPA: Syringomycin biosynthesis enzyme [Zea mays]
Length=325

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP KAVTFGDG PLPA+++  C  +LEEE VAVPW++GD+LL+DN AVLH+R+ F
Sbjct  254  KDARNDPVKAVTFGDGSPLPADVVAACGRVLEEECVAVPWRRGDILLLDNWAVLHSRRSF  313

Query  185  LPPRRVLASLCK  220
             PPRR+LASLCK
Sbjct  314  EPPRRILASLCK  325



>ref|XP_008383739.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=325

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +2

Query  2    REDARN-DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARK  178
            ++DARN DP+KA+ FGDG PL A++I+DC  ILE+ESVA+PW+KGDVLL+DNMAVLH+R 
Sbjct  252  KDDARNSDPEKALAFGDGSPLAADVIYDCQKILEDESVAIPWRKGDVLLLDNMAVLHSRN  311

Query  179  PFLPPRRVLASLCK  220
            P   PRRVLASLCK
Sbjct  312  PCTTPRRVLASLCK  325



>ref|XP_006465697.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Citrus 
sinensis]
Length=323

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D +NDP KAVTFG+G PLP +I++DC+ ILEEE VA+PW+ GDVLLIDN+AVLHAR+  
Sbjct  252  KDTQNDPVKAVTFGNGSPLPEDIVYDCMKILEEECVAIPWQNGDVLLIDNLAVLHARRSS  311

Query  185  LPPRRVLASLCK  220
              PR +LASLCK
Sbjct  312  SRPRHILASLCK  323



>ref|XP_001778974.1| predicted protein [Physcomitrella patens]
 gb|EDQ56229.1| predicted protein [Physcomitrella patens]
Length=328

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARNDP KAV FGDG PLP E +  CL IL EESV++PW+ GDVL++DN+AV HARK F
Sbjct  257  EDARNDPLKAVKFGDGTPLPKEAVMACLDILTEESVSIPWRHGDVLVLDNIAVQHARKSF  316

Query  185  LPPRRVLASLCK  220
             PPRRVLASL K
Sbjct  317  APPRRVLASLAK  328



>ref|XP_002968731.1| hypothetical protein SELMODRAFT_90998 [Selaginella moellendorffii]
 ref|XP_002990619.1| hypothetical protein SELMODRAFT_131940 [Selaginella moellendorffii]
 gb|EFJ08251.1| hypothetical protein SELMODRAFT_131940 [Selaginella moellendorffii]
 gb|EFJ29847.1| hypothetical protein SELMODRAFT_90998 [Selaginella moellendorffii]
Length=326

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            EDARN  ++AV FGDG PLP   + +CL I+ E SVA+PW +GDVLLIDN+AVLHAR+PF
Sbjct  255  EDARNVAERAVVFGDGSPLPRAAVLECLDIIHELSVAIPWCRGDVLLIDNLAVLHARRPF  314

Query  185  LPPRRVLASLCK  220
             PPRRVLASLCK
Sbjct  315  TPPRRVLASLCK  326



>emb|CDX88947.1| BnaA04g02390D [Brassica napus]
 emb|CDX83808.1| BnaC08g18370D [Brassica napus]
Length=289

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+K VTFGDG+PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  208  EDKRNDPRKTVTFGDGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  267



>emb|CDX88855.1| BnaA03g07940D [Brassica napus]
Length=295

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 13/83 (16%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+K VTFGDG+PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  208  EDKRNDPRKTVTFGDGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  267

Query  185  -------------LPPRRVLASL  214
                         +P +R++A++
Sbjct  268  ESISEQATTSFYTIPTQRLMAAI  290



>emb|CDY70280.1| BnaAnng33200D, partial [Brassica napus]
Length=334

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+K VTFGDG+PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  233  EDKRNDPRKTVTFGDGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  292



>emb|CBI36055.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    REDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKP  181
            ++   ND +K V+FG+G+ LP +I+ DCL IL EE VA PW+KGDVLLIDN A LH+R+P
Sbjct  136  KDKGMNDSEKTVSFGNGEALPDDIVEDCLKILHEECVAFPWQKGDVLLIDNWAALHSRRP  195

Query  182  FLPPRRVLASLCK  220
            + PPR +LASLCK
Sbjct  196  YTPPRNILASLCK  208



>ref|XP_002445051.1| hypothetical protein SORBIDRAFT_07g003385 [Sorghum bicolor]
 gb|EES14546.1| hypothetical protein SORBIDRAFT_07g003385 [Sorghum bicolor]
Length=317

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARN P   V FGDG PLPA++I +C  ILEEE VA+PW++GD+LLIDN AVLH R+P 
Sbjct  246  KDARNGPVNTVMFGDGSPLPADVIDECGKILEEECVAIPWQQGDILLIDNWAVLHGRRPS  305

Query  185  LPPRRVLASLCK  220
              PRR+LASLCK
Sbjct  306  KSPRRILASLCK  317



>gb|EPS67856.1| hypothetical protein M569_06917, partial [Genlisea aurea]
Length=309

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + +TFGDG P+P E++ DC+ +L+EESVA+PW+KGDVLL+DN+AVLHAR PF PPRR
Sbjct  244  DLSEMLTFGDGTPMPIEVVRDCVKLLDEESVALPWEKGDVLLVDNLAVLHARNPFTPPRR  303

Query  200  VLASLC  217
            +LASLC
Sbjct  304  ILASLC  309



>ref|XP_009112100.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Brassica 
rapa]
Length=252

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+K VTFGD +PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  171  EDKRNDPRKTVTFGDWEPLPKDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  230



>ref|XP_009123824.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Brassica 
rapa]
Length=271

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            ED RNDP+K VTFGD +PLP +I+HDCL ILEEE VAVPW++GDVLLIDN AVLH+R+PF
Sbjct  190  EDKRNDPRKTVTFGDWEPLPKDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPF  249



>gb|KDO36029.1| hypothetical protein CISIN_1g020626mg [Citrus sinensis]
Length=267

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D +NDP KAVTFG+G P P +I+++ + ILEEE VA+PW+ GDVLLIDN+AVLHAR+  
Sbjct  196  KDTQNDPVKAVTFGNGSPYPEDIVYNLMKILEEECVAIPWQNGDVLLIDNLAVLHARRSS  255

Query  185  LPPRRVLASLCK  220
              PR +LASLCK
Sbjct  256  SRPRHILASLCK  267



>ref|XP_002283654.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Vitis 
vinifera]
Length=326

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    REDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKP  181
            ++   ND +K V+FG+G+ LP +I+ DCL IL EE VA PW+KGDVLLIDN A LH+R+P
Sbjct  254  KDKGMNDSEKTVSFGNGEALPDDIVEDCLKILHEECVAFPWQKGDVLLIDNWAALHSRRP  313

Query  182  FLPPRRVLASLCK  220
            + PPR +LASLCK
Sbjct  314  YTPPRNILASLCK  326



>gb|KDO36028.1| hypothetical protein CISIN_1g020626mg [Citrus sinensis]
Length=323

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D +NDP KAVTFG+G P P +I+++ + ILEEE VA+PW+ GDVLLIDN+AVLHAR+  
Sbjct  252  KDTQNDPVKAVTFGNGSPYPEDIVYNLMKILEEECVAIPWQNGDVLLIDNLAVLHARRSS  311

Query  185  LPPRRVLASLCK  220
              PR +LASLCK
Sbjct  312  SRPRHILASLCK  323



>ref|XP_006426874.1| hypothetical protein CICLE_v10026083mg [Citrus clementina]
 gb|ESR40114.1| hypothetical protein CICLE_v10026083mg [Citrus clementina]
Length=323

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D +NDP KAVTFG+G P P +I+++ + ILEEE VA+PW+ GDVLLIDN+AVLHAR+  
Sbjct  252  KDTQNDPVKAVTFGNGSPYPEDIVYNLMKILEEECVAIPWQNGDVLLIDNLAVLHARRSS  311

Query  185  LPPRRVLASLCK  220
              PR +LASLCK
Sbjct  312  SRPRHILASLCK  323



>gb|EPS67855.1| hypothetical protein M569_06916, partial [Genlisea aurea]
Length=312

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  K +TFGDG P+P  I+ D + ILEEESVA PW+KGDVL +DN+ VLHAR  F PPRR
Sbjct  247  DLSKMMTFGDGTPMPIGIVQDSIKILEEESVAFPWEKGDVLFVDNLTVLHARNSFTPPRR  306

Query  200  VLASLC  217
            +LASLC
Sbjct  307  ILASLC  312



>gb|EPS60477.1| hypothetical protein M569_14326 [Genlisea aurea]
Length=320

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  35   VTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            VTFGD  PLP   + DCL ++EEESVAVPW+KGDV+L+DN+A LHAR P++PPR V ASL
Sbjct  259  VTFGDDTPLPGIAVQDCLKMMEEESVAVPWEKGDVMLVDNLAALHARNPYVPPRSVWASL  318

Query  215  C  217
            C
Sbjct  319  C  319



>ref|XP_009065528.1| hypothetical protein LOTGIDRAFT_196958 [Lottia gigantea]
 gb|ESO83742.1| hypothetical protein LOTGIDRAFT_196958 [Lottia gigantea]
Length=331

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDP+ A+ FGDG+ +PA+++ +  A+L++ SV + W+KGDV ++DN  VLHAR+PF
Sbjct  260  KDCRNDPETAILFGDGEKMPADVMKNLTAMLDKLSVDITWQKGDVFMVDNRQVLHARRPF  319

Query  185  LPPRRVLASLCK  220
             PPR +LA+LCK
Sbjct  320  TPPRTILAALCK  331



>ref|XP_005706462.1| electron carrier/ oxidoreductase [Galdieria sulphuraria]
 gb|EME29942.1| electron carrier/ oxidoreductase [Galdieria sulphuraria]
Length=329

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RNDPKKAVTFGDG PLP+E +  C  ++ +  V+  WKKGDVL+I+N  V+HAR  F
Sbjct  258  KDKRNDPKKAVTFGDGTPLPSEDLQICSKVMHDICVSFRWKKGDVLMINNELVMHARNSF  317

Query  185  LPPRRVLASL  214
            +PPRR+LA L
Sbjct  318  VPPRRILACL  327



>ref|XP_006595473.1| PREDICTED: clavaminate synthase-like protein At3g21360-like, 
partial [Glycine max]
Length=138

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  35   VTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            V F  G+PLP+ I++DCL ILEEESVA+PW+KGDVLLIDN AVL++R+ F PP +V  SL
Sbjct  69   VNFKYGQPLPSHIVYDCLHILEEESVAIPWQKGDVLLIDNWAVLYSRRSFDPPCQVSLSL  128



>gb|EYU24122.1| hypothetical protein MIMGU_mgv1a0197361mg, partial [Erythranthe 
guttata]
Length=199

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  35   VTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            VT  DG  +P EI+  C  ILEEES+   W+KGDVL +DN A+LH R+P LPPR+VLA+L
Sbjct  138  VTMADGTEIPEEIVKRCSEILEEESIQFKWEKGDVLFLDNYALLHGRRPSLPPRKVLAAL  197

Query  215  CK  220
            CK
Sbjct  198  CK  199



>ref|XP_011442945.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Crassostrea 
gigas]
Length=337

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RN P+ ++TFGDG P+  +++     +L E +V   WKKGDV+++DN   LH R+ F
Sbjct  266  KDSRNSPETSITFGDGSPMDPKVMDVLENVLNELAVDFIWKKGDVVMVDNRQALHGRRSF  325

Query  185  LPPRRVLASLCK  220
            +PPRR+LA+LCK
Sbjct  326  VPPRRILAALCK  337



>ref|WP_011413713.1| SyrP protein [Erythrobacter litoralis]
 gb|ABC62837.1| syrP protein, putative [Erythrobacter litoralis HTCC2594]
Length=306

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D RNDP K+VTFGDG P+  E + + +A+ +E +  + W++GDV L+DN  V+H R+PF 
Sbjct  236  DRRNDPSKSVTFGDGTPITGEQMAEAIALADELTYDLAWQQGDVALVDNFLVMHGRRPFR  295

Query  188  PPRRVLASLCK  220
              RRVLASL  
Sbjct  296  GKRRVLASLIS  306



>gb|EKC43220.1| hypothetical protein CGI_10027319 [Crassostrea gigas]
Length=357

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RN P+ ++TFGDG P+  +++     +L E +V   WKKGDV+++DN   LH R+ F
Sbjct  286  KDSRNSPETSITFGDGSPMDPKVMDVLENVLNELAVDFIWKKGDVVMVDNRQALHGRRSF  345

Query  185  LPPRRVLASLCK  220
            +PPRR+LA+LCK
Sbjct  346  VPPRRILAALCK  357



>ref|WP_015245893.1| SyrP protein [Singulisphaera acidiphila]
 gb|AGA26741.1| putative taurine catabolism dioxygenase [Singulisphaera acidiphila 
DSM 18658]
Length=331

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RNDP K++TFGDG PL    +   +A+ EE +  +PW++GDV L+DN+  +H R+ F
Sbjct  257  KDSRNDPAKSITFGDGAPLDGTAVQVAIALAEELTFDIPWQQGDVALVDNLVAMHGRRTF  316

Query  185  LPPRRVLASL  214
              PR++LASL
Sbjct  317  SGPRKILASL  326



>gb|ETO13900.1| hypothetical protein RFI_23465 [Reticulomyxa filosa]
Length=385

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
             D+RN  ++AV FGDG P+  + I   + I+ + SVA+PW+ GDV+LIDN  V+H+RK F
Sbjct  314  NDSRNVAERAVIFGDGSPILPQDIQVLVQIMNDLSVAIPWQFGDVMLIDNKQVMHSRKAF  373

Query  185  LPPRRVLASLCK  220
             PPR + A+LCK
Sbjct  374  TPPRDIYAALCK  385



>ref|XP_008360163.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=109

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PAE+++ C  I+EEES+   W+KGDVL +DN+A+LH R+P L PRRVL + CK
Sbjct  52   DGTEIPAELVNRCEQIIEEESIQFKWEKGDVLFLDNLALLHGRRPSLAPRRVLVATCK  109



>ref|XP_003572155.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Brachypodium 
distachyon]
Length=340

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             +  F DG  +PA+ +  C  I+EEES+   W+KGDVL++DN+A LH R+P LPPRRVL 
Sbjct  271  SSAAFADGSEIPADFVKRCGEIIEEESIQFRWEKGDVLILDNLATLHGRRPSLPPRRVLV  330

Query  209  SLCK  220
            + CK
Sbjct  331  ATCK  334



>ref|XP_010044303.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Eucalyptus 
grandis]
Length=322

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  ILEEES+   W+KGDVL  DNMA+LH R+P LPPR+VLA+
Sbjct  260  SATMADGTEIPDHVVKRCGEILEEESIQFKWEKGDVLFFDNMALLHGRRPSLPPRKVLAA  319

Query  212  LCK  220
             CK
Sbjct  320  TCK  322



>gb|KCW86383.1| hypothetical protein EUGRSUZ_B03062 [Eucalyptus grandis]
Length=298

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  ILEEES+   W+KGDVL  DNMA+LH R+P LPPR+VLA+
Sbjct  236  SATMADGTEIPDHVVKRCGEILEEESIQFKWEKGDVLFFDNMALLHGRRPSLPPRKVLAA  295

Query  212  LCK  220
             CK
Sbjct  296  TCK  298



>gb|EPS67858.1| hypothetical protein M569_06919 [Genlisea aurea]
Length=101

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            D    VTFGDG PLP E + DC+  +EEES A+PW++GDV LI+N+A LH+R  F
Sbjct  35   DLSTGVTFGDGTPLPIEAVQDCVKFMEEESAALPWEQGDVFLIENLAALHSRNSF  89



>ref|XP_011008738.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Populus 
euphratica]
Length=321

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P   +  C  I+EEES+   W+KGDVL +DNMA+LH R+P LPPR+VL S
Sbjct  259  SATLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVS  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_002445444.1| hypothetical protein SORBIDRAFT_07g019340 [Sorghum bicolor]
 gb|EES14939.1| hypothetical protein SORBIDRAFT_07g019340 [Sorghum bicolor]
Length=323

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +PA+ +  C  I+EEES+   W+KGD+L++DN+A LH R+P LPPRRVL 
Sbjct  260  SSATLADGSEIPADFVRRCGEIIEEESIQFRWEKGDILILDNLATLHGRRPSLPPRRVLV  319

Query  209  SLCK  220
            + CK
Sbjct  320  ATCK  323



>gb|EMT27634.1| Clavaminate synthase-like protein [Aegilops tauschii]
Length=332

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + TF DG  +PA+ +  C  I+EEES+   W+KGDVL++DN+A LH R+P L PRRVL 
Sbjct  269  SSATFADGSEIPADFVRRCGEIIEEESIQFRWEKGDVLILDNLATLHGRRPSLAPRRVLV  328

Query  209  SLCK  220
            + CK
Sbjct  329  ATCK  332



>ref|XP_002974377.1| hypothetical protein SELMODRAFT_414524 [Selaginella moellendorffii]
 gb|EFJ24599.1| hypothetical protein SELMODRAFT_414524 [Selaginella moellendorffii]
Length=203

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
            +  ++FGDG PL  + +  C  I+EEE VA  W+KGDVL+IDN AVLHAR+P  PPR++L
Sbjct  138  EHGISFGDGTPLNEKFLAACKRIMEEEKVAFKWRKGDVLIIDNDAVLHAREPSRPPRKIL  197

Query  206  ASL  214
            A+L
Sbjct  198  AAL  200



>ref|XP_007222712.1| hypothetical protein PRUPE_ppa008704mg [Prunus persica]
 gb|EMJ23911.1| hypothetical protein PRUPE_ppa008704mg [Prunus persica]
Length=322

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PA +++ C  I+EEES+   W+KGDVL  DN+A+LH R+P LPPRRVL + CK
Sbjct  265  DGTEIPANVVNRCEQIIEEESIQFKWEKGDVLFFDNLALLHGRRPSLPPRRVLVATCK  322



>ref|XP_008243156.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Prunus 
mume]
Length=322

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PA +++ C  I+EEES+   W+KGDVL  DN+A+LH R+P LPPRRVL + CK
Sbjct  265  DGTEIPANVVNRCEQIIEEESIQFKWEKGDVLFFDNLALLHGRRPSLPPRRVLVATCK  322



>ref|WP_007165225.1| SyrP protein [Erythrobacter sp. NAP1]
 gb|EAQ28019.1| putative SyrP-like protein [Erythrobacter sp. NAP1]
Length=307

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RNDP + +TFGDG P+ +E +   +AI +E +  + W+ GDV L+DN  V+H R+PF 
Sbjct  237  DSRNDPNRTITFGDGSPITSEDMAPAIAIADELTHDLAWQAGDVALVDNFLVMHGRRPFE  296

Query  188  PPRRVLASLC  217
              RRVLASL 
Sbjct  297  GKRRVLASLV  306



>ref|XP_008678543.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Zea mays]
 gb|AFW62085.1| hypothetical protein ZEAMMB73_686767 [Zea mays]
Length=322

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +PA+ +  C  I+EEES+   W+KGD+L++DN+A LH R+P LPPR+VL 
Sbjct  259  SSATLADGSEIPADFVRRCGEIIEEESIQFRWEKGDILILDNLATLHGRRPSLPPRKVLV  318

Query  209  SLCK  220
            + CK
Sbjct  319  ATCK  322



>gb|EYU40851.1| hypothetical protein MIMGU_mgv1a018757mg [Erythranthe guttata]
Length=321

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +PA I+  C  I+E+ES+   W+KGDVL +DN A+LH R+P LPPR+VL +
Sbjct  259  SATMADGTEIPANIVRRCEEIIEDESIQFKWQKGDVLFLDNYALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_008389321.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=321

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PAE+++ C  I+EEES+   W+KGDVL +DN+A+LH R+P L PRRVL + CK
Sbjct  264  DGTEIPAELVNRCEQIIEEESIQFKWEKGDVLFLDNLALLHGRRPSLAPRRVLVATCK  321



>ref|XP_008351024.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Malus 
domestica]
Length=321

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PAE+++ C  I+EEES+   W+KGDVL +DN+A+LH R+P L PRRVL + CK
Sbjct  264  DGTEIPAELVNRCEQIIEEESIQFKWEKGDVLFLDNLALLHGRRPSLAPRRVLVATCK  321



>ref|XP_009336638.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Pyrus 
x bretschneideri]
Length=321

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PAE+++ C  I+EEES+   W+KGDVL +DN+A+LH R+P L PRRVL + CK
Sbjct  264  DGTEIPAELVNRCEQIIEEESIQFKWEKGDVLFLDNLALLHGRRPSLAPRRVLVATCK  321



>ref|XP_002324809.2| hypothetical protein POPTR_0018s00590g, partial [Populus trichocarpa]
 gb|EEF03374.2| hypothetical protein POPTR_0018s00590g, partial [Populus trichocarpa]
Length=53

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLP  190
            FGDGKPL  +IIHDCL ILEEES+A+PW+KGDVLLIDN A LH     +P
Sbjct  3    FGDGKPLSGDIIHDCLKILEEESLAIPWQKGDVLLIDNWA-LHLATSTIP  51



>ref|XP_002990802.1| hypothetical protein SELMODRAFT_448192 [Selaginella moellendorffii]
 gb|EFJ08075.1| hypothetical protein SELMODRAFT_448192 [Selaginella moellendorffii]
Length=338

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
            +  ++FGDG PL  + +  C  I+EEE VA  W+KGDVL+IDN AVLHAR+P  PPR++L
Sbjct  273  EHGISFGDGTPLNEKFLAACNRIMEEEKVAFKWRKGDVLIIDNDAVLHAREPSKPPRKIL  332

Query  206  ASLC  217
            ++L 
Sbjct  333  SALA  336



>ref|XP_010044302.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Eucalyptus 
grandis]
Length=322

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  IL+EES+   W+KGDVL  DNMA+LH R+P LPPR+VL +
Sbjct  260  SATMADGTEIPDHVVKRCGEILDEESIQFKWEKGDVLFFDNMALLHGRRPSLPPRKVLVA  319

Query  212  LCK  220
             CK
Sbjct  320  TCK  322



>ref|WP_034952094.1| SyrP protein [Erythrobacter sp. JL475]
 gb|KEO87949.1| SyrP protein [Erythrobacter sp. JL475]
Length=307

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RNDP +++T G+G+P+ AE +   +AI +E +  + W+ GDV L+DN  V+H R+PF 
Sbjct  237  DSRNDPNRSITLGNGEPITAEQMAGPIAIADELTYDLAWQAGDVALVDNFIVMHGRRPFE  296

Query  188  PPRRVLASL  214
              RRVLASL
Sbjct  297  GKRRVLASL  305



>ref|XP_006858496.1| hypothetical protein AMTR_s00071p00129300 [Amborella trichopoda]
 gb|ERN19963.1| hypothetical protein AMTR_s00071p00129300 [Amborella trichopoda]
Length=64

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            ++ FGDG P P E I +   I +E +V + W+KGD+LL+DN+AV HAR+P  P R +LAS
Sbjct  2    SLGFGDGVPFPDEAIKNYGKIRDENNVNIRWEKGDILLVDNLAVQHARRPGKPTRIILAS  61

Query  212  LCK  220
            LCK
Sbjct  62   LCK  64



>ref|XP_006378505.1| hypothetical protein POPTR_0010s14110g [Populus trichocarpa]
 gb|ERP56302.1| hypothetical protein POPTR_0010s14110g [Populus trichocarpa]
Length=321

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P   +  C  I+EEES+   W+KGDVL +DNMA+LH R+P LPPR+VL +
Sbjct  259  SAMLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
            +CK
Sbjct  319  ICK  321



>ref|XP_004974652.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Setaria 
italica]
Length=322

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +PAE +  C  I+EEES+   W+KGD+L++DN+A LH R+P L PR+VL 
Sbjct  259  SSATLADGSEIPAEFVRRCGEIIEEESIQFRWEKGDILILDNLATLHGRRPSLAPRKVLV  318

Query  209  SLCK  220
            + CK
Sbjct  319  ATCK  322



>ref|XP_006858502.1| hypothetical protein AMTR_s00071p00132190 [Amborella trichopoda]
 gb|ERN19969.1| hypothetical protein AMTR_s00071p00132190 [Amborella trichopoda]
Length=129

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +V FGDG P P E  +    I +E +V + W+KGD+LL+DN+AV HAR+P  PPR +LAS
Sbjct  67   SVCFGDGTPFPDEAFNTYKKIRDEINVNIRWQKGDILLLDNLAVQHARRPGKPPRVILAS  126

Query  212  LCK  220
            LCK
Sbjct  127  LCK  129



>ref|XP_002314891.1| hypothetical protein POPTR_0010s14120g [Populus trichocarpa]
 gb|EEF01062.1| hypothetical protein POPTR_0010s14120g [Populus trichocarpa]
Length=321

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P   +  C  I+EEES+   W+KGDVL +DNMA+LH R+P LPPR+VL +
Sbjct  259  SAMLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>gb|ACN40806.1| unknown [Picea sitchensis]
Length=332

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  44   GDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            GDG  +P +II +   ++  E V V W+ GDVLLIDN+AV+HAR+P  PPRRVL S+CK
Sbjct  274  GDGSAIPKDIIEESARVMNNECVEVKWEAGDVLLIDNLAVMHARRPSKPPRRVLVSMCK  332



>ref|XP_009418433.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Musa 
acuminata subsp. malaccensis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEESV   W++GDVL +DN+A+LH R+P +PPR+VL +
Sbjct  259  SATMADGSEIPEHVVKRCGEIIEEESVQFKWEEGDVLFLDNLALLHGRRPSMPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_005766892.1| hypothetical protein EMIHUDRAFT_416307 [Emiliania huxleyi CCMP1516]
 gb|EOD14463.1| hypothetical protein EMIHUDRAFT_416307 [Emiliania huxleyi CCMP1516]
Length=411

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILE---EESVAVPWKKGDVLLIDNMAVLHAR  175
            ED RNDP KA+ +GDG+ L  E +   L   E      VA  W+ GDVL+IDN A +H+R
Sbjct  319  EDGRNDPLKAIRYGDGEELDGEAVAALLETGEWMAAHRVAFAWQSGDVLIIDNQAAMHSR  378

Query  176  KPFLPPRRVLASL  214
            + F PPRR+LASL
Sbjct  379  ETFTPPRRILASL  391



>gb|AFK36473.1| unknown [Lotus japonicus]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEES+   W+KGDVL  DN A+LH R+P LPPR+VL +
Sbjct  259  SATMADGTEIPEHVVKRCGEIIEEESIQFKWEKGDVLFFDNCALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_002524391.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38002.1| conserved hypothetical protein [Ricinus communis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEES+   W+ GDVL +DN+A+LH R+P LPPR+VL +
Sbjct  259  SATMADGTEIPEHVVKRCEQIIEEESIQFKWETGDVLFLDNLALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>gb|KCW86384.1| hypothetical protein EUGRSUZ_B03063 [Eucalyptus grandis]
Length=298

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  IL+EES+   W+KGDVL  DNMA+LH R+P LPPR+VL +
Sbjct  236  SATMIDGTEIPDHVVKRCGEILDEESIQFKWEKGDVLFFDNMALLHGRRPSLPPRKVLVA  295

Query  212  LCK  220
             CK
Sbjct  296  TCK  298



>gb|AFK43267.1| unknown [Medicago truncatula]
Length=221

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPRRVL +
Sbjct  159  SATMADGTEIPEHVVKRCGEIIEEESIQFKWEKGDVLFLDNYALLHGRRPSLPPRRVLVA  218

Query  212  LCK  220
              K
Sbjct  219  TTK  221



>ref|XP_010044304.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Eucalyptus 
grandis]
Length=322

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  IL+EES+   W+KGDVL  DNMA+LH R+P LPPR+VL +
Sbjct  260  SATMIDGTEIPDHVVKRCGEILDEESIQFKWEKGDVLFFDNMALLHGRRPSLPPRKVLVA  319

Query  212  LCK  220
             CK
Sbjct  320  TCK  322



>ref|XP_002965817.1| hypothetical protein SELMODRAFT_66708, partial [Selaginella moellendorffii]
 gb|EFJ33237.1| hypothetical protein SELMODRAFT_66708, partial [Selaginella moellendorffii]
Length=259

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V FGDG P+P E +    A+L+EE V V W+KGD++++DN++V+H R P  PPR VL 
Sbjct  196  RGVAFGDGSPIPVEELDKIAAVLQEEQVVVDWQKGDIVIVDNLSVMHCRLPGEPPRVVLV  255

Query  209  SLCK  220
            SL K
Sbjct  256  SLVK  259



>ref|XP_003576427.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Brachypodium 
distachyon]
Length=380

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +PA  +  C   +EEES+   W+KGD+L++DN+A LH R+P LPPRRVL + CK
Sbjct  323  DGAEIPASFVRRCEETIEEESIQFRWRKGDILILDNLATLHGRRPSLPPRRVLVATCK  380



>ref|XP_002960924.1| hypothetical protein SELMODRAFT_74242 [Selaginella moellendorffii]
 gb|EFJ38463.1| hypothetical protein SELMODRAFT_74242 [Selaginella moellendorffii]
Length=330

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            FGD  P P + +  CL IL+EE VA PW+KGDVL++DN  VLHAR+P   PR VL SL K
Sbjct  271  FGDCSPFPQDALDACLRILDEEKVAFPWQKGDVLIVDNANVLHARQPSKRPRTVLVSLLK  330



>gb|ACN40106.1| unknown [Picea sitchensis]
Length=235

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
             ++++ GDG  +P E +    AIL EE V + W++GDVLL+DNMAV HAR+P  PPRR+L
Sbjct  171  NQSLSLGDGCGIPGEALDAFKAILNEECVDLKWEEGDVLLLDNMAVQHARRPSKPPRRIL  230

Query  206  ASLCK  220
             ++CK
Sbjct  231  IAMCK  235



>ref|XP_002967085.1| hypothetical protein SELMODRAFT_87833 [Selaginella moellendorffii]
 gb|EFJ31684.1| hypothetical protein SELMODRAFT_87833 [Selaginella moellendorffii]
Length=330

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            FGD  P P + +  CL IL+EE VA PW+KGDVL++DN  VLHAR+P   PR VL SL K
Sbjct  271  FGDCSPFPQDALDACLRILDEEKVAFPWQKGDVLIVDNANVLHARQPSKRPRTVLVSLLK  330



>ref|XP_005768829.1| hypothetical protein EMIHUDRAFT_436587 [Emiliania huxleyi CCMP1516]
 gb|EOD16400.1| hypothetical protein EMIHUDRAFT_436587 [Emiliania huxleyi CCMP1516]
Length=432

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILE---EESVAVPWKKGDVLLIDNMAVLHAR  175
            ED RNDP KA+ +GDG+ L  E +   L   E      VA  W+ GDVL+IDN A +H+R
Sbjct  340  EDGRNDPLKAIRYGDGEELDGEAVAALLETGEWMAAHRVAFAWQSGDVLIIDNQAAMHSR  399

Query  176  KPFLPPRRVLASL  214
            + F PPRR+LASL
Sbjct  400  ETFTPPRRILASL  412



>gb|EEE68610.1| hypothetical protein OsJ_27145 [Oryza sativa Japonica Group]
Length=293

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +P   +  C  I+EEES+   W+ GDVL++DN+A LH R+P LPPRRVL 
Sbjct  230  SSATMADGAEIPTAFVARCGEIIEEESIQFRWEVGDVLILDNLATLHGRRPSLPPRRVLV  289

Query  209  SLCK  220
            + CK
Sbjct  290  ATCK  293



>gb|KEH17356.1| clavaminate synthase-like plant protein [Medicago truncatula]
Length=321

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPRRVL +
Sbjct  259  SATMADGTEIPEHVVKRCGEIIEEESIQFKWEKGDVLFLDNYALLHGRRPSLPPRRVLVA  318

Query  212  LCK  220
              K
Sbjct  319  TTK  321



>dbj|BAD05823.1| putative Signal peptidase I [Oryza sativa Japonica Group]
Length=323

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +P   +  C  I+EEES+   W+ GDVL++DN+A LH R+P LPPRRVL 
Sbjct  260  SSATMADGAEIPTAFVARCGEIIEEESIQFRWEVGDVLILDNLATLHGRRPSLPPRRVLV  319

Query  209  SLCK  220
            + CK
Sbjct  320  ATCK  323



>ref|XP_006437754.1| hypothetical protein CICLE_v10033372mg [Citrus clementina]
 gb|ESR50994.1| hypothetical protein CICLE_v10033372mg [Citrus clementina]
Length=321

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P  ++  C  I+E+ES+   W+KGDVL +DN+AVLH R+P +PPR+VL +
Sbjct  259  SACMADGTEIPENVVKRCEEIIEDESIQFKWEKGDVLFLDNLAVLHGRRPSMPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>gb|KJB50797.1| hypothetical protein B456_008G187300 [Gossypium raimondii]
Length=321

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + +  DG  +P  ++  C  I+EEES+   W+KGDV + DNMA+LH R+P  PPRRVL +
Sbjct  259  SASMADGTEIPENVVKRCGEIIEEESIQFKWEKGDVAIFDNMALLHGRRPSKPPRRVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_006484570.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Citrus 
sinensis]
 gb|KDO70121.1| hypothetical protein CISIN_1g036171mg [Citrus sinensis]
Length=321

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P  ++  C  I+E+ES+   W+KGDVL +DN+AVLH R+P +PPR+VL +
Sbjct  259  SACMADGTEIPENVVKRCEEIIEDESIQFKWEKGDVLFLDNLAVLHGRRPSMPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|WP_003615168.1| Taurine catabolism dioxygenase TauD/TfdA [Methylosinus trichosporium]
Length=325

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+ A  F DG P+P E++ D  A+L+ ESV+ PW+KGDV+++DNM V HAR PF  PR
Sbjct  251  NLPRNAF-FADGSPIPDEMLDDVRAVLDAESVSFPWEKGDVMMLDNMLVAHARAPFKGPR  309

Query  197  RVLASLCK**KH*TLG  244
             V+ ++     H  LG
Sbjct  310  NVVVAMAG--SHSNLG  323



>gb|KDP29349.1| hypothetical protein JCGZ_18270 [Jatropha curcas]
Length=321

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +P + +  C  I+EEES+   W+ GDVL +DN+A+LH R+P LPPRRVL + CK
Sbjct  264  DGTEIPEKFVKRCEQIIEEESIQFKWEAGDVLFLDNLALLHGRRPSLPPRRVLVATCK  321



>ref|XP_002983066.1| hypothetical protein SELMODRAFT_117522 [Selaginella moellendorffii]
 gb|EFJ15875.1| hypothetical protein SELMODRAFT_117522 [Selaginella moellendorffii]
Length=298

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   RNDP-KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLP  190
            ++DP  + V FGDG P+P E +     +L+EE V + W+KGDV+++DN++V+H R P  P
Sbjct  227  QDDPVTRGVAFGDGSPIPVEELDKIATVLQEEQVVLDWQKGDVVIVDNLSVMHCRLPGEP  286

Query  191  PRRVLASLCK  220
            PR VL SL K
Sbjct  287  PRVVLVSLIK  296



>ref|WP_034388097.1| SyrP protein [Hellea balneolensis]
Length=314

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARNDP K++T+GD  P+  E ++  + + +  S  + W+ GDV LIDN  V+H R+P+
Sbjct  243  KDARNDPSKSITYGDDSPIDLEALNTAITLADSLSYDLNWQAGDVALIDNYRVMHGRRPY  302

Query  185  LPPRRVLASL  214
               RRV+ SL
Sbjct  303  TGKRRVITSL  312



>gb|AFG63213.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63214.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63215.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63216.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63217.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63218.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63220.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63221.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63222.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63223.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63224.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63225.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
 gb|AFG63226.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
Length=119

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
             ++++ GDG  +P E +     ++ EE V + W+ GDVLL+DNMAV HAR+P  PPRR+L
Sbjct  55   NQSLSMGDGCGIPGEALDAFKTVVNEECVNLKWEAGDVLLLDNMAVQHARRPSKPPRRIL  114

Query  206  ASLCK  220
             ++CK
Sbjct  115  IAMCK  119



>ref|XP_008467203.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Cucumis 
melo]
Length=322

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +   ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPRRVL + CK
Sbjct  265  DGTEIAENVVKRCQEIIEEESIQFKWEKGDVLFLDNYALLHGRRPSLPPRRVLVATCK  322



>ref|XP_004490256.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Cicer 
arietinum]
Length=321

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +P  ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPR+VL +
Sbjct  259  SATMADGTEIPDNVVKRCGEIIEEESIQFKWQKGDVLFLDNYALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
              K
Sbjct  319  TTK  321



>ref|XP_006858500.1| hypothetical protein AMTR_s00071p00131570 [Amborella trichopoda]
 gb|ERN19967.1| hypothetical protein AMTR_s00071p00131570 [Amborella trichopoda]
Length=333

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
             ++F DG P P E       I +E +V + W+KGD+LL+DN+AV HAR+P  PPR +LAS
Sbjct  271  GLSFADGTPFPNEAFKTYKKIRDENNVNIRWEKGDILLLDNLAVQHARRPGKPPRIILAS  330

Query  212  LCK  220
            LCK
Sbjct  331  LCK  333



>gb|AFG63219.1| hypothetical protein 0_1803_01, partial [Pinus taeda]
Length=119

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
             ++++ GDG  +P E +     ++ EE V + W+ GDVLL+DNMAV HAR+P  PPRR+L
Sbjct  55   NQSLSMGDGCCIPGEALDAFKTVVNEECVNLKWEAGDVLLLDNMAVQHARRPSKPPRRIL  114

Query  206  ASLCK  220
             ++CK
Sbjct  115  IAMCK  119



>ref|XP_004297149.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Fragaria 
vesca subsp. vesca]
Length=321

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + +  DG  +P  +++ C  I+EEES+   W+KGDVL  DN A+LH R+P   PRRVL +
Sbjct  259  SASMADGSEIPDNVVNRCQEIIEEESIQFKWEKGDVLFFDNYALLHGRRPSAAPRRVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|WP_022599044.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCN38084.1| putative Clavaminate synthase [Vibrio nigripulchritudo AM115]
 emb|CCN66766.1| putative Clavaminate synthase [Vibrio nigripulchritudo Pon4]
 emb|CCN44497.1| putative Clavaminate synthase [Vibrio nigripulchritudo FTn2]
 emb|CCN74997.1| putative Clavaminate synthase [Vibrio nigripulchritudo SO65]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|WP_022552116.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 ref|YP_008622849.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCO59747.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCN82178.1| putative Clavaminate synthase [Vibrio nigripulchritudo BLFn1]
 emb|CCN93133.1| putative Clavaminate synthase [Vibrio nigripulchritudo ENn2]
 emb|CCO41498.1| putative Clavaminate synthase [Vibrio nigripulchritudo SFn135]
 emb|CCO53224.1| putative Clavaminate synthase [Vibrio nigripulchritudo Wn13]
 emb|CCN90783.1| putative Clavaminate synthase [Vibrio nigripulchritudo SFn27]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|WP_022607050.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCN72859.1| putative Clavaminate synthase [Vibrio nigripulchritudo SFn118]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|WP_004399145.1| SyrP [Vibrio nigripulchritudo]
 gb|EGU61233.1| Taurine catabolism dioxygenase TauD/TfdA [Vibrio nigripulchritudo 
ATCC 27043]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|WP_022610463.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCO44717.1| putative Clavaminate synthase [Vibrio nigripulchritudo SOn1]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|WP_022590254.1| putative Clavaminate synthase [Vibrio nigripulchritudo]
 emb|CCN53177.1| putative Clavaminate synthase [Vibrio nigripulchritudo MADA3021]
 emb|CCN58533.1| putative Clavaminate synthase [Vibrio nigripulchritudo MADA3029]
 emb|CCN49975.1| putative Clavaminate synthase [Vibrio nigripulchritudo MADA3020]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN   KAVT G G+ + AE++ +  A ++E  V   W+ GDVLL++N  VLHAR+PF 
Sbjct  255  DSRNVSTKAVTTGSGEFMDAEVMEETKAAMDELCVNFRWEAGDVLLVNNYTVLHARQPFT  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GKRRILASVA  324



>ref|XP_006660097.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Oryza 
brachyantha]
Length=259

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
              T  DG  +PA  +  C  I+EEES+   W+KGDVL++DN+A LH R+P LPPRR L +
Sbjct  193  TATMADGSEIPAGFVRRCRDIIEEESIQFRWEKGDVLILDNLATLHGRRPSLPPRRGLVA  252



>ref|XP_010925014.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Elaeis 
guineensis]
Length=321

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +PAE++  C  I+EEES+   W+KGD+L +DN+A+LH R+P LPPR+VL +
Sbjct  259  SATMADGSEIPAEVVKRCEEIIEEESIQFKWEKGDILFLDNLALLHGRRPSLPPRKVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_004147109.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Cucumis 
sativus]
 gb|KGN51551.1| hypothetical protein Csa_5G577420 [Cucumis sativus]
Length=322

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +   ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPR+VL + CK
Sbjct  265  DGTEIAENVVKRCQEIIEEESIQFRWEKGDVLFLDNYALLHGRRPSLPPRKVLVATCK  322



>gb|ABR18170.1| unknown [Picea sitchensis]
Length=320

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  38   TFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLC  217
            T GDG   P E     + I+EEE V + W+ GDVL++DN  V HAR+P  PPRR+LA+ C
Sbjct  260  TLGDGSLFPEEAFESSIQIIEEECVEINWEVGDVLVLDNRFVQHARRPSTPPRRLLAAFC  319

Query  218  K  220
            K
Sbjct  320  K  320



>ref|XP_008779099.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Phoenix 
dactylifera]
Length=321

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            + T  DG  +PA+++  C  I+EEES+   W+KGD+L +DN+A+LH R+P LPPRRVL +
Sbjct  259  SATMADGSEIPADVVKRCEEIIEEESIQFKWEKGDILFLDNLALLHGRRPSLPPRRVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|XP_004162029.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Cucumis 
sativus]
Length=322

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +   ++  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPR+VL   CK
Sbjct  265  DGTEIAENVVKRCQEIIEEESIQFRWEKGDVLFLDNYALLHGRRPSLPPRKVLVGTCK  322



>gb|KDP29350.1| hypothetical protein JCGZ_18271 [Jatropha curcas]
Length=321

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  47   DGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            DG  +P   +  C  I+E+ES+   W+KGDVL +DN+A+LH R+P LPPR++L + C+
Sbjct  264  DGTEIPENFVKRCEEIIEDESIQFNWEKGDVLFLDNLALLHGRRPSLPPRKILVATCR  321



>ref|WP_040965438.1| SyrP protein [Erythrobacter vulgaris]
Length=311

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RNDP +A+TFGDG+ +  E +   + I +E +  + WK  DV L+DN  V+H R+PF 
Sbjct  241  DSRNDPNRAITFGDGQAITPEDMAIPIRIADELTYDLQWKARDVALVDNFLVMHGRRPFS  300

Query  188  PPRRVLASL  214
              RRVLASL
Sbjct  301  GRRRVLASL  309



>ref|XP_006858504.1| hypothetical protein AMTR_s00071p00133840 [Amborella trichopoda]
 gb|ERN19971.1| hypothetical protein AMTR_s00071p00133840 [Amborella trichopoda]
Length=316

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  17   NDPKKA-VTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPP  193
            N+P+   V FGDG PLP   +     IL+  SV + W+KGDVL++DN++V HAR+P  PP
Sbjct  248  NNPEDIDVHFGDGTPLPVGALEIYRKILDVNSVDLQWQKGDVLVVDNLSVQHARRPGKPP  307

Query  194  RRVLASLCK  220
            R +L S+CK
Sbjct  308  RVILVSICK  316



>gb|EMT25595.1| Clavaminate synthase-like protein [Aegilops tauschii]
Length=273

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
             + T  DG  +PA  +  C  I+EEES+   W+KGD++++DN+A LH R+P LPPRRVL 
Sbjct  210  SSATVADGAEIPASFVQRCEEIIEEESIQFRWRKGDIVILDNLATLHGRRPSLPPRRVLV  269

Query  209  SLCK  220
            + CK
Sbjct  270  ATCK  273



>ref|XP_002505882.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67140.1| predicted protein, partial [Micromonas sp. RCC299]
Length=286

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D  N P  +V  GDG P+  +++     I  EESVAV W+ GDV+LI+N+ V+HAR+ F+
Sbjct  215  DELNAPGASVVLGDGTPMRQDMLDAMERIFREESVAVQWRAGDVMLINNLQVMHARETFV  274

Query  188  ---PPRRVLASL  214
                PRRVLASL
Sbjct  275  DGEAPRRVLASL  286



>ref|WP_040655297.1| hypothetical protein, partial [Rubidibacter lacunae]
Length=341

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +2

Query  23   PKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRV  202
            P+ A  FGDG  +  EI+    A    E+V  PW+ GDVLL+DNMAV H R+PF  PRRV
Sbjct  274  PRNAY-FGDGGEISEEILEAIRAAFAAETVVFPWQAGDVLLLDNMAVAHGRRPFSGPRRV  332

Query  203  LASL  214
            LA +
Sbjct  333  LAGM  336



>ref|WP_043969598.1| regulatory protein, partial [Micromonospora carbonacea]
Length=318

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  11   ARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLP  190
            A  D      +GDG P+ A+++ +  A    E+ + PW++GDVLL++NM   HAR+PF P
Sbjct  246  AEEDLPYQTAYGDGTPIGADVLAELRAAYAAETRSFPWRRGDVLLVENMLAAHAREPFTP  305

Query  191  PRRVLASLC  217
            PRR+L ++ 
Sbjct  306  PRRILTAMS  314



>ref|WP_012189424.1| taurine catabolism dioxygenase TauD/TfdA [Herpetosiphon aurantiacus]
 gb|ABX04519.1| Taurine catabolism dioxygenase TauD/TfdA [Herpetosiphon aurantiacus 
DSM 785]
Length=349

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  +   +GDG P+  E++ +   +L++E+V  PW++GDVL++DNM V HAR PF+ PR+
Sbjct  276  DLPRNTYYGDGSPIEPEVLAEIRHVLDQETVMFPWQEGDVLMLDNMLVAHARSPFVGPRK  335

Query  200  VLASLCK  220
            ++  + +
Sbjct  336  IVVGMAE  342



>gb|ERN42083.1| putative taurine catabolism dioxygenase [Rubidibacter lacunae 
KORDI 51-2]
Length=362

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +2

Query  23   PKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRV  202
            P+ A  FGDG  +  EI+    A    E+V  PW+ GDVLL+DNMAV H R+PF  PRRV
Sbjct  274  PRNAY-FGDGGEISEEILEAIRAAFAAETVVFPWQAGDVLLLDNMAVAHGRRPFSGPRRV  332

Query  203  LASLC  217
            LA + 
Sbjct  333  LAGMA  337



>gb|ABR17432.1| unknown [Picea sitchensis]
Length=319

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  26   KKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVL  205
            K     GDG   P + I   + I+EEE V + W+ GDVL++DN  V HAR+P  PPRRVL
Sbjct  255  KTTPMLGDGPLFPEDAIESFIQIIEEECVDITWEVGDVLVLDNRFVQHARRPSTPPRRVL  314

Query  206  ASLCK  220
            A+ CK
Sbjct  315  AAFCK  319



>ref|XP_002278552.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Vitis 
vinifera]
 emb|CAN78723.1| hypothetical protein VITISV_020006 [Vitis vinifera]
 emb|CBI27080.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +PA ++  C  I+EEES+   W+KGDVL++DN+A+LH R+P LPPRRVL +
Sbjct  260  SAMMADGTEIPANVVKRCEEIIEEESIQFKWEKGDVLVLDNLALLHGRRPSLPPRRVLVT  319

Query  212  LCK  220
             CK
Sbjct  320  TCK  322



>ref|WP_034959538.1| SyrP protein [Erythrobacter longus]
 gb|KEO90064.1| SyrP protein [Erythrobacter longus]
Length=311

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  8    DARNDPKKAVTFGD----GKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHAR  175
            DARNDP KA+TFG     G+ + A  +   +AI +E +  + W+ GDV LIDN  V+H R
Sbjct  237  DARNDPNKAITFGGIDGRGEAITAADMGPAVAIADELTHDLQWQAGDVALIDNFTVMHGR  296

Query  176  KPFLPPRRVLASL  214
            +P+   RRVLASL
Sbjct  297  RPYEGKRRVLASL  309



>ref|WP_008347633.1| MULTISPECIES: taurine catabolism dioxygenase tauD/tfdA [Burkholderia]
 gb|EKS69665.1| taurine catabolism dioxygenase tauD/tfdA [Burkholderia sp. SJ98]
 gb|KDR25051.1| hypothetical protein BG60_31310 [Burkholderia zhejiangensis]
Length=332

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+  V +GDG PL A+ + +  A+L+E+ +A PW  GDVL++DNM   HAR PF  PR
Sbjct  260  NVPRN-VFYGDGAPLEADALAEIRAVLDEKRIAFPWLTGDVLMLDNMLTAHARDPFEGPR  318

Query  197  RVLASLCK  220
            RV+ ++ +
Sbjct  319  RVVVAMAQ  326



>ref|WP_020683821.1| hypothetical protein [Marinobacterium rhizophilum]
Length=326

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            DARN+ K AV   DG+P+   +I + +  +++E V   W+ GDVL I+N  VLHAR+PF 
Sbjct  255  DARNEGKTAVVTADGEPMDEAVIDEVVRQMDKECVNFKWQHGDVLWINNHTVLHARQPFK  314

Query  188  PPRRVLASLC  217
              R +LAS+ 
Sbjct  315  GERNILASIS  324



>ref|WP_041398990.1| SyrP protein, partial [Planctomyces brasiliensis]
Length=282

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RNDP  A+  GDG  L A+ +   + + EE +  V W+KGD ++IDN  V+HAR+ F
Sbjct  199  KDSRNDPSSAIRHGDGSVLDADAVRRAIELSEELAFDVAWQKGDAVIIDNRVVMHARRTF  258

Query  185  LPPRRVLASL  214
               R+++ASL
Sbjct  259  QGTRKIVASL  268



>ref|WP_041311823.1| SyrP [Herbaspirillum seropedicae]
Length=334

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V F DG P+P  ++ +  A+L++E+V  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVLFADGSPIPDSMLEEVRAVLDQETVIFPWEAGDVLMLDNMLAAHARTPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAE  326



>ref|WP_027778120.1| hypothetical protein [Burkholderia caledonica]
Length=334

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+EE V  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVYYGDGAPLEADALAQIRGVLDEERVVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAQ  326



>ref|WP_007236400.1| SyrP protein [marine gamma proteobacterium HTCC2080]
 gb|EAW39483.1| syrP protein, putative [marine gamma proteobacterium HTCC2080]
Length=332

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D RN    +V FGDG P+P   + + +AI  ++     W+ GDV+LIDN+ V+H R+PF
Sbjct  257  QDQRNSAASSVCFGDGSPMPIPALKEMIAIAYQQVYDHIWQAGDVILIDNLRVMHGRRPF  316

Query  185  LPPRRVLASL  214
               R VLA L
Sbjct  317  SGTRTVLAGL  326



>gb|ADJ63841.1| clavaminic acid synthetase (CAS)-like protein [Herbaspirillum 
seropedicae SmR1]
Length=342

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V F DG P+P  ++ +  A+L++E+V  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  271  RNVLFADGSPIPDSMLEEVRAVLDQETVIFPWEAGDVLMLDNMLAAHARTPFEGPRKVVV  330

Query  209  SLCK  220
            ++ +
Sbjct  331  AMAE  334



>gb|ADY58679.1| Taurine catabolism dioxygenase TauD/TfdA [Planctomyces brasiliensis 
DSM 5305]
Length=341

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +D+RNDP  A+  GDG  L A+ +   + + EE +  V W+KGD ++IDN  V+HAR+ F
Sbjct  258  KDSRNDPSSAIRHGDGSVLDADAVRRAIELSEELAFDVAWQKGDAVIIDNRVVMHARRTF  317

Query  185  LPPRRVLASL  214
               R+++ASL
Sbjct  318  QGTRKIVASL  327



>emb|CDZ79741.1| peptide synthase [Chlamydia sp. 'Rubis']
Length=334

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  35   VTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            + F DG  +P E I+  + +LE+ ++  PW+KGDVL++DN+  +H R PF   RR+L +L
Sbjct  273  IYFADGTKIPRESIYHIMEVLEKNTIYFPWQKGDVLVLDNVLAMHGRAPFTGKRRILTAL  332

Query  215  CK  220
             K
Sbjct  333  TK  334



>ref|XP_010490000.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Camelina 
sativa]
Length=307

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAV  118
            ED RNDP KAVTFGDGKPLPA+I+HDCL +LEEE VA+
Sbjct  260  EDKRNDPTKAVTFGDGKPLPADIVHDCLRVLEEECVAL  297



>ref|WP_039770085.1| SyrP [Pseudomonas fluorescens]
 gb|KIF59028.1| SyrP [Pseudomonas fluorescens]
Length=327

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+  E++    A+L+E +++ PW++GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEDEVLSQIRAVLDECAISFPWQEGDVLMLDNMLSAHARSPFEGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VIVAMAE  320



>gb|ABK26347.1| unknown [Picea sitchensis]
Length=319

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  44   GDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            GDG   P E I   + I EEE V V W+ GDVL++DN  V HAR+P  PPRR+LA+ CK
Sbjct  261  GDGSLFPEEAIEPYIRITEEECVDVTWEVGDVLVLDNRFVQHARRPSTPPRRLLAAFCK  319



>ref|WP_015866525.1| Taurine catabolism dioxygenase TauD/TfdA [Variovorax paradoxus]
 gb|ACS20363.1| Taurine catabolism dioxygenase TauD/TfdA [Variovorax paradoxus 
S110]
Length=330

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG  +  EI  +  A+L+ E+VA PW++GDVL++DNM V HAR PF  PR
Sbjct  256  NVPRNTF-FADGSTISDEIFGEVRAVLDAETVAFPWEEGDVLMLDNMLVAHARSPFKGPR  314

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  315  KVIVAMAE  322



>ref|WP_013795423.1| SyrP [Marinomonas posidonica]
 gb|AEF53947.1| Taurine catabolism dioxygenase TauD/TfdA [Marinomonas posidonica 
IVIA-Po-181]
Length=326

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            D+RN  +KAVT  +G+P+ A  +   +  ++E  V   W+ GDVL I+N  VLHAR+PF 
Sbjct  255  DSRNQGEKAVTTANGEPMDANALEQLVKAMDELCVNFKWQPGDVLWINNHTVLHARQPFE  314

Query  188  PPRRVLASLC  217
              RR+LAS+ 
Sbjct  315  GERRILASIS  324



>ref|WP_019701171.1| syrP protein [Acidovorax avenae]
Length=330

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG P+P  ++ +  A+L+ E+V+ PW+KGDV+++DNM   HAR PF  PR
Sbjct  255  NVPRNTF-FADGSPMPDALMDEVRAVLDAETVSFPWEKGDVVMLDNMLAAHARSPFKGPR  313

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  314  KVVVAMAR  321



>ref|WP_031048272.1| hypothetical protein [Streptomyces sp. NRRL WC-3774]
Length=347

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V FGDG+P+   ++ +  A  + E+V  PW++GDVLLIDNM V H R P+  PRR
Sbjct  269  DIPRQVYFGDGEPIEDAVLDEVRAAFDAETVREPWQEGDVLLIDNMLVSHGRDPYEGPRR  328

Query  200  VLASLC  217
            VL ++ 
Sbjct  329  VLVAMT  334



>ref|WP_026432248.1| SyrP [Acidovorax oryzae]
Length=330

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG P+P  ++ +  A+L+ E+V+ PW+KGDV+++DNM   HAR PF  PR
Sbjct  255  NVPRNTF-FADGSPMPDALMDEVRAVLDAETVSFPWEKGDVVMLDNMLAAHARSPFKGPR  313

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  314  KVVVAMAR  321



>ref|WP_026196734.1| SyrP [Fangia hongkongensis]
Length=320

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  8    DARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFL  187
            DARN+  K+VT  DG  +   +++     ++E++V+  W++GDVL I+N  VLH+R+P+ 
Sbjct  250  DARNEGHKSVTLADGAYIDDTVMNTLTEKMKEDTVSFHWQEGDVLWINNNTVLHSREPYQ  309

Query  188  PPRRVLASLCK  220
              R+V AS+ K
Sbjct  310  GARKVYASIAK  320



>ref|WP_005455406.1| SyrP [Saccharomonospora cyanea]
 gb|EHR60638.1| putative taurine catabolism dioxygenase [Saccharomonospora cyanea 
NA-134]
Length=313

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  ++V F DG P+PAE +H        E+V V W+ GD++LIDN+ V H R+PF  PRR
Sbjct  247  DMPQSVVFADGSPIPAEYVHQVRERGLAEAVDVGWEAGDLMLIDNVLVGHGRRPFTGPRR  306

Query  200  VLASLC  217
            VL ++ 
Sbjct  307  VLVAMS  312



>ref|WP_013596030.1| taurine catabolism dioxygenase tauD/TfdA [Acidovorax avenae]
 gb|ADX47549.1| Taurine catabolism dioxygenase TauD/TfdA [Acidovorax avenae subsp. 
avenae ATCC 19860]
Length=330

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG P+P  ++ +  A+L+ E+V+ PW+KGDV+++DNM   HAR PF  PR
Sbjct  255  NVPRNTF-FADGSPMPDALMDEVRAVLDAETVSFPWEKGDVVMLDNMLAAHARAPFKGPR  313

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  314  KVVVAMAR  321



>ref|WP_043733042.1| hypothetical protein [Kutzneria sp. 744]
Length=284

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            FGDG P+PAE+I + L      S+  PW++GD+L++DNM + H R+P+   R++  S+ +
Sbjct  219  FGDGSPIPAEVIAEILDAYRRNSIVFPWQRGDLLIVDNMLMSHGRRPYRGARQIRVSMAQ  278



>ref|WP_018905478.1| syrP protein [Variovorax paradoxus]
Length=330

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG  +  EI  +  A+L+ E+VA PW++GDVL++DNM V HAR PF  PR
Sbjct  256  NVPRNTF-FADGSTIGDEIFDEVRAVLDAETVAFPWEEGDVLMLDNMLVAHARSPFKGPR  314

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  315  KVIVAMAE  322



>ref|WP_037018633.1| SyrP [Pseudomonas nitroreducens]
Length=324

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
             D  + V +GDG P+   ++ +   +LEE  V+ PW  GDVL++DNM   HAR PF  PR
Sbjct  253  QDLPRNVYYGDGSPIEPSVLDEVRGVLEEAKVSFPWTSGDVLMLDNMLAAHARSPFCGPR  312

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  313  KVVVAMAE  320



>ref|WP_024764720.1| SyrP [Pseudomonas nitroreducens]
Length=324

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
             D  + V +GDG P+   ++ +   +LEE  V+ PW  GDVL++DNM   HAR PF  PR
Sbjct  253  QDLPRNVYYGDGSPIEPSVLDEVRGVLEEAKVSFPWTSGDVLMLDNMLAAHARSPFSGPR  312

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  313  KVVVAMAE  320



>ref|WP_040560018.1| hypothetical protein, partial [Kordia algicida]
Length=256

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            FGDG  +  E I + + +L++ ++ VPW+KGD+L++DNM  LH R PF   R +LAS+
Sbjct  198  FGDGTEIKKEYIENIIQVLDDITIPVPWQKGDLLMVDNMTALHGRLPFTGDRSILASM  255



>ref|WP_027784410.1| hypothetical protein [Burkholderia cepacia]
Length=335

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAR  324



>ref|WP_043182787.1| hypothetical protein [Burkholderia cepacia]
 gb|KER71844.1| hypothetical protein HR51_16495 [Burkholderia cepacia]
Length=335

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|XP_006362521.1| PREDICTED: clavaminate synthase-like protein At3g21360-like [Solanum 
tuberosum]
Length=322

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D   A+ F DG  +P  I+  C  I+EEES+   W+KGDVL +DN+A LH R+P LPPR+
Sbjct  257  DISSAMMF-DGTEIPQNIVKRCEEIIEEESIQFKWQKGDVLFLDNLATLHGRRPSLPPRK  315

Query  200  VLASLCK  220
            VL + CK
Sbjct  316  VLVATCK  322



>ref|WP_034184138.1| hypothetical protein [Burkholderia pyrrocinia]
 gb|KFL50265.1| hypothetical protein JM78_30130 [Burkholderia pyrrocinia]
Length=339

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>emb|CDP00560.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P  ++  C  I+EEES+   W+KGD+L +DNMA LH R+P L PRRVL +
Sbjct  259  SAMMADGTEIPENVVKRCEEIIEEESIQFKWEKGDILFLDNMATLHGRRPSLSPRRVLVT  318

Query  212  LCK  220
            +CK
Sbjct  319  ICK  321



>ref|WP_021163603.1| MULTISPECIES: SyrP-like protein [Burkholderia cepacia complex]
 gb|ERJ33701.1| SyrP-like protein [Burkholderia sp. AU4i]
 gb|AIO23395.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
cepacia ATCC 25416]
Length=335

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|XP_011077364.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Sesamum 
indicum]
Length=321

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  32   AVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLAS  211
            +    DG  +P +I+  C  I+EEES+   W+KGDVL +DN A+LH R+P LPPRRVL +
Sbjct  259  SAMMADGTEIPEKIVKRCEEIIEEESIQFKWEKGDVLFLDNYALLHGRRPSLPPRRVLVA  318

Query  212  LCK  220
             CK
Sbjct  319  TCK  321



>ref|WP_025989814.1| hypothetical protein [Burkholderia oklahomensis]
Length=337

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  266  RNVYYGDGAPLEADALTEIRGVLERQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  325

Query  209  SLCK  220
            ++ +
Sbjct  326  AMAR  329



>ref|WP_011351934.1| hypothetical protein [Burkholderia lata]
 gb|ABB08375.1| hypothetical protein Bcep18194_A4780 [Burkholderia lata]
Length=335

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_034186925.1| hypothetical protein [Burkholderia cenocepacia]
 gb|KEA60287.1| hypothetical protein DT99_07575 [Burkholderia cenocepacia]
Length=335

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_012425965.1| taurine catabolism dioxygenase tauD/tfdA [Burkholderia phytofirmans]
 gb|ACD18449.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia phytofirmans 
PsJN]
Length=344

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL AE + +   +L+++ +  PW  GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVYYGDGEPLEAEALAEIRGVLDQQRIVFPWLTGDVLMLDNMLTAHARDPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAR  326



>ref|WP_010103778.1| syringomycin biosynthesis enzyme, putative [Burkholderia oklahomensis]
 gb|AIO65914.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
oklahomensis]
Length=337

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  266  RNVYYGDGAPLEADALTEIRGVLERQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  325

Query  209  SLCK  220
            ++ +
Sbjct  326  AMAR  329



>ref|WP_039358661.1| hypothetical protein [Mumia flava]
 gb|KHL12268.1| hypothetical protein LK11_36890 [Mumia flava]
Length=335

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ + +   +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAEIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_011656819.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria]
 gb|ABI87089.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria 
AMMD]
Length=339

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRGVLERQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_006753775.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria]
 gb|EDT01850.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria 
IOP40-10]
Length=339

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRGVLERQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>gb|ABV56595.1| KtzO [Kutzneria sp. 744]
 gb|EWM18619.1| SyrP protein [Kutzneria sp. 744]
Length=323

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            FGDG P+PAE+I + L      S+  PW++GD+L++DNM + H R+P+   R++  S+ +
Sbjct  258  FGDGSPIPAEVIAEILDAYRRNSIVFPWQRGDLLIVDNMLMSHGRRPYRGARQIRVSMAQ  317



>ref|WP_006760383.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria]
 gb|EDT39646.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia ambifaria 
MEX-5]
Length=339

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRGVLERQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_013342378.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. CCGE1003]
 gb|ADN60851.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. CCGE1003]
Length=336

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+E+ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVYYGDGAPLEADALAQIRGVLDEQRIVFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAQ  326



>ref|WP_017520931.1| hypothetical protein [Pseudomonas nitroreducens]
Length=328

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+   ++ +   +LEE  V+ PW  GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEPSVLDEVRGVLEEAKVSFPWYSGDVLMLDNMLAAHARSPFSGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VVVAMAE  320



>ref|WP_037055677.1| SyrP [Pseudomonas oleovorans]
Length=323

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+   ++ D   +L E +V+ PW  GDVL++DNM   HAR PF  PR+
Sbjct  250  DLPRNVYYGDGSPIEESLLDDIRGVLAEATVSFPWCSGDVLMLDNMLTAHARTPFSGPRK  309

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  310  VIVAMAQ  316



>ref|WP_017320426.1| hypothetical protein [cyanobacterium PCC 7702]
Length=347

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  11   ARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLP  190
            A  D      +GDG P+  E++     + +++ V+  W+KGDVL++DNM  +HAR  F+P
Sbjct  271  AEKDLPTNTYYGDGSPIEPEVLEHLRQVYQQQMVSFTWEKGDVLMLDNMLAIHARNSFVP  330

Query  191  PRRVLASLCK  220
            PR++L  + +
Sbjct  331  PRKILVGMAE  340



>ref|WP_026044726.1| hypothetical protein [Burkholderia pyrrocinia]
Length=335

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRAVLDRQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_029967000.1| hypothetical protein [Burkholderia sp. URHA0054]
Length=349

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+E+ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  264  RNVYYGDGAPLEADALAQIRGVLDEQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  323

Query  209  SLCK  220
            ++ +
Sbjct  324  AMAQ  327



>gb|EDP95518.1| Condensation domain [Kordia algicida OT-1]
Length=323

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASL  214
            FGDG  +  E I + + +L++ ++ VPW+KGD+L++DNM  LH R PF   R +LAS+
Sbjct  265  FGDGTEIKKEYIENIIQVLDDITIPVPWQKGDLLMVDNMTALHGRLPFTGDRSILASM  322



>ref|WP_039221883.1| hypothetical protein [Burkholderia multivorans]
 gb|AIO74997.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
multivorans]
 gb|KHS14225.1| hypothetical protein BMD20_13970 [Burkholderia multivorans]
 gb|KHS17309.1| hypothetical protein BMD22_14300 [Burkholderia multivorans]
Length=336

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRAVLDRQRIVFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_006476051.1| Hypothetical protein [Burkholderia cenocepacia]
 gb|ABF76061.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia cenocepacia 
AU 1054]
 gb|ABK08386.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia cenocepacia 
HI2424]
 gb|EAY61963.1| Hypothetical protein BCPG_00173 [Burkholderia cenocepacia PC184]
 gb|KGY59685.1| hypothetical protein DK10_06260 [Burkholderia cepacia]
Length=335

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ +     +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAQIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_006486082.1| MULTISPECIES: taurine catabolism dioxygenase, TauD/TfdA family 
[Burkholderia cepacia complex]
 emb|CAR51988.1| putative dioxygenase [Burkholderia cenocepacia J2315]
 emb|CCE53427.1| SyrP-like protein [Burkholderia cenocepacia H111]
 gb|EPZ86567.1| taurine catabolism dioxygenase, TauD/TfdA family [Burkholderia 
cenocepacia K56-2Valvano]
 gb|ERI26481.1| taurine catabolism dioxygenase, TauD/TfdA family [Burkholderia 
cenocepacia BC7]
 emb|CDN60124.1| SyrP-like protein [Burkholderia cenocepacia H111]
 gb|AIO48576.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
cepacia]
 gb|KGB95053.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
cepacia]
 gb|KIS46644.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
cepacia]
Length=335

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ +     +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAQIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_027807406.1| hypothetical protein [Burkholderia cenocepacia]
Length=335

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ +     +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAQIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_012403341.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia phymatum]
 gb|ACC73168.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia phymatum 
STM815]
Length=343

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +   +LE++ V  PW  GDVL++DNM   HAR PF  PR+V+ 
Sbjct  260  RNVYYGDGTPLEADALAEIRGVLEQQRVVFPWVSGDVLMLDNMLTAHARDPFEGPRKVVV  319

Query  209  SLCK  220
            ++ +
Sbjct  320  AMAE  323



>ref|WP_010092425.1| hypothetical protein [Burkholderia ubonensis]
Length=335

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRAVLDRQRIVFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_012328451.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia cenocepacia]
 gb|ACA90782.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia cenocepacia 
MC0-3]
Length=335

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG+PL A+ +     +L+++ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGEPLEADALAQIRGVLDQQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_006047208.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia graminis]
 gb|EDT12086.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia graminis 
C4D1M]
Length=349

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+E+ +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  264  RNVYYGDGAPLEADALAQIRGVLDEQRIVFPWRTGDVLMLDNMLTAHARDPFEGPRKVVV  323

Query  209  SLCK  220
            ++ +
Sbjct  324  AMAQ  327



>ref|WP_039415740.1| SyrP [Pandoraea pulmonicola]
 gb|AJC23612.1| SyrP [Pandoraea pulmonicola]
Length=320

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG PL  E +     +LE E ++ PW  GDVL++DNM   HAR PF  PR+
Sbjct  248  DLPRNVYYGDGSPLEEEALATIRHVLEAEKISFPWHSGDVLMLDNMLAAHARSPFKGPRK  307

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  308  VVVAMAQ  314



>ref|WP_016347862.1| putative syringomycin biosynthesis enzyme [Burkholderia sp. RPE64]
 dbj|BAN27153.1| putative syringomycin biosynthesis enzyme [Burkholderia sp. RPE64]
Length=334

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + V  PW  GDVL++DNM   HAR PF  PRRV+ 
Sbjct  265  RNVYYGDGAPLEADALAEIRAVLDAQRVVFPWLTGDVLMLDNMLTAHARDPFDGPRRVVV  324

Query  209  SLCK  220
            ++ +
Sbjct  325  AMAR  328



>ref|WP_011796775.1| taurine catabolism dioxygenase TauD/TfdA [Acidovorax citrulli]
 gb|ABM34281.1| Taurine catabolism dioxygenase TauD/TfdA [Acidovorax citrulli 
AAC00-1]
Length=330

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  17   NDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPR  196
            N P+    F DG P+P  ++ +  A+L+ E+V+ PW++GDV+++DNM   HAR PF  PR
Sbjct  255  NVPRNTF-FADGSPMPDALMDEVRAVLDAETVSFPWEQGDVVMLDNMLAAHARAPFKGPR  313

Query  197  RVLASLCK  220
            +V+ ++ +
Sbjct  314  KVVVAMAR  321



>ref|WP_042583995.1| hypothetical protein [Burkholderia sp. MSHR3999]
 gb|KIP19848.1| taurine catabolism dioxygenase TauD, TfdA family protein [Burkholderia 
sp. MSHR3999]
Length=336

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +  PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  261  RNVYYGDGAPLEADALAEIRAVLDRQRIMFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  320

Query  209  SLCK  220
            ++ +
Sbjct  321  AMAQ  324



>ref|WP_015201410.1| taurine catabolism dioxygenase tauD/tfdA [Crinalium epipsammum]
 gb|AFZ11268.1| Taurine catabolism dioxygenase TauD/TfdA [Crinalium epipsammum 
PCC 9333]
Length=343

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  23   PKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRV  202
            P+ A  +GDG P+P +++ +   + +EE++  PWK+GDVLL+DNM   H R PF   R++
Sbjct  275  PRNAY-YGDGTPIPDDVLEEIRQVYQEETIIFPWKEGDVLLLDNMLATHGRMPFSGTRKI  333

Query  203  LASLCK  220
            +  + +
Sbjct  334  VVGMAE  339



>ref|XP_004239424.1| PREDICTED: clavaminate synthase-like protein At3g21360 [Solanum 
lycopersicum]
Length=322

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D   A+ F DG  +P  I+  C  I+EEES+   W+KGDVL +DN A LH R+P LPPR+
Sbjct  257  DISSAMMF-DGTEIPQNIVKRCEEIIEEESIQFKWQKGDVLFLDNWATLHGRRPSLPPRK  315

Query  200  VLASLCK  220
            VL + CK
Sbjct  316  VLVATCK  322



>ref|WP_020193356.1| hypothetical protein, partial [Pseudomonas putida]
Length=179

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+  E++    A+L++ +++ PW++ DVL++DNM   HAR PF  PR+
Sbjct  106  DLPRNVYYGDGTPIENEVLERIRAVLDDCAISFPWQENDVLMLDNMLAAHARAPFTGPRK  165

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  166  VVVAMAQ  172



>ref|WP_035481516.1| hypothetical protein [Burkholderia phenoliruptrix]
Length=336

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+ + +A PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVYYGDGAPLEADALAQIRGVLDAQRIAFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAQ  326



>ref|WP_015477303.1| pyoverdine biosynthesis regulatory protein-TauD/TfdA family protein 
[Pseudomonas denitrificans]
 gb|AGI24445.1| pyoverdine biosynthesis regulatory protein-TauD/TfdA family protein 
[Pseudomonas denitrificans ATCC 13867]
Length=328

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+   ++ +   +LEE  V+ PW  GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEPSVLDEIRGVLEEVKVSFPWTSGDVLMLDNMLAAHARSPFSGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VVVAMAE  320



>ref|WP_014972481.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia phenoliruptrix]
 gb|AFT88574.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia phenoliruptrix 
BR3459a]
Length=336

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  11   ARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLP  190
             R +  + V +GDG PL A  +     +L+ + +A PW+ GDVL++DNM   HAR PF  
Sbjct  257  GRENVPRNVYYGDGAPLEAGALAQIRGVLDAQRIAFPWQTGDVLMLDNMLTAHARDPFEG  316

Query  191  PRRVLASLCK  220
            PR+V+ ++ +
Sbjct  317  PRKVVVAMAQ  326



>gb|ENO99089.1| taurine catabolism dioxygenase TauD, TfdA family protein 2 [Thauera 
phenylacetica B4P]
Length=281

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            +   F DG P+P  ++ D  A+L+ E+V+  W+KGDV ++DNM + HAR PF  PR+V+ 
Sbjct  210  RNTYFADGSPIPDAMLDDVRAVLDAETVSFLWEKGDVTMLDNMLIAHARSPFKGPRKVVV  269

Query  209  SLCK  220
            ++ +
Sbjct  270  AMAE  273



>ref|WP_039737043.1| taurine catabolism dioxygenase TauD [Hassallia byssoidea]
 gb|KIF37505.1| taurine catabolism dioxygenase TauD [Hassallia byssoidea VB512170]
Length=342

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  41   FGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLASLCK  220
            +GDG P+   ++       ++E V   W+KGDVL++DNM  +HARKPF+PPR++L  + +
Sbjct  276  YGDGSPIEPSVLAHLREAYQQEMVIFSWQKGDVLMLDNMLSIHARKPFVPPRKILVGMAE  335



>ref|WP_016773893.1| syrP protein [Pseudomonas sp. R62]
Length=327

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+  E++    A+L++ +++ PW++GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEDEVLAQIRAVLDDCAISFPWQEGDVLMLDNMLSAHARSPFEGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VIVAMAE  320



>ref|WP_042608395.1| SyrP [Pseudomonas fluorescens]
 gb|KIP93422.1| SyrP [Pseudomonas fluorescens]
Length=327

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+  E++    A+L++ +++ PW++GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEDEVLAQIRAVLDDCAISFPWQEGDVLMLDNMLSAHARSPFEGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VIVAMAE  320



>ref|WP_024012352.1| syrP protein [Pseudomonas moraviensis]
 gb|ETF09142.1| syrP protein [Pseudomonas moraviensis R28-S]
Length=327

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  20   DPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRR  199
            D  + V +GDG P+  E++    A+L++ +++ PW++GDVL++DNM   HAR PF  PR+
Sbjct  254  DLPRNVYYGDGSPIEDEVLAQIRAVLDDCAISFPWQEGDVLMLDNMLSAHARSPFEGPRK  313

Query  200  VLASLCK  220
            V+ ++ +
Sbjct  314  VIVAMAE  320



>dbj|BAO91577.1| taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. RPE67]
Length=334

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +A PW  GDVL++DNM   HAR PF  PR+V+ 
Sbjct  265  RNVFYGDGAPLEADALAEIRAVLDAQRIAFPWLSGDVLMLDNMLTAHARDPFEGPRKVVV  324

Query  209  SLCK  220
            ++ +
Sbjct  325  AMAQ  328



>ref|WP_013591052.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. CCGE1001]
 gb|ADX57947.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. CCGE1001]
Length=336

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ +     +L+ + +A PW+ GDVL++DNM   HAR PF  PR+V+ 
Sbjct  263  RNVYYGDGAPLEADALAQIRGVLDAQRIAFPWQTGDVLMLDNMLTAHARDPFEGPRKVVV  322

Query  209  SLCK  220
            ++ +
Sbjct  323  AMAQ  326



>ref|WP_014252022.1| taurine catabolism dioxygenase tauD/tfdA [Burkholderia sp. YI23]
 gb|AET93754.1| Taurine catabolism dioxygenase TauD/TfdA [Burkholderia sp. YI23]
Length=334

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  29   KAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPFLPPRRVLA  208
            + V +GDG PL A+ + +  A+L+ + +A PW  GDVL++DNM   HAR PF  PR+V+ 
Sbjct  265  RNVFYGDGAPLEADALAEIRAVLDAQRIAFPWLSGDVLMLDNMLTAHARDPFEGPRKVVV  324

Query  209  SLCK  220
            ++ +
Sbjct  325  AMAQ  328



>ref|WP_035488733.1| SyrP protein [Gammaproteobacteria bacterium MOLA455]
 gb|ETN92572.1| Taurine catabolism dioxygenase TauD, TfdA family [Gammaproteobacteria 
bacterium MOLA455]
Length=345

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    EDARNDPKKAVTFGDGKPLPAEIIHDCLAILEEESVAVPWKKGDVLLIDNMAVLHARKPF  184
            +DARN  +K++ FGDG  + +  +   + + ++ +  +PW+ GDV+++DN  V+H R+PF
Sbjct  274  KDARNSGEKSICFGDGSAIDSNHMALAIELADQLTFDIPWQSGDVVVLDNFLVMHGRRPF  333

Query  185  LPPRRVLASL  214
               R VLASL
Sbjct  334  QGKRAVLASL  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551197703000