BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003D05 593 bp,:Filtered

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605076.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    171   2e-48   Nicotiana tomentosiformis
ref|XP_009783290.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    169   1e-47   Nicotiana sylvestris
ref|XP_004245850.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    163   4e-45   Solanum lycopersicum
ref|XP_006358616.1|  PREDICTED: mediator of RNA polymerase II tra...    160   3e-44   Solanum tuberosum [potatoes]
ref|XP_009628283.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    158   3e-43   Nicotiana tomentosiformis
ref|XP_006385591.1|  hypothetical protein POPTR_0003s08390g             156   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011018663.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like    155   5e-42   Populus euphratica
ref|XP_004241978.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    154   1e-41   Solanum lycopersicum
gb|KJB51742.1|  hypothetical protein B456_008G229800                    152   2e-41   Gossypium raimondii
gb|KJB51741.1|  hypothetical protein B456_008G229800                    152   3e-41   Gossypium raimondii
gb|KDP45979.1|  hypothetical protein JCGZ_11882                         153   3e-41   Jatropha curcas
ref|XP_006385395.1|  hypothetical protein POPTR_0003s03410g             152   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_009792529.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...    151   3e-41   Nicotiana sylvestris
ref|XP_006387767.1|  hypothetical protein POPTR_0599s00200g             151   5e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006361168.1|  PREDICTED: RING finger protein B-like              152   5e-41   Solanum tuberosum [potatoes]
gb|KJB51740.1|  hypothetical protein B456_008G229800                    152   6e-41   Gossypium raimondii
gb|KJB51739.1|  hypothetical protein B456_008G229800                    152   6e-41   Gossypium raimondii
ref|XP_006385396.1|  hypothetical protein POPTR_0003s03410g             152   8e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011032004.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    152   8e-41   Populus euphratica
ref|XP_009592197.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    151   8e-41   Nicotiana tomentosiformis
ref|XP_009592196.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    151   9e-41   Nicotiana tomentosiformis
ref|XP_009792528.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    151   1e-40   Nicotiana sylvestris
gb|KHG20390.1|  Baculoviral IAP repeat-containing 7-A                   149   4e-40   Gossypium arboreum [tree cotton]
emb|CDP13426.1|  unnamed protein product                                150   5e-40   Coffea canephora [robusta coffee]
ref|XP_006477044.1|  PREDICTED: probable BOI-related E3 ubiquitin...    149   7e-40   Citrus sinensis [Valencia orange]
ref|XP_007039620.1|  SBP family protein                                 149   9e-40   Theobroma cacao [chocolate]
emb|CBI33972.3|  unnamed protein product                                147   1e-39   Vitis vinifera
gb|KDO52692.1|  hypothetical protein CISIN_1g016506mg                   147   2e-39   Citrus sinensis [Valencia orange]
ref|XP_006440127.1|  hypothetical protein CICLE_v10020548mg             147   6e-39   Citrus clementina
gb|KDO52691.1|  hypothetical protein CISIN_1g016506mg                   147   6e-39   Citrus sinensis [Valencia orange]
ref|XP_006440126.1|  hypothetical protein CICLE_v10020548mg             147   7e-39   Citrus clementina
gb|KDO52690.1|  hypothetical protein CISIN_1g016506mg                   147   7e-39   Citrus sinensis [Valencia orange]
gb|KJB25418.1|  hypothetical protein B456_004G190300                    145   9e-39   Gossypium raimondii
ref|XP_004244705.1|  PREDICTED: probable BOI-related E3 ubiquitin...    146   9e-39   Solanum lycopersicum
ref|XP_006440125.1|  hypothetical protein CICLE_v10020548mg             146   2e-38   Citrus clementina
gb|KDO52689.1|  hypothetical protein CISIN_1g016506mg                   146   2e-38   Citrus sinensis [Valencia orange]
ref|XP_002528801.1|  ubiquitin-protein ligase, putative                 142   2e-38   
gb|KJB25417.1|  hypothetical protein B456_004G190300                    145   2e-38   Gossypium raimondii
ref|XP_002279666.1|  PREDICTED: probable BOI-related E3 ubiquitin...    144   3e-38   Vitis vinifera
ref|XP_008229503.1|  PREDICTED: E3 ubiquitin-protein ligase BOI i...    144   4e-38   Prunus mume [ume]
ref|XP_008229502.1|  PREDICTED: E3 ubiquitin-protein ligase BOI i...    144   4e-38   Prunus mume [ume]
ref|XP_009789661.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    144   4e-38   Nicotiana sylvestris
gb|KHG02715.1|  Baculoviral IAP repeat-containing 2                     144   5e-38   Gossypium arboreum [tree cotton]
ref|XP_009789725.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    144   5e-38   Nicotiana sylvestris
ref|XP_010110525.1|  hypothetical protein L484_023358                   144   8e-38   Morus notabilis
ref|XP_008356461.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like    143   9e-38   Malus domestica [apple tree]
ref|XP_004300294.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    142   2e-37   Fragaria vesca subsp. vesca
gb|KJB39791.1|  hypothetical protein B456_007G030800                    140   9e-37   Gossypium raimondii
ref|XP_009371860.1|  PREDICTED: E3 ubiquitin-protein ligase BOI         140   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_010274557.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    140   2e-36   Nelumbo nucifera [Indian lotus]
gb|KJB21031.1|  hypothetical protein B456_003G179400                    139   2e-36   Gossypium raimondii
gb|KJB39790.1|  hypothetical protein B456_007G030800                    139   3e-36   Gossypium raimondii
gb|KHF98414.1|  Baculoviral IAP repeat-containing 4                     138   8e-36   Gossypium arboreum [tree cotton]
ref|XP_010269870.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    138   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006362485.1|  PREDICTED: uncharacterized protein LOC102594630    137   2e-35   Solanum tuberosum [potatoes]
gb|KHG04417.1|  Baculoviral IAP repeat-containing 7-A                   137   3e-35   Gossypium arboreum [tree cotton]
gb|KJB21032.1|  hypothetical protein B456_003G179400                    136   4e-35   Gossypium raimondii
ref|XP_008465916.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    132   2e-33   Cucumis melo [Oriental melon]
ref|XP_004173995.1|  PREDICTED: uncharacterized protein LOC101229955    132   2e-33   
ref|XP_004148373.1|  PREDICTED: uncharacterized protein LOC101213134    132   2e-33   
ref|XP_010677203.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    128   5e-32   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010053562.1|  PREDICTED: E3 ubiquitin-protein ligase BOI i...    127   8e-32   Eucalyptus grandis [rose gum]
ref|XP_010053560.1|  PREDICTED: E3 ubiquitin-protein ligase BOI i...    126   3e-31   Eucalyptus grandis [rose gum]
ref|XP_006600884.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...    125   6e-31   Glycine max [soybeans]
ref|XP_006600883.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...    124   8e-31   
ref|XP_006579664.1|  PREDICTED: probable BOI-related E3 ubiquitin...    125   9e-31   Glycine max [soybeans]
ref|XP_003524323.1|  PREDICTED: probable BOI-related E3 ubiquitin...    125   9e-31   Glycine max [soybeans]
ref|XP_004511753.1|  PREDICTED: transcription factor SPT20 homolog      124   1e-30   
ref|XP_007155735.1|  hypothetical protein PHAVU_003G227200g             124   2e-30   Phaseolus vulgaris [French bean]
ref|XP_003549963.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...    124   3e-30   Glycine max [soybeans]
ref|XP_006600882.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...    124   3e-30   Glycine max [soybeans]
gb|KEH27484.1|  SBP (S-ribonuclease-binding protein) family protein     120   1e-29   Medicago truncatula
ref|XP_004508983.1|  PREDICTED: baculoviral IAP repeat-containing...    120   3e-29   Cicer arietinum [garbanzo]
ref|XP_004508984.1|  PREDICTED: baculoviral IAP repeat-containing...    120   3e-29   Cicer arietinum [garbanzo]
ref|XP_003611413.1|  Baculoviral IAP repeat-containing protein          120   4e-29   Medicago truncatula
ref|XP_007156605.1|  hypothetical protein PHAVU_002G002700g             120   5e-29   Phaseolus vulgaris [French bean]
ref|XP_006590588.1|  PREDICTED: probable BOI-related E3 ubiquitin...    118   2e-28   Glycine max [soybeans]
ref|XP_004147249.1|  PREDICTED: uncharacterized protein LOC101209391    117   3e-28   Cucumis sativus [cucumbers]
ref|XP_006573701.1|  PREDICTED: probable BOI-related E3 ubiquitin...    116   1e-27   
gb|KEH31582.1|  SBP (S-ribonuclease-binding protein) family protein     110   6e-26   Medicago truncatula
gb|KEH31583.1|  SBP (S-ribonuclease-binding protein) family protein     110   1e-25   Medicago truncatula
ref|XP_010055389.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    108   7e-25   Eucalyptus grandis [rose gum]
ref|XP_006398399.1|  hypothetical protein EUTSA_v10000973mg             107   1e-24   Eutrema salsugineum
ref|XP_008448752.1|  PREDICTED: probable BOI-related E3 ubiquitin...    107   3e-24   Cucumis melo [Oriental melon]
gb|KFK31409.1|  hypothetical protein AALP_AA6G108300                    105   7e-24   Arabis alpina [alpine rockcress]
emb|CDY43447.1|  BnaAnng07190D                                          105   8e-24   Brassica napus [oilseed rape]
ref|XP_009114308.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    105   1e-23   Brassica rapa
emb|CDX77733.1|  BnaC07g19870D                                          105   1e-23   Brassica napus [oilseed rape]
ref|XP_009101452.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    104   2e-23   Brassica rapa
emb|CDY33511.1|  BnaA06g35620D                                          104   2e-23   Brassica napus [oilseed rape]
ref|XP_009101453.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    104   2e-23   Brassica rapa
ref|XP_010481380.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    104   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010441512.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    104   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006305399.1|  hypothetical protein CARUB_v10009788mg             103   3e-23   Capsella rubella
ref|XP_010494913.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010480841.1|  PREDICTED: probable BOI-related E3 ubiquitin...    100   6e-23   Camelina sativa [gold-of-pleasure]
gb|AAF25971.1|AC017118_8  F6N18.12                                      101   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128924.1|  PREDICTED: E3 ubiquitin-protein ligase BOI i...    100   3e-22   Brassica rapa
ref|NP_564408.1|  SBP (S-ribonuclease binding protein) family pro...    100   4e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51856.1|  BnaC02g47560D                                          100   4e-22   Brassica napus [oilseed rape]
emb|CDY03162.1|  BnaC09g19940D                                          100   4e-22   Brassica napus [oilseed rape]
ref|XP_010461100.1|  PREDICTED: probable BOI-related E3 ubiquitin...  99.8    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010499827.1|  PREDICTED: probable BOI-related E3 ubiquitin...  99.0    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002891007.1|  hypothetical protein ARALYDRAFT_336359           98.6    2e-21   Arabidopsis lyrata subsp. lyrata
ref|NP_199516.1|  S-ribonuclease binding protein                      97.4    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280993.1|  hypothetical protein CARUB_v10027000mg           96.3    1e-20   Capsella rubella
ref|XP_006415155.1|  hypothetical protein EUTSA_v10008231mg           95.9    2e-20   Eutrema salsugineum
ref|XP_010538488.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  95.5    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010538489.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  95.5    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010538486.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  95.5    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_002865147.1|  ATP binding protein                              94.7    5e-20   Arabidopsis lyrata subsp. lyrata
gb|KHN01654.1|  Inhibitor of apoptosis protein                        89.4    4e-18   Glycine soja [wild soybean]
ref|XP_009388302.1|  PREDICTED: probable BOI-related E3 ubiquitin...  88.2    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN21049.1|  Baculoviral IAP repeat-containing protein 2           87.8    2e-17   Glycine soja [wild soybean]
ref|XP_009388296.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  87.8    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398480.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  87.8    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002868046.1|  predicted protein                                86.3    5e-17   Arabidopsis lyrata subsp. lyrata
ref|NP_001078402.1|  SBP (S-ribonuclease binding protein) family ...  85.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10548.1|  hypothetical protein                                 85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193503.2|  SBP (S-ribonuclease binding protein) family pro...  85.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389106.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  84.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006282676.1|  hypothetical protein CARUB_v10005312mg           84.3    2e-16   Capsella rubella
ref|XP_010529998.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  82.4    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010529996.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  82.4    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010529997.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  82.4    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010529995.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  82.4    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010434630.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  80.9    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010449576.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  80.5    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010919824.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  79.7    1e-14   Elaeis guineensis
ref|XP_009114864.1|  PREDICTED: probable BOI-related E3 ubiquitin...  77.4    2e-14   Brassica rapa
ref|XP_008788744.1|  PREDICTED: probable BOI-related E3 ubiquitin...  77.0    9e-14   
ref|XP_008794860.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  76.6    2e-13   Phoenix dactylifera
ref|XP_009385939.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  74.3    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854019.1|  hypothetical protein AMTR_s00048p00028800        74.3    1e-12   Amborella trichopoda
gb|KHN42644.1|  hypothetical protein glysoja_018887                   70.9    1e-11   Glycine soja [wild soybean]
ref|NP_001052694.1|  Os04g0402500                                     68.9    9e-11   
ref|XP_010100437.1|  Baculoviral IAP repeat-containing protein 3      68.9    1e-10   Morus notabilis
emb|CDX90458.1|  BnaA03g43230D                                        68.2    1e-10   Brassica napus [oilseed rape]
ref|XP_009136861.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       68.2    1e-10   Brassica rapa
gb|EAY93975.1|  hypothetical protein OsI_15752                        68.6    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007157438.1|  hypothetical protein PHAVU_002G070200g           68.6    1e-10   Phaseolus vulgaris [French bean]
ref|XP_009413247.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  67.8    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413245.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  67.8    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413246.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  67.8    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09609.1|  BnaC07g34520D                                        66.2    3e-10   Brassica napus [oilseed rape]
ref|XP_010242600.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  67.0    4e-10   Nelumbo nucifera [Indian lotus]
ref|XP_002314611.1|  hypothetical protein POPTR_0010s05200g           67.0    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002455243.1|  hypothetical protein SORBIDRAFT_03g006990        65.1    4e-10   Sorghum bicolor [broomcorn]
ref|XP_010547760.1|  PREDICTED: LOW QUALITY PROTEIN: probable BOI...  66.6    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_010475941.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  66.2    8e-10   Camelina sativa [gold-of-pleasure]
gb|ABD65150.1|  hypothetical protein 40.t00029                        65.9    8e-10   Brassica oleracea
ref|XP_010037555.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  66.2    9e-10   Eucalyptus grandis [rose gum]
ref|XP_008786211.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  66.2    9e-10   Phoenix dactylifera
ref|XP_009390342.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  65.5    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146990.1|  S-ribonuclease binding protein SBP1              65.5    1e-09   Zea mays [maize]
ref|XP_003517702.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  65.9    1e-09   Glycine max [soybeans]
ref|XP_002511385.1|  ATP binding protein, putative                    65.5    1e-09   Ricinus communis
gb|KHN14568.1|  Baculoviral IAP repeat-containing protein 3           65.9    1e-09   Glycine soja [wild soybean]
gb|KCW49269.1|  hypothetical protein EUGRSUZ_K02834                   65.5    1e-09   Eucalyptus grandis [rose gum]
ref|XP_002892588.1|  hypothetical protein ARALYDRAFT_471187           65.1    1e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010458424.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  65.5    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010935032.1|  PREDICTED: probable BOI-related E3 ubiquitin...  65.5    1e-09   Elaeis guineensis
ref|XP_006653358.1|  PREDICTED: uncharacterized protein LOC102701815  64.7    2e-09   Oryza brachyantha
ref|XP_010651528.1|  PREDICTED: probable BOI-related E3 ubiquitin...  65.5    2e-09   Vitis vinifera
gb|AFW72845.1|  putative RING zinc finger domain superfamily protein  65.5    2e-09   Zea mays [maize]
ref|XP_010248512.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  65.5    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_008643570.1|  PREDICTED: S-ribonuclease binding protein SB...  65.1    2e-09   Zea mays [maize]
ref|XP_010920103.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       64.3    2e-09   Elaeis guineensis
ref|XP_010475940.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  64.7    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007222413.1|  hypothetical protein PRUPE_ppa008184mg           64.7    3e-09   Prunus persica
ref|XP_004953488.1|  PREDICTED: RING finger protein B-like isofor...  65.1    3e-09   
ref|XP_008221847.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       64.7    3e-09   Prunus mume [ume]
ref|XP_004953489.1|  PREDICTED: RING finger protein B-like isofor...  64.7    3e-09   Setaria italica
ref|XP_008340066.1|  PREDICTED: probable BOI-related E3 ubiquitin...  64.3    4e-09   Malus domestica [apple tree]
ref|XP_010087677.1|  Baculoviral IAP repeat-containing protein 3      64.3    4e-09   Morus notabilis
ref|XP_008797654.1|  PREDICTED: probable BOI-related E3 ubiquitin...  63.9    4e-09   Phoenix dactylifera
gb|EEC67459.1|  hypothetical protein OsI_34686                        64.3    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009144425.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  64.3    4e-09   Brassica rapa
ref|XP_011001522.1|  PREDICTED: probable BOI-related E3 ubiquitin...  63.9    4e-09   Populus euphratica
emb|CDP07370.1|  unnamed protein product                              62.8    4e-09   Coffea canephora [robusta coffee]
emb|CDY20611.1|  BnaC08g14470D                                        64.3    4e-09   Brassica napus [oilseed rape]
gb|EAY87115.1|  hypothetical protein OsI_08517                        63.9    5e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAD07587.1|  S-ribonuclease binding protein SBP1-like             63.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251199.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  63.9    5e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004489827.1|  PREDICTED: RING finger protein B-like isofor...  63.9    6e-09   Cicer arietinum [garbanzo]
ref|XP_006853348.1|  hypothetical protein AMTR_s00032p00100570        63.5    6e-09   
ref|XP_006376864.1|  hypothetical protein POPTR_0012s08380g           63.5    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010682528.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  63.9    6e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001169020.1|  uncharacterized protein LOC100382853             63.5    6e-09   Zea mays [maize]
ref|XP_011001520.1|  PREDICTED: probable BOI-related E3 ubiquitin...  63.5    6e-09   Populus euphratica
ref|XP_002318654.1|  hypothetical protein POPTR_0012s08380g           63.5    7e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008389682.1|  PREDICTED: probable BOI-related E3 ubiquitin...  63.5    7e-09   Malus domestica [apple tree]
ref|XP_009380014.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  63.5    8e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151332.1|  inhibitor of apoptosis-like protein              63.2    8e-09   Zea mays [maize]
emb|CAN63942.1|  hypothetical protein VITISV_032504                   63.2    9e-09   Vitis vinifera
ref|XP_009148408.1|  PREDICTED: probable BOI-related E3 ubiquitin...  63.2    1e-08   Brassica rapa
gb|KGN62297.1|  hypothetical protein Csa_2G348840                     63.2    1e-08   Cucumis sativus [cucumbers]
ref|XP_002975512.1|  hypothetical protein SELMODRAFT_103907           62.0    1e-08   Selaginella moellendorffii
ref|XP_011045293.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  62.8    1e-08   Populus euphratica
emb|CDY20963.1|  BnaA08g25620D                                        62.8    1e-08   Brassica napus [oilseed rape]
ref|XP_011045301.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  62.8    1e-08   Populus euphratica
gb|KDP26612.1|  hypothetical protein JCGZ_17770                       62.8    1e-08   Jatropha curcas
gb|EPS57462.1|  hypothetical protein M569_17355                       61.6    1e-08   Genlisea aurea
ref|XP_008809449.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  61.6    1e-08   Phoenix dactylifera
ref|NP_001176584.1|  Os11g0542100                                     62.4    1e-08   
emb|CDX93396.1|  BnaA06g06520D                                        62.4    2e-08   Brassica napus [oilseed rape]
gb|ABA94142.1|  expressed protein                                     62.0    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006305283.1|  hypothetical protein CARUB_v10009658mg           62.4    2e-08   Capsella rubella
ref|XP_008799430.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  62.0    2e-08   Phoenix dactylifera
ref|XP_001752458.1|  predicted protein                                60.5    2e-08   Physcomitrella patens
ref|XP_008444346.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  62.0    2e-08   Cucumis melo [Oriental melon]
ref|XP_004297394.1|  PREDICTED: probable BOI-related E3 ubiquitin...  62.0    3e-08   Fragaria vesca subsp. vesca
ref|XP_006392142.1|  hypothetical protein EUTSA_v10023576mg           61.6    3e-08   Eutrema salsugineum
ref|XP_006356429.1|  PREDICTED: baculoviral IAP repeat-containing...  61.6    3e-08   Solanum tuberosum [potatoes]
ref|XP_003519957.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  61.6    3e-08   Glycine max [soybeans]
ref|XP_003570124.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  61.6    3e-08   Brachypodium distachyon [annual false brome]
gb|KHN00365.1|  Baculoviral IAP repeat-containing protein 3           61.6    3e-08   Glycine soja [wild soybean]
ref|XP_009404714.1|  PREDICTED: probable BOI-related E3 ubiquitin...  61.6    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE51417.1|  hypothetical protein OsJ_32495                        61.2    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302505.1|  hypothetical protein CARUB_v10020606mg           61.6    4e-08   Capsella rubella
gb|KDP31086.1|  hypothetical protein JCGZ_11462                       61.2    4e-08   Jatropha curcas
emb|CDY37958.1|  BnaC05g08160D                                        61.2    4e-08   Brassica napus [oilseed rape]
gb|EPS71986.1|  hypothetical protein M569_02783                       60.5    5e-08   Genlisea aurea
ref|XP_010510934.1|  PREDICTED: probable BOI-related E3 ubiquitin...  61.2    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004975499.1|  PREDICTED: uncharacterized protein LOC101772356  61.2    5e-08   Setaria italica
ref|XP_010911797.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  60.1    5e-08   Elaeis guineensis
gb|EYU35171.1|  hypothetical protein MIMGU_mgv1a018739mg              60.8    5e-08   Erythranthe guttata [common monkey flower]
ref|XP_002452733.1|  hypothetical protein SORBIDRAFT_04g031490        61.2    5e-08   Sorghum bicolor [broomcorn]
ref|XP_010473239.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.8    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006417440.1|  hypothetical protein EUTSA_v10008132mg           60.8    6e-08   Eutrema salsugineum
emb|CBI28557.3|  unnamed protein product                              60.8    6e-08   Vitis vinifera
ref|NP_176260.1|  putative S-ribonuclease binding protein             60.8    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAB71973.1|  Unknown protein                                       60.8    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438334.1|  hypothetical protein CICLE_v10032055mg           60.5    7e-08   Citrus clementina
gb|EYU28443.1|  hypothetical protein MIMGU_mgv1a0093071mg             60.5    8e-08   Erythranthe guttata [common monkey flower]
ref|XP_006652240.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.5    8e-08   Oryza brachyantha
gb|AAM61038.1|  S-ribonuclease binding protein SBP1, putative         60.5    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390377.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.5    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006483894.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.1    9e-08   Citrus sinensis [Valencia orange]
gb|KJB17203.1|  hypothetical protein B456_002G185700                  60.5    9e-08   Gossypium raimondii
gb|KDO36308.1|  hypothetical protein CISIN_1g026366mg                 59.3    1e-07   Citrus sinensis [Valencia orange]
ref|XP_009397722.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS54504.1|  hypothetical protein TRIUR3_32073                     60.1    1e-07   Triticum urartu
emb|CAN75320.1|  hypothetical protein VITISV_003762                   60.1    1e-07   Vitis vinifera
ref|XP_009773985.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  60.1    1e-07   Nicotiana sylvestris
ref|XP_006857405.1|  hypothetical protein AMTR_s00067p00146050        59.7    1e-07   
gb|EMT06341.1|  hypothetical protein F775_08568                       60.1    1e-07   Aegilops tauschii
ref|XP_002282390.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.7    1e-07   Vitis vinifera
ref|XP_010663160.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    1e-07   Vitis vinifera
gb|AEW09099.1|  hypothetical protein CL3803Contig1_04                 55.8    1e-07   Pinus radiata
ref|XP_002306946.1|  hypothetical protein POPTR_0005s26410g           59.3    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008812698.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.7    1e-07   Phoenix dactylifera
ref|XP_008812700.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.7    1e-07   Phoenix dactylifera
ref|XP_004236214.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.7    2e-07   Solanum lycopersicum
ref|XP_007044691.1|  ATP binding protein, putative isoform 1          59.7    2e-07   Theobroma cacao [chocolate]
ref|XP_011003059.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.9    2e-07   Populus euphratica
ref|XP_006469661.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    2e-07   Citrus sinensis [Valencia orange]
ref|XP_009103847.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.3    2e-07   Brassica rapa
ref|XP_010266836.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.9    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006469659.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    2e-07   Citrus sinensis [Valencia orange]
gb|KHF97887.1|  Baculoviral IAP repeat-containing 3                   59.3    2e-07   Gossypium arboreum [tree cotton]
ref|XP_004983614.1|  PREDICTED: uncharacterized abhydrolase domai...  59.3    2e-07   Setaria italica
ref|XP_010240958.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006439839.1|  hypothetical protein CICLE_v10021322mg           59.3    2e-07   Citrus clementina
ref|XP_004983613.1|  PREDICTED: uncharacterized abhydrolase domai...  59.3    2e-07   Setaria italica
ref|XP_006840685.1|  hypothetical protein AMTR_s00096p00060800        59.3    2e-07   Amborella trichopoda
emb|CDP13182.1|  unnamed protein product                              59.3    2e-07   Coffea canephora [robusta coffee]
ref|XP_010491705.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.3    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010240950.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.3    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008812701.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.3    2e-07   Phoenix dactylifera
gb|ABA27035.1|  TO65-3                                                56.2    2e-07   Taraxacum officinale [dandelion]
dbj|BAJ92369.1|  predicted protein                                    58.9    2e-07   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009773809.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.9    2e-07   Nicotiana sylvestris
gb|EMS58871.1|  hypothetical protein TRIUR3_19026                     58.2    2e-07   Triticum urartu
ref|XP_010240980.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  59.3    2e-07   Nelumbo nucifera [Indian lotus]
emb|CBI21767.3|  unnamed protein product                              58.9    2e-07   Vitis vinifera
ref|XP_010644986.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.5    3e-07   Vitis vinifera
ref|XP_010417995.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010678784.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.5    3e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
dbj|BAK05571.1|  predicted protein                                    58.9    3e-07   
ref|XP_002886605.1|  protein binding protein                          58.9    3e-07   
ref|XP_011083458.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  58.5    3e-07   
ref|XP_009137018.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  58.5    3e-07   
ref|XP_011083460.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  58.2    3e-07   
emb|CDY13070.1|  BnaA09g17470D                                        58.2    3e-07   
emb|CDY71192.1|  BnaCnng71790D                                        58.2    3e-07   
ref|XP_004291341.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.2    3e-07   
emb|CDY71607.1|  BnaAnng38140D                                        58.5    4e-07   
dbj|BAK00321.1|  predicted protein                                    58.5    4e-07   
ref|XP_010678783.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  58.5    4e-07   
emb|CDY01615.1|  BnaC07g36050D                                        58.5    4e-07   
ref|XP_009113878.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  58.2    4e-07   
ref|NP_001117260.1|  putative S-ribonuclease binding protein SBP1     58.2    4e-07   
ref|XP_001770762.1|  predicted protein                                57.8    4e-07   
ref|XP_008813803.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.5    4e-07   
ref|XP_009421000.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.2    4e-07   
ref|XP_003574031.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  58.5    4e-07   
ref|XP_001752164.1|  predicted protein                                57.4    4e-07   
ref|XP_002510571.1|  ATP binding protein, putative                    57.8    4e-07   
ref|XP_008807159.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  57.4    5e-07   
ref|XP_011101315.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  58.2    5e-07   
ref|XP_011101313.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  58.2    5e-07   
ref|XP_011086587.1|  PREDICTED: probable BOI-related E3 ubiquitin...  58.2    5e-07   
ref|XP_006844713.1|  hypothetical protein AMTR_s00016p00251370        58.2    5e-07   
ref|XP_009595910.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  58.2    5e-07   
emb|CDY46345.1|  BnaC01g30250D                                        57.8    5e-07   
gb|AFK41356.1|  unknown                                               55.1    5e-07   
dbj|BAD95238.1|  At1g10650                                            58.2    5e-07   
gb|KJB50227.1|  hypothetical protein B456_008G159600                  58.2    5e-07   
ref|XP_009397559.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  58.2    5e-07   
ref|XP_001764877.1|  predicted protein                                57.4    6e-07   
ref|NP_172535.1|  putative S-ribonuclease binding protein SBP1        58.2    6e-07   
ref|XP_003604051.1|  Baculoviral IAP repeat-containing protein        56.6    6e-07   
gb|AGT16109.1|  hypothetical protein SHCRBa_074_M02_R_10              56.6    6e-07   
gb|ACN37072.1|  unknown                                               57.8    6e-07   
ref|XP_006344404.1|  PREDICTED: uncharacterized protein LOC102589...  57.8    6e-07   
gb|KJB59748.1|  hypothetical protein B456_009G269400                  57.4    7e-07   
gb|ACL52541.1|  unknown                                               57.8    7e-07   
ref|NP_001145762.1|  uncharacterized LOC100279269                     57.8    7e-07   
ref|XP_009404199.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.8    7e-07   
gb|AAF17669.1|AC009398_18  F20B24.9                                   57.8    7e-07   
ref|XP_008809947.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.8    8e-07   
dbj|BAJ53103.1|  JHL20J20.10                                          57.0    8e-07   
dbj|BAK02282.1|  predicted protein                                    57.4    8e-07   
ref|XP_006647704.1|  PREDICTED: LOW QUALITY PROTEIN: BOI-related ...  57.4    9e-07   
ref|XP_007210966.1|  hypothetical protein PRUPE_ppa022731mg           57.0    9e-07   
ref|XP_010095524.1|  hypothetical protein L484_015994                 56.6    9e-07   
ref|XP_003572572.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.0    1e-06   
ref|XP_010092657.1|  hypothetical protein L484_006254                 57.0    1e-06   
dbj|BAJ94916.1|  predicted protein                                    57.0    1e-06   
ref|XP_010693160.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.4    1e-06   
ref|XP_010265999.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.6    1e-06   
ref|XP_006398155.1|  hypothetical protein EUTSA_v10001241mg           57.0    1e-06   
ref|XP_002450892.1|  hypothetical protein SORBIDRAFT_05g020720        56.6    1e-06   
ref|XP_008221230.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.0    1e-06   
ref|XP_003576002.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  57.0    1e-06   
ref|XP_006648281.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.0    1e-06   
ref|XP_003576000.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.0    1e-06   
ref|XP_004952607.1|  PREDICTED: uncharacterized protein LOC101765852  57.0    1e-06   
emb|CDY18062.1|  BnaA01g23230D                                        56.6    1e-06   
ref|XP_010941250.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  57.0    1e-06   
ref|XP_009106096.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  56.6    1e-06   
gb|KJB63493.1|  hypothetical protein B456_010G002400                  56.6    1e-06   
ref|XP_009123622.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  56.6    1e-06   
ref|NP_001052696.1|  Os04g0403200                                     56.6    1e-06   
emb|CDY26402.1|  BnaA02g23680D                                        56.6    2e-06   
gb|EYU22122.1|  hypothetical protein MIMGU_mgv1a009853mg              56.6    2e-06   
ref|XP_004975497.1|  PREDICTED: uncharacterized protein LOC101771554  56.6    2e-06   
gb|ACA64816.1|  SKIP interacting protein 23                           56.2    2e-06   
ref|XP_011034989.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    2e-06   
ref|XP_007160863.1|  hypothetical protein PHAVU_001G023100g           56.2    2e-06   
gb|EAZ23266.1|  hypothetical protein OsJ_06960                        56.6    2e-06   
ref|XP_004954957.1|  PREDICTED: uncharacterized protein LOC101754387  57.0    2e-06   
dbj|BAD25386.1|  SBP1-like                                            56.6    2e-06   
ref|XP_010929532.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    2e-06   
ref|XP_007224119.1|  hypothetical protein PRUPE_ppa015770mg           56.2    2e-06   
ref|XP_010929531.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    2e-06   
ref|XP_002464911.1|  hypothetical protein SORBIDRAFT_01g028680        56.2    2e-06   
ref|XP_010929530.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    2e-06   
ref|XP_010929529.1|  PREDICTED: uncharacterized protein LOC105050...  56.2    2e-06   
ref|XP_004293740.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  56.2    2e-06   
ref|XP_004238654.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       56.2    2e-06   
ref|XP_006422590.1|  hypothetical protein CICLE_v10028906mg           55.8    3e-06   
ref|XP_008797073.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    3e-06   
ref|XP_008797071.1|  PREDICTED: probable BOI-related E3 ubiquitin...  56.2    3e-06   
ref|XP_007022242.1|  SBP family protein, putative                     55.8    3e-06   
ref|NP_001046988.1|  Os02g0524500                                     56.2    3e-06   
gb|KDO68076.1|  hypothetical protein CISIN_1g021834mg                 55.8    3e-06   
ref|XP_006486730.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.8    3e-06   
ref|XP_004952013.1|  PREDICTED: uncharacterized protein LOC101785147  55.8    3e-06   
ref|XP_010529288.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  55.8    3e-06   
ref|XP_007017864.1|  SBP family protein, putative                     55.8    3e-06   
emb|CDX88507.1|  BnaC06g39510D                                        55.5    3e-06   
gb|KHN27726.1|  hypothetical protein glysoja_025531                   55.5    3e-06   
ref|XP_009796179.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  55.5    4e-06   
ref|XP_001774030.1|  predicted protein                                55.8    4e-06   
ref|XP_004170559.1|  PREDICTED: baculoviral IAP repeat-containing...  54.7    4e-06   
gb|EPS66413.1|  hypothetical protein M569_08369                       53.5    4e-06   
ref|XP_008679457.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  55.5    4e-06   
gb|KJB12786.1|  hypothetical protein B456_002G036500                  55.5    4e-06   
gb|KJB14381.1|  hypothetical protein B456_002G122300                  55.1    4e-06   
emb|CDP13601.1|  unnamed protein product                              55.5    4e-06   
gb|KJB12784.1|  hypothetical protein B456_002G036500                  55.5    4e-06   
ref|XP_009106631.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    4e-06   
gb|KHG12681.1|  Apoptosis inhibitor 1                                 54.7    4e-06   
ref|XP_003546794.2|  PREDICTED: probable BOI-related E3 ubiquitin...  55.5    4e-06   
ref|XP_009597083.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       55.5    5e-06   
emb|CDX87407.1|  BnaA07g34660D                                        55.1    5e-06   
ref|XP_010942313.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.5    5e-06   
ref|XP_010942314.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.5    5e-06   
ref|XP_006585416.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    5e-06   
ref|XP_009398965.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    5e-06   
ref|XP_008447126.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    5e-06   
ref|XP_010249378.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    5e-06   
ref|XP_010249377.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    5e-06   
ref|XP_004952606.1|  PREDICTED: uncharacterized protein LOC101765176  55.1    5e-06   
emb|CDY51918.1|  BnaC01g41070D                                        55.1    5e-06   
emb|CDY34127.1|  BnaC01g28670D                                        51.6    5e-06   
ref|XP_004139826.1|  PREDICTED: uncharacterized protein LOC101212862  55.1    5e-06   
ref|XP_010933546.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  54.7    5e-06   
ref|XP_010933545.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-l...  55.1    5e-06   
ref|XP_004979414.1|  PREDICTED: baculoviral IAP repeat-containing...  55.1    6e-06   
ref|XP_011092971.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    6e-06   
ref|XP_008357125.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    6e-06   
ref|NP_193705.1|  SBP (S-ribonuclease binding protein) family pro...  54.7    6e-06   
gb|KHN12793.1|  RING finger protein B                                 55.1    6e-06   
gb|AAL32681.1|  putative protein                                      54.7    6e-06   
ref|XP_009133197.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       54.7    6e-06   
ref|XP_003550333.1|  PREDICTED: probable BOI-related E3 ubiquitin...  55.1    6e-06   
ref|NP_001239697.1|  uncharacterized protein LOC100783373             55.1    6e-06   
ref|NP_001141047.1|  uncharacterized LOC100273128                     55.1    6e-06   
ref|XP_006413938.1|  hypothetical protein EUTSA_v10025664mg           54.7    6e-06   
ref|XP_009796699.1|  PREDICTED: E3 ubiquitin-protein ligase BOI       54.7    6e-06   
ref|XP_010107663.1|  putative E3 ubiquitin-protein ligase MGRN1       54.7    6e-06   
ref|XP_009400345.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  54.3    6e-06   
gb|EAY84340.1|  hypothetical protein OsI_05717                        54.7    7e-06   
ref|XP_003581168.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    7e-06   
ref|XP_010940173.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  54.7    7e-06   
ref|XP_011046677.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    7e-06   
ref|XP_010940174.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  54.7    7e-06   
dbj|BAD07738.1|  putative S-ribonuclease binding protein SBP1         54.3    7e-06   
dbj|BAD19942.1|  hypothetical protein                                 53.9    7e-06   
ref|NP_001045784.1|  Os02g0130300                                     54.7    7e-06   
gb|EMT23839.1|  hypothetical protein F775_07805                       54.7    8e-06   
ref|XP_010059921.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    8e-06   
ref|XP_006282459.1|  hypothetical protein CARUB_v10005280mg           54.7    8e-06   
ref|XP_003589169.1|  Baculoviral IAP repeat-containing protein        54.7    8e-06   
ref|XP_002867924.1|  hypothetical protein ARALYDRAFT_914691           54.3    8e-06   
ref|XP_007149286.1|  hypothetical protein PHAVU_005G057600g           54.7    8e-06   
ref|XP_009383394.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    8e-06   
ref|XP_011072140.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  54.7    8e-06   
gb|KFK41850.1|  hypothetical protein AALP_AA2G179000                  54.3    8e-06   
ref|XP_002305522.2|  hypothetical protein POPTR_0004s18150g           54.3    9e-06   
ref|XP_010690363.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    9e-06   
ref|XP_009383395.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    9e-06   
ref|XP_002446385.1|  hypothetical protein SORBIDRAFT_06g015100        54.3    9e-06   
ref|XP_004979415.1|  PREDICTED: baculoviral IAP repeat-containing...  54.3    1e-05   
ref|XP_010657615.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    1e-05   
ref|XP_002279403.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    1e-05   
ref|XP_004499050.1|  PREDICTED: RING finger protein B-like            54.3    1e-05   
ref|XP_003576001.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    1e-05   
ref|XP_002274721.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    1e-05   
ref|XP_011083881.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.3    1e-05   
ref|XP_009397341.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.9    1e-05   
gb|AAF28357.2|AF223395_1  S-ribonuclease binding protein SBP1         54.3    1e-05   
gb|ABB77434.1|  S-RNase-binding protein                               54.3    1e-05   
ref|XP_002452185.1|  hypothetical protein SORBIDRAFT_04g021320        54.3    1e-05   
gb|AFW71614.1|  putative RING zinc finger domain superfamily protein  52.0    1e-05   
ref|NP_001148208.1|  S-ribonuclease binding protein SBP1              53.9    1e-05   
gb|AAM67026.1|  unknown                                               53.9    1e-05   
ref|XP_010536507.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  53.9    1e-05   
ref|NP_001148476.1|  inhibitor of apoptosis-like protein              53.9    1e-05   
ref|XP_002453251.1|  hypothetical protein SORBIDRAFT_04g002540        53.9    1e-05   
tpg|DAA38010.1|  TPA: putative RING zinc finger domain superfamil...  53.9    1e-05   
ref|XP_009124688.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.9    1e-05   
gb|AFK48352.1|  unknown                                               50.4    1e-05   
ref|NP_566438.1|  protein BOI-related gene 3                          53.9    1e-05   
ref|XP_007017198.1|  S-ribonuclease binding protein 1                 53.9    1e-05   
emb|CDY24237.1|  BnaC01g38170D                                        53.9    1e-05   
ref|XP_008347618.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.9    1e-05   
ref|XP_010242079.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.9    1e-05   
ref|XP_009374981.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.4    1e-05   
ref|XP_008378031.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.9    1e-05   
gb|AFW63409.1|  putative RING zinc finger domain superfamily protein  53.9    1e-05   
dbj|BAO04295.1|  S-RNase binding protein 1                            53.5    2e-05   
ref|XP_008372035.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.5    2e-05   
emb|CAN63052.1|  hypothetical protein VITISV_027810                   53.9    2e-05   
ref|XP_011046102.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.5    2e-05   
ref|XP_009399070.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.5    2e-05   
ref|XP_008783738.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    2e-05   
ref|XP_009135263.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.5    2e-05   
ref|XP_004975496.1|  PREDICTED: uncharacterized protein LOC101771155  53.5    2e-05   
ref|XP_010056616.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  53.1    2e-05   
ref|XP_010909317.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    2e-05   
ref|XP_011076810.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  53.1    2e-05   
ref|XP_004163423.1|  PREDICTED: putative inhibitor of apoptosis-like  51.2    2e-05   
gb|AFW64919.1|  putative RING zinc finger domain superfamily protein  53.1    2e-05   
ref|XP_010909318.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    2e-05   
gb|EYU40440.1|  hypothetical protein MIMGU_mgv1a019506mg              52.8    2e-05   
ref|XP_008387919.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    2e-05   
ref|XP_010439661.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  53.1    2e-05   
ref|XP_007199425.1|  hypothetical protein PRUPE_ppa026502mg           53.1    2e-05   
ref|XP_008679459.1|  PREDICTED: E3 ubiquitin-protein ligase BOI-like  53.1    3e-05   
emb|CDP20640.1|  unnamed protein product                              53.1    3e-05   
ref|XP_008236025.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.8    3e-05   
gb|EYU36313.1|  hypothetical protein MIMGU_mgv1a009482mg              53.1    3e-05   
ref|XP_002884932.1|  protein binding protein                          53.1    3e-05   
ref|XP_007211500.1|  hypothetical protein PRUPE_ppa007884mg           53.1    3e-05   
ref|XP_006473694.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.8    3e-05   
gb|AGZ15275.1|  hypothetical protein                                  53.1    3e-05   
emb|CDY64561.1|  BnaCnng44050D                                        53.1    3e-05   
ref|XP_009621213.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    3e-05   
gb|KDO84920.1|  hypothetical protein CISIN_1g022683mg                 52.8    3e-05   
ref|XP_004291095.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    3e-05   
ref|XP_006434742.1|  hypothetical protein CICLE_v10001290mg           53.1    3e-05   
ref|XP_009146570.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    3e-05   
emb|CDX82568.1|  BnaA03g32530D                                        53.1    3e-05   
ref|XP_008236026.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.8    3e-05   
ref|XP_006435218.1|  hypothetical protein CICLE_v10003489mg           52.8    3e-05   
ref|XP_006407282.1|  hypothetical protein EUTSA_v10021066mg           53.1    3e-05   



>ref|XP_009605076.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 5/175 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRAL+GAAEES+AR+LREKEAE+EKAARRN+EL ARA QLSAEAQ
Sbjct  174  GEQLRRTLAEKRQRHYRALMGAAEESMARRLREKEAEMEKAARRNAELEARAAQLSAEAQ  233

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQARARAQEVTAATLQAQLQ  +MN G   ER DGN        ++      YIDPDRV
Sbjct  234  AWQARARAQEVTAATLQAQLQHAMMNGGGCNERNDGNGGGEPEDAESA-----YIDPDRV  288

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S GPSCKAC KR+ASVV+LPCRHLC+C+ CDAVAQACPLC S+RSSSVEVFLC
Sbjct  289  VESTGPSCKACGKRVASVVLLPCRHLCVCTECDAVAQACPLCFSIRSSSVEVFLC  343



>ref|XP_009783290.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nicotiana 
sylvestris]
Length=344

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 146/175 (83%), Gaps = 5/175 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRAL+GAAEES+AR+LREKEAE+EKA RRN+EL ARA QLSAEAQ
Sbjct  175  GEQLRRTLAEKRQRHYRALMGAAEESMARRLREKEAEMEKATRRNAELEARAAQLSAEAQ  234

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQARARAQEVTAATLQAQLQ  +MN G   ER+DGN        ++      YIDPDRV
Sbjct  235  AWQARARAQEVTAATLQAQLQHAMMNGGRCNERDDGNGGGEPEDAESA-----YIDPDRV  289

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S GPSCKAC KR+ASVV+LPCRHLC+C+ CDAVAQACPLC S+RSSSVEV+LC
Sbjct  290  VESTGPSCKACGKRVASVVLLPCRHLCVCTECDAVAQACPLCFSIRSSSVEVYLC  344



>ref|XP_004245850.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Solanum 
lycopersicum]
Length=348

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 144/176 (82%), Gaps = 7/176 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRAL+GAAEES+AR+LREKEAE+EKAARRN+EL AR  QLSAEAQ
Sbjct  179  GEQLRRTLAEKRQRHYRALIGAAEESMARRLREKEAEMEKAARRNAELEARVAQLSAEAQ  238

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQARARAQEVTAATLQAQLQ  ++N G   E  DGN         A      YIDPDRV
Sbjct  239  AWQARARAQEVTAATLQAQLQHAMINGGGCNEINDGNGGEPEDAESA------YIDPDRV  292

Query  169  VLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S G PSCKACRKR+ASVVVLPCRHLC+C+ CDAVAQACPLC ++RSSSVEVFLC
Sbjct  293  VESTGGPSCKACRKRVASVVVLPCRHLCMCTECDAVAQACPLCFAIRSSSVEVFLC  348



>ref|XP_006358616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Solanum tuberosum]
Length=346

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 143/176 (81%), Gaps = 7/176 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQ HYRAL+GAAEES+AR+LREKEAE+EKAARRN+EL ARA Q SAEAQ
Sbjct  177  GEQLRRTLAEKRQSHYRALIGAAEESMARRLREKEAEMEKAARRNAELEARAAQFSAEAQ  236

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQARARAQEVTAATLQAQLQ  ++N G   E  DGN         A      YIDPDRV
Sbjct  237  AWQARARAQEVTAATLQAQLQHAMINGGGCNEINDGNGGEPEDAESA------YIDPDRV  290

Query  169  VLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S G PSCKACRKR+ASVVVLPCRHLC+C+ CDAVAQACPLC ++RSSSVEVFLC
Sbjct  291  VESTGGPSCKACRKRVASVVVLPCRHLCICTECDAVAQACPLCFAIRSSSVEVFLC  346



>ref|XP_009628283.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nicotiana 
tomentosiformis]
Length=338

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 4/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTLEEKR+RHY ALLGA EE++AR+LREK+ EVEKAARRN+EL ARA QL+AEA+
Sbjct  164  GEQLRRTLEEKRKRHYHALLGATEETIARRLREKDTEVEKAARRNAELEARAVQLTAEAR  223

Query  349  awqara-raqevtaatlqaqlqqVIMNAGA-VQEREDGNapacgaggdaedaesAYIDPD  176
            AWQ +    +           Q  +MN G  + ER+DG   +CG   +  ++   Y+DPD
Sbjct  224  AWQTKTRELEVTAVTLQAQLQQVAMMNGGMNLPERDDGGGISCGGEAEDAESA--YVDPD  281

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            RVV S GPSCKACRKR ASVV+LPCRHLCLC+ CDAVAQ+CPLC S+RSSSVEVFLC
Sbjct  282  RVVESTGPSCKACRKRFASVVLLPCRHLCLCTECDAVAQSCPLCRSIRSSSVEVFLC  338



>ref|XP_006385591.1| hypothetical protein POPTR_0003s08390g [Populus trichocarpa]
 gb|ERP63388.1| hypothetical protein POPTR_0003s08390g [Populus trichocarpa]
Length=345

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 143/181 (79%), Gaps = 6/181 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALLGAAEES+AR+LREKE E+EKA RRN+EL ARA QLS +AQ
Sbjct  165  GEQLRRTLAEKRQRHYRALLGAAEESIARRLREKEMEIEKATRRNAELEARATQLSIDAQ  224

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNap-----acgaggdaedaesAYI  185
             WQA+ R QEVTAA+LQAQLQQ IMN G  Q+   G+              AEDAESAY+
Sbjct  225  VWQAKVRTQEVTAASLQAQLQQAIMNGGLAQDSRRGDDGIGCPGGVEGQTQAEDAESAYV  284

Query  184  DPDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DPDRV + PG PSCKACRKR+ASVV+LPCRHLC+C+ CD V  ACPLCL VR+SSVEVFL
Sbjct  285  DPDRVTVVPGGPSCKACRKRMASVVLLPCRHLCVCTECDQVVPACPLCLHVRNSSVEVFL  344

Query  7    C  5
            C
Sbjct  345  C  345



>ref|XP_011018663.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Populus euphratica]
Length=350

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR+L E+RQ+HYRALLGAAEES+AR+LRE+EAEV++A R+N+EL ARA QLS EAQ
Sbjct  170  GEQLRRSLAERRQQHYRALLGAAEESIARRLREREAEVQRATRKNAELEARASQLSIEAQ  229

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapac-----gaggdaedaesAYI  185
             WQA+AR QEVTA +LQAQLQQ IMN G VQ+   G+            G AEDAESAY+
Sbjct  230  VWQAKARTQEVTATSLQAQLQQAIMNGGVVQDSRRGDDGTGCSGGDEGQGQAEDAESAYV  289

Query  184  DPDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DPDRV + PG PSCK+CRKR+ASVV+LPCRHLC+C+ CD + QACPLCL VR+SSVEVFL
Sbjct  290  DPDRVTVVPGRPSCKSCRKRMASVVLLPCRHLCVCTECDQMVQACPLCLHVRNSSVEVFL  349

Query  7    C  5
            C
Sbjct  350  C  350



>ref|XP_004241978.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Solanum 
lycopersicum]
Length=331

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLE+KR+ HYRAL+G AEES+AR+L+EKEAEV KA RRN+EL ARA QLSAEAQA
Sbjct  160  EQLRRTLEDKRRAHYRALIGTAEESMARQLKEKEAEVGKAFRRNAELEARAAQLSAEAQA  219

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQER-EDGNapacgaggdaedaesAYIDPDRV  170
            WQARARA+E TAATLQAQLQQ +MN G       DG+    G   DAE A   YIDPDRV
Sbjct  220  WQARARAEEFTAATLQAQLQQAMMNGGGCNANLPDGDIAGAGEAEDAESA---YIDPDRV  276

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V + GPSCKACRKR+ASVV+LPCRHLC+C+ CDAV QACPLCLS+RSSSVEVFLC
Sbjct  277  VETTGPSCKACRKRVASVVLLPCRHLCVCTDCDAVVQACPLCLSIRSSSVEVFLC  331



>gb|KJB51742.1| hypothetical protein B456_008G229800 [Gossypium raimondii]
Length=296

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKR RH+RALLGAAEESVAR+LR+KEAEVEKA RRN+EL AR  QL+ E+Q
Sbjct  119  GEALRRTLAEKRHRHFRALLGAAEESVARRLRDKEAEVEKAKRRNAELEARVAQLNVESQ  178

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED---GNapacgaggdaedaesAYIDP  179
             WQA+ARAQE TAA+LQAQLQQ IM+ GA    +D   G        G A DAESAY+DP
Sbjct  179  VWQAKARAQEATAASLQAQLQQAIMSGGAAASMQDSRRGEEGVKCGEGQAVDAESAYVDP  238

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV S GP+CKACRKR+ASVV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE FL
Sbjct  239  DRVVASWGPACKACRKRLASVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEAFL  295



>gb|KJB51741.1| hypothetical protein B456_008G229800 [Gossypium raimondii]
Length=307

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKR RH+RALLGAAEESVAR+LR+KEAEVEKA RRN+EL AR  QL+ E+Q
Sbjct  130  GEALRRTLAEKRHRHFRALLGAAEESVARRLRDKEAEVEKAKRRNAELEARVAQLNVESQ  189

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED---GNapacgaggdaedaesAYIDP  179
             WQA+ARAQE TAA+LQAQLQQ IM+ GA    +D   G        G A DAESAY+DP
Sbjct  190  VWQAKARAQEATAASLQAQLQQAIMSGGAAASMQDSRRGEEGVKCGEGQAVDAESAYVDP  249

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV S GP+CKACRKR+ASVV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE FL
Sbjct  250  DRVVASWGPACKACRKRLASVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEAFL  306



>gb|KDP45979.1| hypothetical protein JCGZ_11882 [Jatropha curcas]
Length=359

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALL AA+E +AR+L EK  EVEKA RRN+EL ARA QLS EAQ
Sbjct  182  GEQLRRTLVEKRQRHYRALLSAADEVIARRLTEKNTEVEKATRRNAELEARAAQLSVEAQ  241

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQER---EDGNapacgaggdaedaesAYIDP  179
             WQA+ARAQE  AA+LQAQLQQ IM+ G  Q+    +DG   + G  G AEDAESAY+DP
Sbjct  242  VWQAKARAQESMAASLQAQLQQAIMSGGVAQDSRRGDDGLGCSGGVEGQAEDAESAYVDP  301

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +RV +S GPSCK CRKR A+VVVLPCRHLCLC+ CD VAQACPLCL VR+SSVEVFL
Sbjct  302  ERVTVSGGPSCKGCRKRAATVVVLPCRHLCLCTECDQVAQACPLCLQVRNSSVEVFL  358



>ref|XP_006385395.1| hypothetical protein POPTR_0003s03410g [Populus trichocarpa]
 gb|ERP63192.1| hypothetical protein POPTR_0003s03410g [Populus trichocarpa]
Length=310

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQ+HYRALLGAAEES+AR+LRE EAEV++A R+N+EL ARA QLS EAQ
Sbjct  130  GEQLRRALAEKRQQHYRALLGAAEESIARRLRESEAEVQRATRKNAELEARASQLSIEAQ  189

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQE-----REDGNapacgaggdaedaesAYI  185
             WQA+AR QEVTA +LQAQLQQ IMN G VQ+        G +      G AEDAESAY+
Sbjct  190  VWQAKARTQEVTATSLQAQLQQAIMNGGVVQDSRRGDGGTGCSGGVEGQGQAEDAESAYV  249

Query  184  DPDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DPDRV + PG PSCK+CRKR+ASVV+LPCRHLC+C+ CD + QACPLCL VR+SSVEVFL
Sbjct  250  DPDRVTVVPGRPSCKSCRKRMASVVLLPCRHLCVCTECDQMVQACPLCLHVRNSSVEVFL  309

Query  7    C  5
            C
Sbjct  310  C  310



>ref|XP_009792529.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X2 [Nicotiana 
sylvestris]
Length=290

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR TLEEKR+RHY ALLGAAEE++AR++REK+ EVEKA RRN+EL ARA QL+AEA+
Sbjct  116  GEQLRLTLEEKRKRHYHALLGAAEETIARRIREKDTEVEKATRRNAELEARAVQLTAEAR  175

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQ--EREDGNapacgaggdaedaesAYIDPD  176
            AWQA+AR QEVTAATLQAQLQQV M  G +   ER+DG   +C    +  ++   ++DPD
Sbjct  176  AWQAKAREQEVTAATLQAQLQQVAMMNGGINLPERDDGGGISCCGEAEDAESA--FVDPD  233

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV S GPSCK CRKR ASVV+LPCRHLCLC+ CDAVAQ+CPLC S+RSSSVEVFL
Sbjct  234  RVVESTGPSCKGCRKRFASVVMLPCRHLCLCTECDAVAQSCPLCRSIRSSSVEVFL  289



>ref|XP_006387767.1| hypothetical protein POPTR_0599s00200g [Populus trichocarpa]
 gb|ERP46681.1| hypothetical protein POPTR_0599s00200g [Populus trichocarpa]
Length=313

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQ+HYRALLGAAEES+AR+LRE EAEV++A R+N+EL ARA QLS EAQ
Sbjct  133  GEQLRRALAEKRQQHYRALLGAAEESIARRLRESEAEVQRATRKNAELEARASQLSIEAQ  192

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQE-----REDGNapacgaggdaedaesAYI  185
             WQA+AR QEVTA +LQAQLQQ IMN G VQ+        G +      G AEDAESAY+
Sbjct  193  VWQAKARTQEVTATSLQAQLQQAIMNGGVVQDSRRGDGGTGCSGGVEGQGQAEDAESAYV  252

Query  184  DPDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DPDRV + PG PSCK+CRKR+ASVV+LPCRHLC+C+ CD + QACPLCL VR+SSVEVFL
Sbjct  253  DPDRVTVVPGRPSCKSCRKRMASVVLLPCRHLCVCTECDQMVQACPLCLHVRNSSVEVFL  312

Query  7    C  5
            C
Sbjct  313  C  313



>ref|XP_006361168.1| PREDICTED: RING finger protein B-like [Solanum tuberosum]
Length=342

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 142/175 (81%), Gaps = 4/175 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLE+KR+ HYRAL+G A+ES+AR+L+EKEAEV KA R N+EL ARA QLSAEAQA
Sbjct  171  EQLRRTLEDKRRTHYRALIGTAKESMARQLKEKEAEVGKAVRHNAELEARAAQLSAEAQA  230

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQER-EDGNapacgaggdaedaesAYIDPDRV  170
            WQARARA+E TAATLQAQLQQ +MN G       DG+    G   DAE A   YIDPDRV
Sbjct  231  WQARARAEEFTAATLQAQLQQAMMNGGGCNANLPDGDIAGAGEAEDAESA---YIDPDRV  287

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S GPSCKACRKR ASVV+LPCRHLC+C+ CDAV QACPLCLS+RSSSVEVFLC
Sbjct  288  VESTGPSCKACRKRAASVVLLPCRHLCVCTDCDAVVQACPLCLSIRSSSVEVFLC  342



>gb|KJB51740.1| hypothetical protein B456_008G229800 [Gossypium raimondii]
Length=334

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKR RH+RALLGAAEESVAR+LR+KEAEVEKA RRN+EL AR  QL+ E+Q
Sbjct  157  GEALRRTLAEKRHRHFRALLGAAEESVARRLRDKEAEVEKAKRRNAELEARVAQLNVESQ  216

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED---GNapacgaggdaedaesAYIDP  179
             WQA+ARAQE TAA+LQAQLQQ IM+ GA    +D   G        G A DAESAY+DP
Sbjct  217  VWQAKARAQEATAASLQAQLQQAIMSGGAAASMQDSRRGEEGVKCGEGQAVDAESAYVDP  276

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV S GP+CKACRKR+ASVV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE FL
Sbjct  277  DRVVASWGPACKACRKRLASVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEAFL  333



>gb|KJB51739.1| hypothetical protein B456_008G229800 [Gossypium raimondii]
Length=335

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKR RH+RALLGAAEESVAR+LR+KEAEVEKA RRN+EL AR  QL+ E+Q
Sbjct  158  GEALRRTLAEKRHRHFRALLGAAEESVARRLRDKEAEVEKAKRRNAELEARVAQLNVESQ  217

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED---GNapacgaggdaedaesAYIDP  179
             WQA+ARAQE TAA+LQAQLQQ IM+ GA    +D   G        G A DAESAY+DP
Sbjct  218  VWQAKARAQEATAASLQAQLQQAIMSGGAAASMQDSRRGEEGVKCGEGQAVDAESAYVDP  277

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV S GP+CKACRKR+ASVV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE FL
Sbjct  278  DRVVASWGPACKACRKRLASVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEAFL  334



>ref|XP_006385396.1| hypothetical protein POPTR_0003s03410g [Populus trichocarpa]
 gb|ERP63193.1| hypothetical protein POPTR_0003s03410g [Populus trichocarpa]
Length=348

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQ+HYRALLGAAEES+AR+LRE EAEV++A R+N+EL ARA QLS EAQ
Sbjct  168  GEQLRRALAEKRQQHYRALLGAAEESIARRLRESEAEVQRATRKNAELEARASQLSIEAQ  227

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQE-----REDGNapacgaggdaedaesAYI  185
             WQA+AR QEVTA +LQAQLQQ IMN G VQ+        G +      G AEDAESAY+
Sbjct  228  VWQAKARTQEVTATSLQAQLQQAIMNGGVVQDSRRGDGGTGCSGGVEGQGQAEDAESAYV  287

Query  184  DPDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DPDRV + PG PSCK+CRKR+ASVV+LPCRHLC+C+ CD + QACPLCL VR+SSVEVFL
Sbjct  288  DPDRVTVVPGRPSCKSCRKRMASVVLLPCRHLCVCTECDQMVQACPLCLHVRNSSVEVFL  347

Query  7    C  5
            C
Sbjct  348  C  348



>ref|XP_011032004.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Populus 
euphratica]
Length=345

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTL EKRQRHYR LLGAAEES+AR+LREKE E+EKA RRN+EL ARA QLS +AQ 
Sbjct  166  EQLRRTLAEKRQRHYRELLGAAEESIARRLREKEMEIEKATRRNAELEARATQLSIDAQV  225

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNap-----acgaggdaedaesAYID  182
            WQA+ R QEVTAA+LQAQLQQ +MN G  Q+   G+              AEDAESAY+D
Sbjct  226  WQAKVRTQEVTAASLQAQLQQAVMNGGLAQDSRRGDDGIGCPGGVEGQTQAEDAESAYVD  285

Query  181  PDRVVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            PDRV + PG PSCK+CRKR+ASVV+LPCRHLC+C+ CD + QACPLCL VR+SSVEVFLC
Sbjct  286  PDRVTVVPGRPSCKSCRKRMASVVLLPCRHLCVCTECDQMVQACPLCLHVRNSSVEVFLC  345



>ref|XP_009592197.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=334

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 15/180 (8%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLEEKR+ HYRALLG AEE++AR+L+EKEAEVEKA RRN+EL ARA QLSAEAQA
Sbjct  164  EQLRRTLEEKRRTHYRALLGTAEETMARQLKEKEAEVEKAVRRNAELEARAAQLSAEAQA  223

Query  346  wqararaqevtaatlqaqlqqVIMNAGA------VQEREDGNapacgaggdaedaesAYI  185
            WQARA+A+E TAATLQAQLQQ ++N GA      + E + G A    +          Y+
Sbjct  224  WQARAKAEEFTAATLQAQLQQAMINNGAGGCNAHLPESDGGEAEDAESV---------YV  274

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            DPDRV+ S GPSCKACRKR+ASVV+LPCRHLC+C+ CDAV QACPLC S+R+SSVEVFLC
Sbjct  275  DPDRVIESTGPSCKACRKRVASVVLLPCRHLCVCTDCDAVLQACPLCFSIRTSSVEVFLC  334



>ref|XP_009592196.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=335

 Score =   151 bits (382),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 15/180 (8%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLEEKR+ HYRALLG AEE++AR+L+EKEAEVEKA RRN+EL ARA QLSAEAQA
Sbjct  165  EQLRRTLEEKRRTHYRALLGTAEETMARQLKEKEAEVEKAVRRNAELEARAAQLSAEAQA  224

Query  346  wqararaqevtaatlqaqlqqVIMNAGA------VQEREDGNapacgaggdaedaesAYI  185
            WQARA+A+E TAATLQAQLQQ ++N GA      + E + G A    +          Y+
Sbjct  225  WQARAKAEEFTAATLQAQLQQAMINNGAGGCNAHLPESDGGEAEDAESV---------YV  275

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            DPDRV+ S GPSCKACRKR+ASVV+LPCRHLC+C+ CDAV QACPLC S+R+SSVEVFLC
Sbjct  276  DPDRVIESTGPSCKACRKRVASVVLLPCRHLCVCTDCDAVLQACPLCFSIRTSSVEVFLC  335



>ref|XP_009792528.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Nicotiana sylvestris]
Length=338

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR TLEEKR+RHY ALLGAAEE++AR++REK+ EVEKA RRN+EL ARA QL+AEA+
Sbjct  164  GEQLRLTLEEKRKRHYHALLGAAEETIARRIREKDTEVEKATRRNAELEARAVQLTAEAR  223

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQ--EREDGNapacgaggdaedaesAYIDPD  176
            AWQA+AR QEVTAATLQAQLQQV M  G +   ER+DG   +C    +  ++   ++DPD
Sbjct  224  AWQAKAREQEVTAATLQAQLQQVAMMNGGINLPERDDGGGISCCGEAEDAESA--FVDPD  281

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV S GPSCK CRKR ASVV+LPCRHLCLC+ CDAVAQ+CPLC S+RSSSVEVFL
Sbjct  282  RVVESTGPSCKGCRKRFASVVMLPCRHLCLCTECDAVAQSCPLCRSIRSSSVEVFL  337



>gb|KHG20390.1| Baculoviral IAP repeat-containing 7-A [Gossypium arboreum]
Length=331

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKR RH+RALLGAAEESVAR+LR+KEAEVEKA +RN+EL  R  QL+ EAQ
Sbjct  154  GEALRRTLAEKRHRHFRALLGAAEESVARRLRDKEAEVEKAKQRNAELETRVAQLNVEAQ  213

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED---GNapacgaggdaedaesAYIDP  179
             WQA+AR QE TAA+LQAQLQQ IM+ GA     D   G        G A DAESAY+DP
Sbjct  214  VWQAKARTQEATAASLQAQLQQAIMSGGAAASMHDSRRGEEGVKCGEGQAVDAESAYVDP  273

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV S GP+CKACRKR+ASVV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE FL
Sbjct  274  DRVVASWGPACKACRKRLASVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEAFL  330



>emb|CDP13426.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 14/188 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYR+LLGAAEESVAR+LREKEAEVEKAARRN+EL A+A QLS EAQ
Sbjct  181  GEQLRRTLAEKRQRHYRSLLGAAEESVARRLREKEAEVEKAARRNAELEAKAAQLSLEAQ  240

Query  349  awqararaqevtaatlqaqlqqVIMNAGA-------VQERED-------GNapacgaggd  212
            AWQ RA+ QE  AA LQAQL++ I+ +G        VQER++        N+ A   GG+
Sbjct  241  AWQQRAKMQEHMAANLQAQLERAIITSGGYNGAAQQVQERDEWGGGGGGNNSAAGTVGGE  300

Query  211  aedaesAYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
            AEDAESAYIDPDRVV   GPSCKACRKR+A++VVLPCRHL LC+ CDAVA+ACP+C + R
Sbjct  301  AEDAESAYIDPDRVVERAGPSCKACRKRVAAMVVLPCRHLSLCTECDAVARACPVCFATR  360

Query  31   SSSVEVFL  8
            SSS+EVFL
Sbjct  361  SSSLEVFL  368



>ref|XP_006477044.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
[Citrus sinensis]
Length=356

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  178  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  237

Query  349  awqararaqevtaatlqaqlqqVIMNA--GAVQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+   G  Q+   G+      G  AEDAESAY+DPD
Sbjct  238  VWQAKARAQEATAASLQAQLQQAIMSGAGGGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  297

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  298  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  355



>ref|XP_007039620.1| SBP family protein [Theobroma cacao]
 gb|EOY24121.1| SBP family protein [Theobroma cacao]
Length=338

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 146/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRR L EKR RHYRALLGAAEESVAR+LREKEAEVEKA RRNSEL ARA QLS EAQ
Sbjct  160  GEELRRMLAEKRNRHYRALLGAAEESVARRLREKEAEVEKATRRNSELEARATQLSVEAQ  219

Query  349  awqararaqevtaatlqaqlqqVIMNAGA-----VQEREDGNapacgaggdaedaesAYI  185
             WQA+ARAQE TAA+LQAQLQQ IM+ GA     ++  E+G     G  G AEDAESAY+
Sbjct  220  VWQAKARAQEATAASLQAQLQQAIMSGGAAAAQDIRRGEEGLKCGGGVEGQAEDAESAYV  279

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV  S GP CKACR R+ASVV+LPCRHLCLC+ CD VAQACPLCL+VR+SSVEVFL
Sbjct  280  DPERVAAS-GPVCKACRTRVASVVLLPCRHLCLCTECDRVAQACPLCLTVRNSSVEVFL  337



>emb|CBI33972.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 16/174 (9%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALLGAAEESVAR+LREKEAEVEKAAR N+EL ARA QLS EAQ
Sbjct  156  GEQLRRTLAEKRQRHYRALLGAAEESVARRLREKEAEVEKAARCNAELEARAAQLSMEAQ  215

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TAA+LQAQLQQ +M+ G  Q  ED  +               YIDP+RV
Sbjct  216  VWQAKARAQEATAASLQAQLQQAMMSGGGGQA-EDAESA--------------YIDPERV  260

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              S GP CKACRKR+ASVV+LPCRH C+C+ CD V QACPLCLS+R SSVEVFL
Sbjct  261  K-SSGPMCKACRKRVASVVLLPCRHFCICTQCDGVVQACPLCLSLRDSSVEVFL  313



>gb|KDO52692.1| hypothetical protein CISIN_1g016506mg [Citrus sinensis]
Length=318

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  140  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  199

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  200  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  259

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  260  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  317



>ref|XP_006440127.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
 gb|ESR53367.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
Length=353

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  175  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  234

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  235  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  294

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  295  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  352



>gb|KDO52691.1| hypothetical protein CISIN_1g016506mg [Citrus sinensis]
Length=354

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  176  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  235

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  236  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  295

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  296  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  353



>ref|XP_006440126.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
 gb|ESR53366.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
Length=355

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  177  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  236

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  237  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  296

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  297  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  354



>gb|KDO52690.1| hypothetical protein CISIN_1g016506mg [Citrus sinensis]
Length=356

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  178  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  237

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  238  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  297

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  298  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  355



>gb|KJB25418.1| hypothetical protein B456_004G190300 [Gossypium raimondii]
Length=297

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G +LRRTL EKR RHY ALL AAEESVAR+LREKEAEVEKA RRN+EL ARA QLS E Q
Sbjct  124  GKELRRTLAEKRNRHYHALLAAAEESVARRLREKEAEVEKAKRRNAELEARAAQLSVEVQ  183

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TA +LQAQLQQ ++  GA    +D      G  G AEDAESAY+DP+R+
Sbjct  184  VWQAKARAQEATATSLQAQLQQAMIGCGAAAVTQDSRRGEEGIEGQAEDAESAYVDPERM  243

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V S GPSCKACR R+ASVV+LPCRHLCLC+ CD VAQACPLCL+VR+SSVEVFL
Sbjct  244  V-SSGPSCKACRTRVASVVLLPCRHLCLCTECDRVAQACPLCLAVRNSSVEVFL  296



>ref|XP_004244705.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Solanum lycopersicum]
Length=331

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 141/176 (80%), Gaps = 6/176 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTLEEKR+RHY AL+GA EES AR+L+EKE EVEKA RRN+EL ARA QL+AEA+
Sbjct  161  GEQLRRTLEEKRKRHYHALIGAMEESAARRLKEKETEVEKAGRRNTELEARASQLTAEAR  220

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ +A  QEVTAATLQAQLQQ ++N G +           G GG+AEDAES Y+DPDRV
Sbjct  221  AWQVKAWEQEVTAATLQAQLQQAMVNGGGM-----STVEGDGGGGEAEDAESVYVDPDRV  275

Query  169  VLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            V S G PSCK CRKR ASVV+LPCRHLCLC  CD VAQ+CPLC S+R+SSVEVFLC
Sbjct  276  VESTGRPSCKGCRKRFASVVLLPCRHLCLCIECDVVAQSCPLCRSIRTSSVEVFLC  331



>ref|XP_006440125.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
 gb|ESR53365.1| hypothetical protein CICLE_v10020548mg [Citrus clementina]
Length=387

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  209  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  268

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  269  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  328

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  329  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  386



>gb|KDO52689.1| hypothetical protein CISIN_1g016506mg [Citrus sinensis]
Length=388

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALLGAAEES+AR LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  210  GEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  269

Query  349  awqararaqevtaatlqaqlqqVIMNAGA--VQEREDGNapacgaggdaedaesAYIDPD  176
             WQA+ARAQE TAA+LQAQLQQ IM+      Q+   G+      G  AEDAESAY+DPD
Sbjct  270  VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPD  329

Query  175  RVVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV  P  GP+CK CRKR+ASVV+LPCRHLC+C+ CD V QACPLC +VR SSVEVFL
Sbjct  330  RVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  387



>ref|XP_002528801.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF33623.1| ubiquitin-protein ligase, putative, partial [Ricinus communis]
Length=219

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 136/178 (76%), Gaps = 7/178 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALL AAEES++ +LREKEAEVEKA RRNSEL ARA QLS EAQ
Sbjct  42   GEQLRRTLAEKRQRHYRALLSAAEESISMRLREKEAEVEKATRRNSELEARAAQLSVEAQ  101

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgagg-------daedaesA  191
             WQA+ARAQE  AA+LQAQLQQ IM+ G     ++                  AEDAESA
Sbjct  102  VWQAKARAQETAAASLQAQLQQAIMSGGGGVTADNRRGDDGLGCSGGGGIEGQAEDAESA  161

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            Y+DP+RV +S GP+CK CRKR A+VVVLPCRHLC+C+ CD VAQACPLCL VR+SSVE
Sbjct  162  YVDPERVTVSGGPTCKGCRKRAATVVVLPCRHLCMCTECDQVAQACPLCLQVRNSSVE  219



>gb|KJB25417.1| hypothetical protein B456_004G190300 [Gossypium raimondii]
Length=336

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G +LRRTL EKR RHY ALL AAEESVAR+LREKEAEVEKA RRN+EL ARA QLS E Q
Sbjct  163  GKELRRTLAEKRNRHYHALLAAAEESVARRLREKEAEVEKAKRRNAELEARAAQLSVEVQ  222

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TA +LQAQLQQ ++  GA    +D      G  G AEDAESAY+DP+R+
Sbjct  223  VWQAKARAQEATATSLQAQLQQAMIGCGAAAVTQDSRRGEEGIEGQAEDAESAYVDPERM  282

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V S GPSCKACR R+ASVV+LPCRHLCLC+ CD VAQACPLCL+VR+SSVEVFL
Sbjct  283  V-SSGPSCKACRTRVASVVLLPCRHLCLCTECDRVAQACPLCLAVRNSSVEVFL  335



>ref|XP_002279666.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Vitis vinifera]
Length=337

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 147/182 (81%), Gaps = 9/182 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALLGAAEESVAR+LREKEAEVEKAAR N+EL ARA QLS EAQ
Sbjct  156  GEQLRRTLAEKRQRHYRALLGAAEESVARRLREKEAEVEKAARCNAELEARAAQLSMEAQ  215

Query  349  awqararaqevtaatlqaqlqqVIMNAGA-VQER--EDG-----Napacgaggdaedaes  194
             WQA+ARAQE TAA+LQAQLQQ +M+ G   Q+R  E+G      A   G  G AEDAES
Sbjct  216  VWQAKARAQEATAASLQAQLQQAMMSGGGCSQDRRGEEGLGCAVGAEGGGCSGQAEDAES  275

Query  193  AYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            AYIDP+RV  S GP CKACRKR+ASVV+LPCRH C+C+ CD V QACPLCLS+R SSVEV
Sbjct  276  AYIDPERVK-SSGPMCKACRKRVASVVLLPCRHFCICTQCDGVVQACPLCLSLRDSSVEV  334

Query  13   FL  8
            FL
Sbjct  335  FL  336



>ref|XP_008229503.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X2 [Prunus 
mume]
Length=347

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 147/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+RTL EKRQRHYRALL AAEES+AR+LREKE EVEKA RRN+EL ARA QLS +AQ
Sbjct  169  GEQLQRTLAEKRQRHYRALLSAAEESIARRLREKEVEVEKATRRNAELEARAAQLSVDAQ  228

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERE-----DGNapacgaggdaedaesAYI  185
             WQA+ARAQ+ TAATLQAQLQQ +M+ G V  ++     DG A + G  G AEDAESAYI
Sbjct  229  VWQAKARAQQATAATLQAQLQQAMMSGGFVAAQDSRRGDDGVASSAGVEGQAEDAESAYI  288

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV +S  PSCKACRKR+ASVV+LPCRHLCLC+ CD + QACPLCL +R+SSVEVFL
Sbjct  289  DPERVTMS-APSCKACRKRVASVVILPCRHLCLCTECDQMVQACPLCLCMRNSSVEVFL  346



>ref|XP_008229502.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X1 [Prunus 
mume]
Length=348

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 147/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+RTL EKRQRHYRALL AAEES+AR+LREKE EVEKA RRN+EL ARA QLS +AQ
Sbjct  170  GEQLQRTLAEKRQRHYRALLSAAEESIARRLREKEVEVEKATRRNAELEARAAQLSVDAQ  229

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERE-----DGNapacgaggdaedaesAYI  185
             WQA+ARAQ+ TAATLQAQLQQ +M+ G V  ++     DG A + G  G AEDAESAYI
Sbjct  230  VWQAKARAQQATAATLQAQLQQAMMSGGFVAAQDSRRGDDGVASSAGVEGQAEDAESAYI  289

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV +S  PSCKACRKR+ASVV+LPCRHLCLC+ CD + QACPLCL +R+SSVEVFL
Sbjct  290  DPERVTMS-APSCKACRKRVASVVILPCRHLCLCTECDQMVQACPLCLCMRNSSVEVFL  347



>ref|XP_009789661.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Nicotiana sylvestris]
Length=338

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 15/180 (8%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLEEKR+ HYRALLG  EE++AR+L+EKEAEVEKA RRN+EL ARA QLSAEAQA
Sbjct  168  EQLRRTLEEKRRTHYRALLGTVEETMARQLKEKEAEVEKAVRRNAELEARAAQLSAEAQA  227

Query  346  wqararaqevtaatlqaqlqqVIMNAGA------VQEREDGNapacgaggdaedaesAYI  185
            WQARARA+E TAATLQAQLQQ ++N GA      + E + G A    +          Y+
Sbjct  228  WQARARAEEFTAATLQAQLQQAMINNGAGGCNAHLPESDGGEAEDAESV---------YV  278

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            D DRVV S GPSCKACRKR+ASVV+LPCRHLC+C+ CDA  QACPLCLS+R+SSVEVFLC
Sbjct  279  DLDRVVESTGPSCKACRKRVASVVLLPCRHLCVCTDCDAALQACPLCLSIRTSSVEVFLC  338



>gb|KHG02715.1| Baculoviral IAP repeat-containing 2 [Gossypium arboreum]
Length=334

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 1/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G +LRRTL EKR RHY ALL AAEESVAR+LREKEAEVEKA RRN+EL A A QLS E Q
Sbjct  161  GKELRRTLAEKRNRHYHALLAAAEESVARRLREKEAEVEKATRRNAELEAWAAQLSVEVQ  220

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TA +LQAQLQQ ++  GA    ED      G  G AEDAESAY+DP+R+
Sbjct  221  VWQAKARAQEATATSLQAQLQQAMIGCGAAAVTEDSRRGEEGIEGQAEDAESAYVDPERM  280

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V S GPSCKACR R+ASVV+LPCRHLCLC+ CD VAQACPLCL+VR+SSVEVFL
Sbjct  281  V-SSGPSCKACRTRVASVVLLPCRHLCLCTECDRVAQACPLCLAVRNSSVEVFL  333



>ref|XP_009789725.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Nicotiana sylvestris]
Length=337

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 15/180 (8%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTLEEKR+ HYRALLG  EE++AR+L+EKEAEVEKA RRN+EL ARA QLSAEAQA
Sbjct  167  EQLRRTLEEKRRTHYRALLGTVEETMARQLKEKEAEVEKAVRRNAELEARAAQLSAEAQA  226

Query  346  wqararaqevtaatlqaqlqqVIMNAGA------VQEREDGNapacgaggdaedaesAYI  185
            WQARARA+E TAATLQAQLQQ ++N GA      + E + G A    +          Y+
Sbjct  227  WQARARAEEFTAATLQAQLQQAMINNGAGGCNAHLPESDGGEAEDAESV---------YV  277

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            D DRVV S GPSCKACRKR+ASVV+LPCRHLC+C+ CDA  QACPLCLS+R+SSVEVFLC
Sbjct  278  DLDRVVESTGPSCKACRKRVASVVLLPCRHLCVCTDCDAALQACPLCLSIRTSSVEVFLC  337



>ref|XP_010110525.1| hypothetical protein L484_023358 [Morus notabilis]
 gb|EXC26743.1| hypothetical protein L484_023358 [Morus notabilis]
Length=356

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALLGAAEE++AR+LREK+AE+EKA RRN+EL ARA QLS +AQ
Sbjct  176  GEQLRRTLAEKRQRHYRALLGAAEETIARRLREKQAEMEKATRRNAELEARAAQLSVDAQ  235

Query  349  awqararaqevtaatlqaqlqqVIM----NAGAVQERE--DGNapacgaggdaedaesAY  188
             WQA+ARAQEVT A+LQAQLQQ +M       +  +R   D    +C  GG AEDAESAY
Sbjct  236  LWQAKARAQEVTVASLQAQLQQAMMVGVGGPTSAHDRRGVDDGGLSCADGGQAEDAESAY  295

Query  187  IDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +DPDRV +  GPSC+ACRKR+ASVV+LPCRHLCLC+ CD + QACP+CLS+R+SSVEVFL
Sbjct  296  VDPDRVAVVSGPSCRACRKRVASVVLLPCRHLCLCTDCDRLVQACPVCLSLRNSSVEVFL  355



>ref|XP_008356461.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Malus domestica]
Length=340

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 147/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYRALL A EES+AR+LR+KE EV+KA RRNSEL ARA QLS EAQ
Sbjct  162  GEQLRRTLAEKRQRHYRALLNAVEESIARRLRQKEVEVQKATRRNSELEARAAQLSVEAQ  221

Query  349  awqararaqevtaatlqaqlqqVIMNAG--AVQER---EDGNapacgaggdaedaesAYI  185
             WQA+ARAQ+ TAA+LQAQLQQ +++ G  A Q+    E+G   A G  G AEDAESAYI
Sbjct  222  VWQAKARAQQATAASLQAQLQQAMISGGFAAAQDSRRGEEGVVCAAGVEGRAEDAESAYI  281

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV +S GPSCKACRKR+ASVV+LPCRHL LC+ CD V QACPLCL++R+SSVEV+L
Sbjct  282  DPERVTVS-GPSCKACRKRVASVVLLPCRHLSLCTECDQVIQACPLCLTLRNSSVEVYL  339



>ref|XP_004300294.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Fragaria 
vesca subsp. vesca]
Length=342

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 133/181 (73%), Gaps = 7/181 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+RTL EKRQRHYRALLGAAEESV+RKLREKEAE +KA RRN+EL ARA  LS EAQ
Sbjct  163  GEQLQRTLAEKRQRHYRALLGAAEESVSRKLREKEAEFQKATRRNAELEARAAHLSVEAQ  222

Query  349  --awqararaqevtaatlqaqlqqVIMNAG----AVQEREDGNapacgaggdaedaesAY  188
                +ARA+     +  +Q Q  + +++AG      Q+    +     A   AEDAES Y
Sbjct  223  IWQAKARAQEATAASLQVQVQQAKAMLSAGFQVAGAQDSRRVDDGLTCAENQAEDAESGY  282

Query  187  IDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            IDP+R  +S GPSCKACRKR+ASVV+LPCRHLCLC+ CD   Q+CPLCLS+R+SSVEVFL
Sbjct  283  IDPERATVS-GPSCKACRKRVASVVLLPCRHLCLCTECDQTVQSCPLCLSMRNSSVEVFL  341

Query  7    C  5
            C
Sbjct  342  C  342



>gb|KJB39791.1| hypothetical protein B456_007G030800 [Gossypium raimondii]
Length=301

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 142/183 (78%), Gaps = 9/183 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL EKR RHYRALL AAEESVAR+ REKEAEVEKA RRN EL ARA QL AE Q
Sbjct  118  GEELRRTLAEKRHRHYRALLEAAEESVARRFREKEAEVEKAKRRNVELEARAAQLGAEVQ  177

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNa--------pacgaggdaedaes  194
             WQA+A+AQEVTAA+LQAQLQQ IMN GA   ++D               +   AEDAES
Sbjct  178  VWQAKAKAQEVTAASLQAQLQQAIMNGGAGLTQQDSRRGGEEWRKCAGGESEAQAEDAES  237

Query  193  AYIDPDRVVLS-PGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            AY+DP+RVV +  GP CKACR R+A+VV+LPCRHLCLC+ CD VAQACPLCL++R+SSVE
Sbjct  238  AYVDPERVVAAASGPCCKACRTRVAAVVLLPCRHLCLCTECDRVAQACPLCLTLRNSSVE  297

Query  16   VFL  8
            VFL
Sbjct  298  VFL  300



>ref|XP_009371860.1| PREDICTED: E3 ubiquitin-protein ligase BOI [Pyrus x bretschneideri]
Length=340

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 146/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQ HYRALL AAEESVAR+LREKE EV+KA RRNSEL ARA QLS EAQ
Sbjct  162  GEQLRRTLAEKRQMHYRALLNAAEESVARRLREKEVEVQKATRRNSELEARAAQLSVEAQ  221

Query  349  awqararaqevtaatlqaqlqqVIMNAG--AVQER---EDGNapacgaggdaedaesAYI  185
             WQA+ARAQ+ TAA+LQAQLQQ +++ G  A Q+    E+G   A G  G AE+AESAYI
Sbjct  222  FWQAKARAQQATAASLQAQLQQAMISGGFAAAQDSRRGEEGVVCAAGVEGRAEEAESAYI  281

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV +  GPSCKACRKR+ASVV+LPCRHL LC+ CD V QACPLCL++R+SSVEV+L
Sbjct  282  DPERVTV-LGPSCKACRKRVASVVLLPCRHLSLCTECDQVVQACPLCLTLRNSSVEVYL  339



>ref|XP_010274557.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Nelumbo 
nucifera]
Length=340

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            GDQLRRTL E+RQRHYRALLGAAEES AR+LREK+AEVEKA RR++EL  R  QL  EAQ
Sbjct  166  GDQLRRTLAERRQRHYRALLGAAEESAARRLREKDAEVEKAVRRHAELEERVAQLRVEAQ  225

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDG-NapacgaggdaedaesAYIDPDR  173
             WQA+AR QE TAA+LQAQ+QQ +M +G    REDG           AEDAESAYIDP+R
Sbjct  226  VWQAKARQQEATAASLQAQIQQAMMGSGVPDNREDGLGCSGEAHPHHAEDAESAYIDPER  285

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            VV S GP CKACR+R ASVV+LPCRH CLC+ CDA A+ACPLCL+ RS+SVEV+L
Sbjct  286  VV-SSGPMCKACRRRPASVVLLPCRHFCLCTDCDAAAEACPLCLTPRSASVEVYL  339



>gb|KJB21031.1| hypothetical protein B456_003G179400 [Gossypium raimondii]
Length=338

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL EKRQRHY ALLGAAEE+VAR+LREKEAEVEKA RRN+EL ARA Q+S E Q
Sbjct  161  GEELRRTLAEKRQRHYHALLGAAEETVARRLREKEAEVEKAKRRNAELEARAAQVSVEVQ  220

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDG----NapacgaggdaedaesAYID  182
             WQA+ARAQE TA +LQAQLQQ IM+     +   G    N    G     EDAESAY+D
Sbjct  221  VWQAKARAQEATAVSLQAQLQQAIMSGATAHDNRRGDEGLNCAGGGVERQPEDAESAYVD  280

Query  181  PDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            PDRVV S GP C+ACRKR A+VV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVEV L
Sbjct  281  PDRVVAS-GPVCRACRKRAAAVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEVLL  337



>gb|KJB39790.1| hypothetical protein B456_007G030800 [Gossypium raimondii]
Length=342

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 142/183 (78%), Gaps = 9/183 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL EKR RHYRALL AAEESVAR+ REKEAEVEKA RRN EL ARA QL AE Q
Sbjct  159  GEELRRTLAEKRHRHYRALLEAAEESVARRFREKEAEVEKAKRRNVELEARAAQLGAEVQ  218

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNa--------pacgaggdaedaes  194
             WQA+A+AQEVTAA+LQAQLQQ IMN GA   ++D               +   AEDAES
Sbjct  219  VWQAKAKAQEVTAASLQAQLQQAIMNGGAGLTQQDSRRGGEEWRKCAGGESEAQAEDAES  278

Query  193  AYIDPDRVVLS-PGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            AY+DP+RVV +  GP CKACR R+A+VV+LPCRHLCLC+ CD VAQACPLCL++R+SSVE
Sbjct  279  AYVDPERVVAAASGPCCKACRTRVAAVVLLPCRHLCLCTECDRVAQACPLCLTLRNSSVE  338

Query  16   VFL  8
            VFL
Sbjct  339  VFL  341



>gb|KHF98414.1| Baculoviral IAP repeat-containing 4 [Gossypium arboreum]
Length=342

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 140/183 (77%), Gaps = 9/183 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL EKR RHYRALL AAEESVAR+ REKEAEVEKA RRN EL ARA QL AE Q
Sbjct  159  GEELRRTLAEKRHRHYRALLEAAEESVARRFREKEAEVEKAKRRNVELEARAVQLGAEVQ  218

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNa--------pacgaggdaedaes  194
             WQA+A+AQEVTAA+LQAQLQQ IMN GA   +ED               +   AEDAES
Sbjct  219  VWQAKAKAQEVTAASLQAQLQQAIMNGGAGLTQEDSRRGGEEWRKCAGGESEAQAEDAES  278

Query  193  AYIDPDRVV-LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            AY+DP+RVV  + GP CKACR R A+VV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVE
Sbjct  279  AYVDPERVVSAASGPCCKACRTRAAAVVLLPCRHLCLCTECDRVAQACPLCLTFRNSSVE  338

Query  16   VFL  8
            VFL
Sbjct  339  VFL  341



>ref|XP_010269870.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nelumbo 
nucifera]
Length=344

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            GDQLRRTL E+RQRHYRALLGA EES AR+LREK+AEVEKAARR++EL  R  QL  EAQ
Sbjct  167  GDQLRRTLAERRQRHYRALLGAVEESAARRLREKDAEVEKAARRHAELEERVAQLRVEAQ  226

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERE-DGNapacgaggdaedaesAYIDPDR  173
             WQA+ R QE TAA+LQAQ+QQ +M+ GA   RE +G   A      AEDAESAYIDP+R
Sbjct  227  VWQAKVRQQEATAASLQAQIQQAMMSGGAQDNREGEGLGCAGAGEAHAEDAESAYIDPER  286

Query  172  VVLSP--GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            VV S   GP CKACR+R+ASVV+LPCRH CLC+ CDA A+ACPLCLS RS+SVEV+L
Sbjct  287  VVSSSLSGPVCKACRRRVASVVLLPCRHFCLCTECDAGAEACPLCLSRRSASVEVYL  343



>ref|XP_006362485.1| PREDICTED: uncharacterized protein LOC102594630 [Solanum tuberosum]
Length=349

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTLEEKR+  Y AL+GA EES AR+L+E+E EVEKA+RRN+EL ARA Q+ AEA+
Sbjct  180  GEQLRRTLEEKRKHLYHALIGAVEESTARRLKERETEVEKASRRNTELEARASQMIAEAR  239

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERE-DGNapacgaggdaedaesAYIDPDR  173
            AWQ +   QEVTAATLQAQLQQ ++N G +   E DG   A  A          Y+DPDR
Sbjct  240  AWQVKTCEQEVTAATLQAQLQQAMVNGGGMSPPEGDGGGEAKDAESV-------YVDPDR  292

Query  172  VVLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            VV S G PSCK CRKR ASVV+LPCRH+CLC  CD VAQ+CPLC S+R+SSVEVFLC
Sbjct  293  VVESTGRPSCKGCRKRFASVVLLPCRHMCLCIECDVVAQSCPLCRSIRTSSVEVFLC  349



>gb|KHG04417.1| Baculoviral IAP repeat-containing 7-A [Gossypium arboreum]
Length=338

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL EKRQRHY ALLGAAEE+VAR+LREKEAEVEKA RRN+EL ARA Q+S E Q
Sbjct  161  GEELRRTLAEKRQRHYHALLGAAEETVARRLREKEAEVEKAKRRNAELEARAAQVSVEVQ  220

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDG----NapacgaggdaedaesAYID  182
             WQA+ARAQE TA +LQAQLQQ IM+    ++   G    N    G     EDAESAY+D
Sbjct  221  VWQAKARAQEATAVSLQAQLQQAIMSGATARDNRRGDEGLNCAGGGVERQPEDAESAYVD  280

Query  181  PDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            PDRVV S GP C+ACRKR A VV+LPC+HLCLC+ CD VAQACPLCL+ R+SSVEV L
Sbjct  281  PDRVVAS-GPVCRACRKRAAVVVLLPCQHLCLCTECDRVAQACPLCLTARNSSVEVLL  337



>gb|KJB21032.1| hypothetical protein B456_003G179400 [Gossypium raimondii]
Length=336

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = -3

Query  523  QLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqaw  344
            +LRRTL EKRQRHY ALLGAAEE+VAR+LREKEAEVEKA RRN+EL ARA Q+S E Q W
Sbjct  161  ELRRTLAEKRQRHYHALLGAAEETVARRLREKEAEVEKAKRRNAELEARAAQVSVEVQVW  220

Query  343  qararaqevtaatlqaqlqqVIMNAGAVQEREDG----NapacgaggdaedaesAYIDPD  176
            QA+ARAQE TA +LQAQLQQ IM+     +   G    N    G     EDAESAY+DPD
Sbjct  221  QAKARAQEATAVSLQAQLQQAIMSGATAHDNRRGDEGLNCAGGGVERQPEDAESAYVDPD  280

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            RVV S GP C+ACRKR A+VV+LPCRHLCLC+ CD VAQACPLCL+ R+SSVEV L
Sbjct  281  RVVAS-GPVCRACRKRAAAVVLLPCRHLCLCTECDRVAQACPLCLTARNSSVEVLL  335



>ref|XP_008465916.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Cucumis 
melo]
Length=328

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTL EKRQRHYRALL A EESVAR+LRE+EAEVEKA RRN+EL ARA QLS EAQ 
Sbjct  160  EQLRRTLAEKRQRHYRALLDAVEESVARRLREREAEVEKATRRNAELEARAAQLSVEAQV  219

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+ARAQE TA +LQAQ    +  A +    + G+    G  G A+DAESA+IDP+RVV
Sbjct  220  WQAKARAQEATAVSLQAQ----LQQAMSGGGCDGGDGGTVGVEGQADDAESAHIDPERVV  275

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +S GPSCKACRKR+AS+++LPCRHLCLC+ CD VAQ CPLC S RSSSVEV+L
Sbjct  276  IS-GPSCKACRKRLASMLILPCRHLCLCADCDQVAQTCPLCHSKRSSSVEVYL  327



>ref|XP_004173995.1| PREDICTED: uncharacterized protein LOC101229955 [Cucumis sativus]
 gb|KGN60440.1| hypothetical protein Csa_3G911260 [Cucumis sativus]
Length=328

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTL EKRQRHYRALL A EESVAR+LRE+EAEVEKA RRN+EL ARA QLS EAQ 
Sbjct  160  EQLRRTLAEKRQRHYRALLDAVEESVARRLREREAEVEKATRRNAELEARAAQLSVEAQV  219

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+ARAQE TA +LQAQ    +  A +    + G+    G  G A+DAESA+IDP+RVV
Sbjct  220  WQAKARAQEATAVSLQAQ----LQQAMSGGGCDGGDGGTVGVEGQADDAESAHIDPERVV  275

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +S GPSCKACRKR+AS+++LPCRHLCLC+ CD VAQ CPLC S RSSSVEV+L
Sbjct  276  IS-GPSCKACRKRLASMLILPCRHLCLCTDCDQVAQTCPLCHSKRSSSVEVYL  327



>ref|XP_004148373.1| PREDICTED: uncharacterized protein LOC101213134 [Cucumis sativus]
Length=328

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRRTL EKRQRHYRALL A EESVAR+LRE+EAEVEKA RRN+EL ARA QLS EAQ 
Sbjct  160  EQLRRTLAEKRQRHYRALLDAVEESVARRLREREAEVEKATRRNAELEARAAQLSVEAQV  219

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+ARAQE TA +LQAQ    +  A +    + G+    G  G A+DAESA+IDP+RVV
Sbjct  220  WQAKARAQEATAVSLQAQ----LQQAMSGGGCDGGDGGTVGVEGQADDAESAHIDPERVV  275

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +S GPSCKACRKR+AS+++LPCRHLCLC+ CD VAQ CPLC S RSSSVEV+L
Sbjct  276  IS-GPSCKACRKRLASMLILPCRHLCLCTDCDQVAQTCPLCHSKRSSSVEVYL  327



>ref|XP_010677203.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Beta 
vulgaris subsp. vulgaris]
Length=339

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL +KR+RHYRALLGAAEE+VAR++REKEAEVEKAARRN+EL ARA QLSAEAQ
Sbjct  166  GEQLRRTLADKRERHYRALLGAAEEAVARRMREKEAEVEKAARRNAELEARAAQLSAEAQ  225

Query  349  awqararaqevtaatlqaqlqqVIMN-AGAVQEREDGNapacgaggdaedaesAYIDPDR  173
            AWQ +ARAQE  AA+LQAQLQQ ++  +GA+Q+  +G+   C    +  ++   Y++P  
Sbjct  226  AWQVKARAQEAQAASLQAQLQQAMVGPSGALQQDREGSGLGCAGDAEDAESA--YVNPVS  283

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
                  PSCK CR R+ASVV+LPCRHLC+C  CD V QACPLCLS+RS+SVEV+L 
Sbjct  284  EQRVGSPSCKMCRTRVASVVLLPCRHLCVCRECDDVVQACPLCLSIRSASVEVYLT  339



>ref|XP_010053562.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X2 [Eucalyptus 
grandis]
 gb|KCW77882.1| hypothetical protein EUGRSUZ_D02146 [Eucalyptus grandis]
Length=292

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 142/182 (78%), Gaps = 12/182 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL +KRQRHY ALLG AEESVARKLREK+AE+EKA RR +EL ARA QLS EAQ
Sbjct  114  GEQLRRTLADKRQRHYLALLGVAEESVARKLREKDAEMEKATRRYAELEARAAQLSVEAQ  173

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNap--------acgaggdaedaes  194
             WQA+ARAQE  AA++QAQLQQ++M+    Q+R  G A         +   G  AEDAES
Sbjct  174  VWQAKARAQEAAAASMQAQLQQLVMSG---QDRRAGAAAADDGGGPGSAAEGQVAEDAES  230

Query  193  AYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            AY+DPDRVV S GPSCKACR R ASVV+LPCRHLC+C+ CD+V QACP+C + R+SSVE+
Sbjct  231  AYVDPDRVVAS-GPSCKACRSRAASVVLLPCRHLCVCTECDSVVQACPVCFAARNSSVEI  289

Query  13   FL  8
            +L
Sbjct  290  YL  291



>ref|XP_010053560.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X1 [Eucalyptus 
grandis]
 gb|KCW77881.1| hypothetical protein EUGRSUZ_D02146 [Eucalyptus grandis]
Length=358

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 142/182 (78%), Gaps = 12/182 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL +KRQRHY ALLG AEESVARKLREK+AE+EKA RR +EL ARA QLS EAQ
Sbjct  180  GEQLRRTLADKRQRHYLALLGVAEESVARKLREKDAEMEKATRRYAELEARAAQLSVEAQ  239

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNap--------acgaggdaedaes  194
             WQA+ARAQE  AA++QAQLQQ++M+    Q+R  G A         +   G  AEDAES
Sbjct  240  VWQAKARAQEAAAASMQAQLQQLVMSG---QDRRAGAAAADDGGGPGSAAEGQVAEDAES  296

Query  193  AYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            AY+DPDRVV S GPSCKACR R ASVV+LPCRHLC+C+ CD+V QACP+C + R+SSVE+
Sbjct  297  AYVDPDRVVAS-GPSCKACRSRAASVVLLPCRHLCVCTECDSVVQACPVCFAARNSSVEI  355

Query  13   FL  8
            +L
Sbjct  356  YL  357



>ref|XP_006600884.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X4 [Glycine 
max]
Length=310

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 4/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
             +QLRR L EKRQRHYRALL  AEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ
Sbjct  136  AEQLRRALAEKRQRHYRALLSTAEEAVARRLREKEAEVEMATRKNAELEARAAKLSVEAQ  195

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TAA+LQAQLQQ IM+ G   E       +    G AEDAESAYIDP+RV
Sbjct  196  VWQAKARAQEATAASLQAQLQQTIMSHGG--EELAAVGVSSAVEGQAEDAESAYIDPERV  253

Query  169  VLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL++++S+VEVFL
Sbjct  254  VVATTARPKCRGCAKRVASVVVLPCRHLCICTECDAHFRACPVCLTLKNSTVEVFL  309



>ref|XP_006600883.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X3 [Glycine 
max]
Length=315

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 4/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
             +QLRR L EKRQRHYRALL  AEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ
Sbjct  141  AEQLRRALAEKRQRHYRALLSTAEEAVARRLREKEAEVEMATRKNAELEARAAKLSVEAQ  200

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TAA+LQAQLQQ IM+ G   E       +    G AEDAESAYIDP+RV
Sbjct  201  VWQAKARAQEATAASLQAQLQQTIMSHGG--EELAAVGVSSAVEGQAEDAESAYIDPERV  258

Query  169  VLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL++++S+VEVFL
Sbjct  259  VVATTARPKCRGCAKRVASVVVLPCRHLCICTECDAHFRACPVCLTLKNSTVEVFL  314



>ref|XP_006579664.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3-like 
isoform X2 [Glycine max]
Length=351

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 9/179 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALL AAEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ
Sbjct  176  GEQLRRALAEKRQRHYRALLSAAEEAVARQLREKEAEVEMATRKNAELEARAAKLSVEAQ  235

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDG---NapacgaggdaedaesAYIDP  179
             WQA+ARAQE TA +LQ +LQQ I++ G     ED       +    G AEDAESAYIDP
Sbjct  236  VWQAKARAQEATAVSLQTKLQQTILSHGG----EDPAVVGVSSAAVEGQAEDAESAYIDP  291

Query  178  DRVVLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV +    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL+ ++S+VEVFL
Sbjct  292  DRVVAATAARPKCRGCAKRVASVVVLPCRHLCVCTECDAHFRACPVCLTPKNSTVEVFL  350



>ref|XP_003524323.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3-like 
isoform X1 [Glycine max]
Length=350

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 9/179 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKRQRHYRALL AAEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ
Sbjct  175  GEQLRRALAEKRQRHYRALLSAAEEAVARQLREKEAEVEMATRKNAELEARAAKLSVEAQ  234

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDG---NapacgaggdaedaesAYIDP  179
             WQA+ARAQE TA +LQ +LQQ I++ G     ED       +    G AEDAESAYIDP
Sbjct  235  VWQAKARAQEATAVSLQTKLQQTILSHGG----EDPAVVGVSSAAVEGQAEDAESAYIDP  290

Query  178  DRVVLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DRVV +    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL+ ++S+VEVFL
Sbjct  291  DRVVAATAARPKCRGCAKRVASVVVLPCRHLCVCTECDAHFRACPVCLTPKNSTVEVFL  349



>ref|XP_004511753.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=333

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+RTLEEKRQR+ RA+L +AEE+VAR+LREKE E+EKA RRN+EL ARA QL AEAQ
Sbjct  157  GEELQRTLEEKRQRNCRAILKSAEETVARRLREKEIEIEKATRRNAELEARAAQLKAEAQ  216

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED--GNapacgaggdaedaesAYIDPD  176
             W  +A++QE TA +LQ QL Q +MN GA +  +D  G + A G  G AEDAES YIDP+
Sbjct  217  IWMTKAKSQEATAISLQTQLHQAMMNGGAEKRGDDNCGLSCALGVEGQAEDAESGYIDPE  276

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            R  +  GP C+ C KR+ASVV+LPCRHLC+C+ CD   +ACP+CL+V++S+VE++L
Sbjct  277  RXXVMSGPKCRGCGKRVASVVLLPCRHLCVCNECDTHFRACPVCLTVKNSTVEIYL  332



>ref|XP_007155735.1| hypothetical protein PHAVU_003G227200g [Phaseolus vulgaris]
 gb|ESW27729.1| hypothetical protein PHAVU_003G227200g [Phaseolus vulgaris]
Length=347

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQ+HY ALLGAAEE+VAR+LREKEAEVEKA R+N+EL ARA QLS EAQ
Sbjct  176  GEQLRRTLAEKRQKHYNALLGAAEEAVARRLREKEAEVEKATRKNAELEARAAQLSVEAQ  235

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+ARAQE TAA+LQAQLQQ +   G     E     +C   G AEDAESA+IDP+RV
Sbjct  236  VWQAKARAQEATAASLQAQLQQTMCQGG----EEAAAGVSCAVEGQAEDAESAHIDPERV  291

Query  169  VLSPG-PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            VL+   P C+ C KR+AS+VVLPCRHLC+C+ CDA  +ACP+CL+ ++S+VEVFL
Sbjct  292  VLAVARPKCRGCTKRVASIVVLPCRHLCICTECDAHFRACPVCLTPKNSTVEVFL  346



>ref|XP_003549963.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X1 [Glycine 
max]
Length=357

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L EKRQRHYRALL  AEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ 
Sbjct  184  EQLRRALAEKRQRHYRALLSTAEEAVARRLREKEAEVEMATRKNAELEARAAKLSVEAQV  243

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+ARAQE TAA+LQAQLQQ IM+ G   E       +    G AEDAESAYIDP+RVV
Sbjct  244  WQAKARAQEATAASLQAQLQQTIMSHGG--EELAAVGVSSAVEGQAEDAESAYIDPERVV  301

Query  166  LSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            ++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL++++S+VEVFL
Sbjct  302  VATTARPKCRGCAKRVASVVVLPCRHLCICTECDAHFRACPVCLTLKNSTVEVFL  356



>ref|XP_006600882.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X2 [Glycine 
max]
Length=358

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L EKRQRHYRALL  AEE+VAR+LREKEAEVE A R+N+EL ARA +LS EAQ 
Sbjct  185  EQLRRALAEKRQRHYRALLSTAEEAVARRLREKEAEVEMATRKNAELEARAAKLSVEAQV  244

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+ARAQE TAA+LQAQLQQ IM+ G   E       +    G AEDAESAYIDP+RVV
Sbjct  245  WQAKARAQEATAASLQAQLQQTIMSHGG--EELAAVGVSSAVEGQAEDAESAYIDPERVV  302

Query  166  LSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            ++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL++++S+VEVFL
Sbjct  303  VATTARPKCRGCAKRVASVVVLPCRHLCICTECDAHFRACPVCLTLKNSTVEVFL  357



>gb|KEH27484.1| SBP (S-ribonuclease-binding protein) family protein [Medicago 
truncatula]
Length=272

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+RT+EEKRQR+YRA++  AEE+VAR+LREKE +++KA RRN+EL ARA  L  EAQ
Sbjct  96   GEELQRTIEEKRQRNYRAIIKTAEETVARRLREKEIDLQKATRRNAELEARAAHLRTEAQ  155

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQ--EREDGNapacgaggdaedaesAYIDPD  176
             WQA+A+ QE TA +LQ QL   +M+ GA    E E G + A G  G AEDAES YIDP+
Sbjct  156  LWQAKAKEQEATAISLQTQLHHAMMSGGAENRGENECGLSCALGVEGHAEDAESGYIDPE  215

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            R V+  GP C+ C +R+ASVVVLPCRHLC+C+ CD     CP+C +V++S+VEV+L
Sbjct  216  RAVVGSGPKCRGCGERVASVVVLPCRHLCVCTECDTRFGVCPVCFTVKNSTVEVYL  271



>ref|XP_004508983.1| PREDICTED: baculoviral IAP repeat-containing protein 2-like isoform 
X1 [Cicer arietinum]
Length=325

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 7/176 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ +RR+L EKRQRHYR LL AAEE+V ++L+EKE E  KA  +N+EL ARA QL+ EAQ
Sbjct  154  GENVRRSLAEKRQRHYRELLKAAEETVEQRLKEKETEFAKATCKNAELEARAAQLTMEAQ  213

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQARARA E  AA++QA+LQ+ IM     Q  EDG       G   +   + YIDPDRV
Sbjct  214  VWQARARAHEAAAASIQAELQKTIM----CQTNEDGGGVISSTGQAEDAESA-YIDPDRV  268

Query  169  VL--SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             +  +P P C+ C KR+ SVVVLPCRHLC+C+ CD   +ACP+CL++++S+V +FL
Sbjct  269  AMISAPRPKCRGCGKRVPSVVVLPCRHLCICTECDHHFRACPVCLTLKNSTVHIFL  324



>ref|XP_004508984.1| PREDICTED: baculoviral IAP repeat-containing protein 2-like isoform 
X2 [Cicer arietinum]
Length=324

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 7/176 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ +RR+L EKRQRHYR LL AAEE+V ++L+EKE E  KA  +N+EL ARA QL+ EAQ
Sbjct  153  GENVRRSLAEKRQRHYRELLKAAEETVEQRLKEKETEFAKATCKNAELEARAAQLTMEAQ  212

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQARARA E  AA++QA+LQ+ IM     Q  EDG       G   +   + YIDPDRV
Sbjct  213  VWQARARAHEAAAASIQAELQKTIM----CQTNEDGGGVISSTGQAEDAESA-YIDPDRV  267

Query  169  VL--SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             +  +P P C+ C KR+ SVVVLPCRHLC+C+ CD   +ACP+CL++++S+V +FL
Sbjct  268  AMISAPRPKCRGCGKRVPSVVVLPCRHLCICTECDHHFRACPVCLTLKNSTVHIFL  323



>ref|XP_003611413.1| Baculoviral IAP repeat-containing protein [Medicago truncatula]
 gb|AES94371.1| SBP (S-ribonuclease-binding protein) family protein [Medicago 
truncatula]
 gb|AFK47053.1| unknown [Medicago truncatula]
Length=335

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+RT+EEKRQR+YRA++  AEE+VAR+LREKE +++KA RRN+EL ARA  L  EAQ
Sbjct  159  GEELQRTIEEKRQRNYRAIIKTAEETVARRLREKEIDLQKATRRNAELEARAAHLRTEAQ  218

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQ--EREDGNapacgaggdaedaesAYIDPD  176
             WQA+A+ QE TA +LQ QL   +M+ GA    E E G + A G  G AEDAES YIDP+
Sbjct  219  LWQAKAKEQEATAISLQTQLHHAMMSGGAENRGENECGLSCALGVEGHAEDAESGYIDPE  278

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            R V+  GP C+ C +R+ASVVVLPCRHLC+C+ CD     CP+C +V++S+VEV+L
Sbjct  279  RAVVGSGPKCRGCGERVASVVVLPCRHLCVCTECDTRFGVCPVCFTVKNSTVEVYL  334



>ref|XP_007156605.1| hypothetical protein PHAVU_002G002700g [Phaseolus vulgaris]
 gb|ESW28599.1| hypothetical protein PHAVU_002G002700g [Phaseolus vulgaris]
Length=317

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 136/175 (78%), Gaps = 10/175 (6%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L EKR RHYR LL AAEESV R+LREKEAEVEKA RRN+EL ARA QL  E Q
Sbjct  151  GEQLRRALAEKRGRHYRTLLRAAEESVLRRLREKEAEVEKATRRNAELEARAAQLGLETQ  210

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacg-aggdaedaesAYIDPDR  173
             WQA+A+AQE TA +LQAQLQQ IM+ G     EDG A     AGG+AEDAESAY+DP+R
Sbjct  211  LWQAKAKAQEATAVSLQAQLQQAIMSGG-----EDGAAGGLSCAGGEAEDAESAYVDPER  265

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V    GP C+ C KR+A+VVVLPCRHLC+C+ C+   +ACP+CL+V++S+V+V+L
Sbjct  266  V----GPKCRGCAKRVATVVVLPCRHLCICAQCNTHFRACPVCLTVKNSTVQVYL  316



>ref|XP_006590588.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
[Glycine max]
Length=329

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKRQRHYR LL AAEESV R+LREKEAEVEKA RRN+EL ARA QLS EAQ
Sbjct  159  GEQLRRTLAEKRQRHYRTLLRAAEESVLRRLREKEAEVEKATRRNAELEARAAQLSVEAQ  218

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQA+A+AQE TAA LQAQL Q +M++G  ++          AGG+AEDAESAY+DP+RV
Sbjct  219  LWQAKAKAQEATAAALQAQLHQAMMSSGGGEDGGG--GGLSCAGGEAEDAESAYVDPERV  276

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
               P P C+ C KR+ASVVVLPCRHLC+C+ CD   +ACP+CL+V++S+++V+L
Sbjct  277  --GPTPKCRGCAKRVASVVVLPCRHLCICAECDGHFRACPVCLTVKNSTIQVYL  328



>ref|XP_004147249.1| PREDICTED: uncharacterized protein LOC101209391 [Cucumis sativus]
 ref|XP_004167863.1| PREDICTED: uncharacterized LOC101209391 [Cucumis sativus]
 gb|KGN55804.1| hypothetical protein Csa_3G016980 [Cucumis sativus]
Length=331

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL EKRQRHYR LL AAEE   R+LREKE EVEKA RR++EL ARA +LS EA A
Sbjct  161  EELRRTLAEKRQRHYRELLAAAEERAVRRLREKEVEVEKATRRHAELEARAARLSMEAAA  220

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQ +ARA+E  AA LQAQLQQ IM    +                AEDAES YIDP+RV+
Sbjct  221  WQEKARAEEAAAAALQAQLQQAIMRGTGIGG---SGDGGVVGDCTAEDAESGYIDPERVL  277

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
               GPSCK+CRKR+ASVV+LPCRH C+CS CD V + CPLC + R+SSVEV+L
Sbjct  278  AESGPSCKSCRKRVASVVLLPCRHFCVCSVCDHVVRTCPLCRASRNSSVEVYL  330



>ref|XP_006573701.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
isoform X1 [Glycine max]
 ref|XP_006573702.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
isoform X2 [Glycine max]
Length=322

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 131/173 (76%), Gaps = 5/173 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L EKRQRHYR LL AAEESV R+LREKEAE+EKA R N+EL ARA QLS EAQ 
Sbjct  154  EQLRRALAEKRQRHYRTLLRAAEESVLRRLREKEAELEKATRHNAELEARATQLSVEAQL  213

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQARA+AQE TAA LQAQLQQ +M          G      AGG AEDAESAY+DPDRV 
Sbjct  214  WQARAKAQEATAAALQAQLQQAMM---IGDGENGGGGGLSCAGGGAEDAESAYVDPDRV-  269

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              P P C+ C KR+ASVVVLPCRHLC+C+ CD   +ACP+CL+V++S+VEV+L
Sbjct  270  -GPTPKCRGCAKRVASVVVLPCRHLCICAECDTHFRACPVCLTVKNSTVEVYL  321



>gb|KEH31582.1| SBP (S-ribonuclease-binding protein) family protein [Medicago 
truncatula]
Length=286

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 7/177 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL +KRQ+HYR LL AAEE+VAR+LREKE E  KA RRN+EL AR  QL+ EAQ
Sbjct  113  GENLRRTLADKRQKHYRELLNAAEEAVARRLREKEVEFAKATRRNAELEARTAQLTMEAQ  172

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDR  173
             WQA+ARAQE  AA+LQAQLQQ IM     Q  ED G   +CG  G AEDAESAYIDPDR
Sbjct  173  VWQAKARAQEAAAASLQAQLQQTIM----CQTGEDAGGGVSCGVEGQAEDAESAYIDPDR  228

Query  172  VV--LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            VV   +    C+ C KR+A+VVVLPCRHLC+C+ CDA  + CP+C + ++S+VEVFL
Sbjct  229  VVEVAAARGKCRGCEKRVATVVVLPCRHLCVCTECDAHFRVCPVCFTPKNSTVEVFL  285



>gb|KEH31583.1| SBP (S-ribonuclease-binding protein) family protein [Medicago 
truncatula]
Length=331

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 7/177 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL +KRQ+HYR LL AAEE+VAR+LREKE E  KA RRN+EL AR  QL+ EAQ
Sbjct  158  GENLRRTLADKRQKHYRELLNAAEEAVARRLREKEVEFAKATRRNAELEARTAQLTMEAQ  217

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDR  173
             WQA+ARAQE  AA+LQAQLQQ IM     Q  ED G   +CG  G AEDAESAYIDPDR
Sbjct  218  VWQAKARAQEAAAASLQAQLQQTIM----CQTGEDAGGGVSCGVEGQAEDAESAYIDPDR  273

Query  172  VV--LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            VV   +    C+ C KR+A+VVVLPCRHLC+C+ CDA  + CP+C + ++S+VEVFL
Sbjct  274  VVEVAAARGKCRGCEKRVATVVVLPCRHLCVCTECDAHFRVCPVCFTPKNSTVEVFL  330



>ref|XP_010055389.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Eucalyptus 
grandis]
 gb|KCW71846.1| hypothetical protein EUGRSUZ_E00327 [Eucalyptus grandis]
Length=331

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKR+R YRALL AAEESVAR+LREK+AE EKAARRN+EL ARA QL AE +
Sbjct  158  GEQLRRTLAEKRRRQYRALLVAAEESVARRLREKDAEAEKAARRNAELSARAAQLGAEVR  217

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AW+A+ARAQE  AA+LQAQL +      +      G   A      AEDAES Y DPDR 
Sbjct  218  AWEAKARAQEAAAASLQAQLVKAQAMMVSENNGGGGGGEAGPPEAQAEDAESVYADPDRA  277

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V S GP C+AC +R+A+VV+LPCRH C+C+ CD V  ACP+C  +R SSVEVFL
Sbjct  278  VGS-GPGCRACGERVATVVLLPCRHFCVCAECDRVVGACPVCFCMRGSSVEVFL  330



>ref|XP_006398399.1| hypothetical protein EUTSA_v10000973mg [Eutrema salsugineum]
 gb|ESQ39852.1| hypothetical protein EUTSA_v10000973mg [Eutrema salsugineum]
Length=302

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E  +RHYR LL   EESV R+LREKEAE+EKA RR++EL ARA Q+  E++
Sbjct  130  GEQLRRMLAENSERHYRELLRTTEESVRRRLREKEAEIEKATRRHAELEARAAQIETESR  189

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ RA  +E  AA+LQA+LQQ   + G V   E   + +     +AEDAESAY+DPDR 
Sbjct  190  AWQVRAAGREAEAASLQARLQQAFAHGGGVTAAEP-KSGSVDGVDEAEDAESAYVDPDRF  248

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             L+ GPSC+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  249  ELT-GPSCRICRRRSATVLALPCRHLALCKGCDGSVRVCPLCLSSKNSSVEVFF  301



>ref|XP_008448752.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Cucumis melo]
Length=334

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRR L EKRQRHYR +L AAEE  AR+LREKE EVEKA RR++EL ARA +LS EA A
Sbjct  164  EELRRALAEKRQRHYREILAAAEERAARRLREKEVEVEKATRRHAELEARAARLSMEAAA  223

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQ +ARA+E  AA LQAQLQQ IM    +                AEDAES YIDPDRV+
Sbjct  224  WQEKARAEEAAAAALQAQLQQAIMRGTGIGG---SGDGGVVGDCTAEDAESGYIDPDRVI  280

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
               GPSCK+CRKR+ASVV+LPCRH CLCS CD V + CPLC + R+SSVEV+L
Sbjct  281  AESGPSCKSCRKRVASVVLLPCRHFCLCSVCDHVVRTCPLCRASRNSSVEVYL  333



>gb|KFK31409.1| hypothetical protein AALP_AA6G108300 [Arabis alpina]
Length=304

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E  +RHYR LL   EESV R+L+EKEAE+EKA RR++EL ARA Q+  E++
Sbjct  131  GEQLRRMLAENSERHYRELLRTTEESVRRRLKEKEAEIEKATRRHAELEARASQIETESR  190

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQARA A+E  A +LQAQLQQ + + G  +  E  +  A     +AEDAES Y+DPDRV
Sbjct  191  AWQARAAAREAEATSLQAQLQQAVAHGGGFKPAEPKSENAIDGVDEAEDAESTYVDPDRV  250

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             +  GP C+ CR+R A+V+ LPCRHL LC  C    + CPLCLS ++SSVEV+ 
Sbjct  251  EV-IGPGCRICRRRTATVLALPCRHLVLCKGCAGSVRVCPLCLSSKNSSVEVYF  303



>emb|CDY43447.1| BnaAnng07190D [Brassica napus]
Length=302

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR  L + R+RHYR LL   EESV R+L EKEAE+EKA RR++EL ARA Q+  EA+
Sbjct  130  GEQLRCMLADSRERHYRELLRTREESVRRRLGEKEAEMEKATRRHAELEARAAQIEKEAR  189

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ RA A+E  A +LQA+LQQV+ + G V   E     +     +A DAES Y+DPDR 
Sbjct  190  AWQVRAAAKEAEAMSLQARLQQVVAHGGGVTAAEP-KLKSVDGVDEAGDAESVYVDPDRF  248

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             L+ GPSC+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS+++SSVEVF 
Sbjct  249  ELN-GPSCRICRRRAATVLALPCRHLVLCKGCDGSVRVCPLCLSLKNSSVEVFF  301



>ref|XP_009114308.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Brassica 
rapa]
Length=302

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR  L + R+RHYR LL   EESV R+L EKEAE+EKA RR++EL ARA Q+  EA+
Sbjct  130  GEQLRCMLADSRERHYRELLRTREESVRRRLGEKEAEIEKATRRHAELEARAAQIEKEAR  189

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ RA A+E  A +LQA+LQQV+ + G V   E     +     +A DAES Y+DPDR 
Sbjct  190  AWQVRAAAKEAEAMSLQARLQQVVAHGGGVTAAEP-KLKSVDGVDEAGDAESVYVDPDRF  248

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             L+ GPSC+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS+++SSVEVF 
Sbjct  249  ELN-GPSCRICRRRAATVLALPCRHLVLCKGCDGSVRVCPLCLSLKNSSVEVFF  301



>emb|CDX77733.1| BnaC07g19870D [Brassica napus]
Length=300

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L E  +RHYR LL   EESV R+LREKEAE+EKA RR++EL +RA Q+  E++A
Sbjct  129  EQLRRMLAENSERHYRELLKTTEESVRRRLREKEAEIEKATRRHAELESRAMQIETESRA  188

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQARA ++E  A TLQA+LQQ + + G V   E  N+ +     +AEDAESAY+DPDR+ 
Sbjct  189  WQARAASKEAEATTLQARLQQAVAHGGGVTVAEP-NSGSVDGVDEAEDAESAYVDPDRLE  247

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            L+ GPSC+ C +R A+V+ LPCRHL LC  CD   + CPLCL  ++SSVEVF 
Sbjct  248  LT-GPSCRICWRRSATVLALPCRHLILCKGCDGSVRVCPLCLGSKNSSVEVFF  299



>ref|XP_009101452.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Brassica rapa]
Length=303

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L E  +RHYR LL   EESV R+LREKEAE+EKA RR++EL ARA Q+  E++A
Sbjct  132  EQLRRMLAENSERHYRELLKTTEESVRRRLREKEAEIEKATRRHAELEARAMQIETESRA  191

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQARA ++E  A TLQA+LQQ + + G     E  N+ +     +AEDAESAY+DPDR+ 
Sbjct  192  WQARAASKEAEATTLQARLQQAVAHGGGDTVAEP-NSGSVDGVDEAEDAESAYVDPDRLE  250

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            L+ GPSC+ C +R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  251  LT-GPSCRICWRRSATVLALPCRHLILCKGCDGSVRVCPLCLSSKNSSVEVFF  302



>emb|CDY33511.1| BnaA06g35620D [Brassica napus]
Length=303

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L E  +RHYR LL   EESV R+LREKEAE+EKA RR++EL ARA Q+  E++A
Sbjct  132  EQLRRMLAENSERHYRELLKTTEESVRRRLREKEAEIEKATRRHAELEARATQIETESRA  191

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQARA ++E  A TLQA+LQQ + +   V   E  N+ +     +AEDAESAY+DPDR+ 
Sbjct  192  WQARAASKEAEATTLQARLQQAVAHGAGVTVAEP-NSGSVDGVDEAEDAESAYVDPDRLE  250

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            L+ GPSC+ C +R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  251  LT-GPSCRICWRRSATVLALPCRHLILCKGCDGSVRVCPLCLSSKNSSVEVFF  302



>ref|XP_009101453.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Brassica rapa]
Length=300

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -3

Query  523  QLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqaw  344
            QLRR L E  +RHYR LL   EESV R+LREKEAE+EKA RR++EL ARA Q+  E++AW
Sbjct  130  QLRRMLAENSERHYRELLKTTEESVRRRLREKEAEIEKATRRHAELEARAMQIETESRAW  189

Query  343  qararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVVL  164
            QARA ++E  A TLQA+LQQ + + G     E  N+ +     +AEDAESAY+DPDR+ L
Sbjct  190  QARAASKEAEATTLQARLQQAVAHGGGDTVAEP-NSGSVDGVDEAEDAESAYVDPDRLEL  248

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            + GPSC+ C +R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  249  T-GPSCRICWRRSATVLALPCRHLILCKGCDGSVRVCPLCLSSKNSSVEVFF  299



>ref|XP_010481380.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Camelina 
sativa]
Length=309

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E   RHYR LL   EESV R+LREKEAEV+KA RR++EL ARA Q+  E++
Sbjct  133  GEQLRRMLAENNDRHYRELLRTTEESVRRRLREKEAEVDKATRRHAELEARASQIETESR  192

Query  349  awqararaqevtaatlqaqlqqVIMNA---GAVQEREDGNapacgaggdaedaesAYIDP  179
            AWQ RA A+E  A +LQA LQQ +  A   G V    + N+ +     +AEDAESAY+DP
Sbjct  193  AWQVRAAAREAEATSLQAHLQQAVFEAAHRGGVITTAEQNSGSVDGADEAEDAESAYVDP  252

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DR  +  GP C+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  253  DRCEMI-GPGCRICRRRSATVLALPCRHLVLCQGCDGSVRVCPLCLSTKNSSVEVFY  308



>ref|XP_010441512.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Camelina 
sativa]
Length=309

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 122/177 (69%), Gaps = 4/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E   RHYR LL   EESV R+LREKEAEV+KA RR++EL ARA Q+  E++
Sbjct  133  GEQLRRMLTENNDRHYRELLRTTEESVRRRLREKEAEVDKATRRHAELEARASQIETESR  192

Query  349  awqararaqevtaatlqaqlqqVIMNA---GAVQEREDGNapacgaggdaedaesAYIDP  179
            AWQ RA A+E  A +LQAQLQQ +  A   G V    + N+ +     +AEDAESAY+DP
Sbjct  193  AWQVRAAAREAEATSLQAQLQQAVFAAAHRGGVITTAEQNSGSVDGADEAEDAESAYVDP  252

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DR  +  GP C+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  253  DRCEMI-GPGCRICRRRSATVLALPCRHLVLCKGCDGSVRVCPLCLSTKNSSVEVFY  308



>ref|XP_006305399.1| hypothetical protein CARUB_v10009788mg [Capsella rubella]
 gb|EOA38297.1| hypothetical protein CARUB_v10009788mg [Capsella rubella]
Length=317

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL E+R +HY+AL+GA EE + RKLREKEAE+E+A RR+ EL AR  QL  +AQA
Sbjct  142  EELRRTLVERRNKHYKALIGAVEEPLVRKLREKEAEIERATRRHDELVARESQLRNDAQA  201

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQER-----EDGNapacgaggdaedaesAYID  182
            WQ  A++QE TAA+LQAQL Q +   G +  +     E+G   A       EDAESAYID
Sbjct  202  WQGIAKSQEATAASLQAQLHQAVNKCGGLSAQDSRAAEEGLLCAGAGISGLEDAESAYID  261

Query  181  PDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            P+R+     PSCKACRKR A+VV+LPCRHL +C  CD  A ACPLCL++R+SSVE  LC
Sbjct  262  PERMTR---PSCKACRKREATVVMLPCRHLSICPGCDRTALACPLCLTLRNSSVEAILC  317



>ref|XP_010494913.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Camelina 
sativa]
Length=309

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 124/177 (70%), Gaps = 4/177 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E  +RHYR LL   EESV R+LREKEAEV+KA RR++EL ARA Q+  E++
Sbjct  133  GEQLRRMLAENNERHYRELLRTTEESVRRRLREKEAEVDKATRRHAELEARASQIETESR  192

Query  349  awqararaqevtaatlqaqlqqVIMNA---GAVQEREDGNapacgaggdaedaesAYIDP  179
            AWQ RA A+E  A +LQAQLQQV+  A   G V    + N+ +     +AEDAESAY+DP
Sbjct  193  AWQVRAAAREAEATSLQAQLQQVVFAAAHRGGVITTAEQNSGSLDGADEAEDAESAYVDP  252

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DR  +  GP C+ CR+R A+V+ LPCRHL LC  CD   + CPLCL+ ++SSVEVF 
Sbjct  253  DRCEM-IGPGCRICRRRSATVLALPCRHLVLCKGCDGSVRVCPLCLNTKNSSVEVFY  308



>ref|XP_010480841.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Camelina sativa]
Length=179

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL E+R++HY+AL+GA EE + RKLREKEAE+E+A RR++EL AR  QL A+A+A
Sbjct  11   EELRRTLAERRKKHYKALIGAVEELLVRKLREKEAEIERATRRHNELVARESQLRAQAEA  70

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQ RA+AQE  AA+LQAQLQQ +   G V   E             +DAESAY+DP+R+ 
Sbjct  71   WQGRAKAQEAAAASLQAQLQQAVNKCGGVSAEE--GLVLGAGISGVDDAESAYVDPERM-  127

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
                PSCKACRK  A++V+LPCRHL +C  CD  A ACPLCL++RSSSVE  LC
Sbjct  128  --KRPSCKACRKMEATLVMLPCRHLSICPGCDRTALACPLCLTLRSSSVEAILC  179



>gb|AAF25971.1|AC017118_8 F6N18.12 [Arabidopsis thaliana]
Length=277

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
             ++LRRTL EKR+ HY+ALLGA EES+ RKLREKE E+E+A RR++EL AR  QL AE Q
Sbjct  101  AEELRRTLAEKRKMHYKALLGAVEESLVRKLREKEVEIERATRRHNELVARDSQLRAEVQ  160

Query  349  awqararaqevtaatlqaqlqqVIMN-AGAVQEREDGNapac----gaggdaedaesAYI  185
             WQ RA+A E  AA+LQ+QLQQ +   AG     +D  A             +DAES Y+
Sbjct  161  VWQERAKAHEDAAASLQSQLQQAVNQCAGGCVSAQDSRAAEEGLLCTTISGVDDAESVYV  220

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            DP+RV     P+CKACR+R A+VVVLPCRHL +C  CD  A ACPLCL++R+SSVE   C
Sbjct  221  DPERV---KRPNCKACREREATVVVLPCRHLSICPGCDRTALACPLCLTLRNSSVEAIFC  277



>ref|XP_009128924.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X1 [Brassica 
rapa]
 ref|XP_009128926.1| PREDICTED: E3 ubiquitin-protein ligase BOI isoform X2 [Brassica 
rapa]
 emb|CDY37172.1| BnaA02g24910D [Brassica napus]
Length=302

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 117/172 (68%), Gaps = 2/172 (1%)
 Frame = -3

Query  523  QLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqaw  344
            +LRR L E  +RHYR LL   EESV R+LREKEAE+ KA RR +EL ARA Q+  E++AW
Sbjct  132  ELRRMLAENNERHYRELLRTTEESVRRRLREKEAEIVKATRRYAELEARAAQMETESRAW  191

Query  343  qararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVVL  164
            Q RA A+E  A +LQ +LQQ   N G V   E   + +     +AEDAESAY+DPDR  L
Sbjct  192  QVRAAAREAEATSLQVRLQQAFANGGGVTATEP-KSGSGDCVDEAEDAESAYVDPDRFEL  250

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              GPSC+ CR+R A+V+ LPCRHL LC  CD   + CP+CLS ++SSVEVF 
Sbjct  251  I-GPSCRICRRRSATVLALPCRHLILCKGCDGSVRVCPVCLSSKNSSVEVFF  301



>ref|NP_564408.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
 gb|AAM63608.1| unknown [Arabidopsis thaliana]
 gb|AEE31523.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
Length=312

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
             ++LRRTL EKR+ HY+ALLGA EES+ RKLREKE E+E+A RR++EL AR  QL AE Q
Sbjct  136  AEELRRTLAEKRKMHYKALLGAVEESLVRKLREKEVEIERATRRHNELVARDSQLRAEVQ  195

Query  349  awqararaqevtaatlqaqlqqVIMN-AGAVQEREDGNapac----gaggdaedaesAYI  185
             WQ RA+A E  AA+LQ+QLQQ +   AG     +D  A             +DAES Y+
Sbjct  196  VWQERAKAHEDAAASLQSQLQQAVNQCAGGCVSAQDSRAAEEGLLCTTISGVDDAESVYV  255

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            DP+RV     P+CKACR+R A+VVVLPCRHL +C  CD  A ACPLCL++R+SSVE   C
Sbjct  256  DPERV---KRPNCKACREREATVVVLPCRHLSICPGCDRTALACPLCLTLRNSSVEAIFC  312



>emb|CDY51856.1| BnaC02g47560D [Brassica napus]
Length=303

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 117/174 (67%), Gaps = 2/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G +LRR L E  +RHYR LL   EESV R+LREKEAE+ KA RR +EL ARA Q+  E++
Sbjct  131  GAELRRMLTENNERHYRELLRTTEESVRRRLREKEAEIVKATRRYAELEARAAQMETESR  190

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ RA A+E  A +LQ +LQQ   N G V    D  + +     +AEDAESAY+DPDR 
Sbjct  191  AWQVRAAAREAEATSLQVRLQQAFANGGGVTA-TDPKSGSDDCVDEAEDAESAYVDPDRF  249

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             L  GPSC+ CR+R A+V+ LPCRHL LC  CD   + CP+CLS ++SSVEV  
Sbjct  250  ELI-GPSCRICRRRSATVLALPCRHLILCKGCDGSVRVCPVCLSSKNSSVEVLF  302



>emb|CDY03162.1| BnaC09g19940D [Brassica napus]
Length=322

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR  L +  +RHYR LL   EESV R+LREKEAE+E+A RR++EL ARA Q+  EA+
Sbjct  150  GEQLRCMLADTGERHYRELLRTREESVRRRLREKEAEIERATRRHAELEARAAQIEKEAR  209

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQ RA A+E  A +LQA+LQQV+ + G V   E     +     +A DAES Y+DPDR 
Sbjct  210  AWQVRAAAKEAEAMSLQARLQQVVAHGGGVTAAEP-KLKSVDGVDEAGDAESVYVDPDRF  268

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              S GPSC+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS+++SSVEVF 
Sbjct  269  E-SNGPSCRICRRRAATVLALPCRHLILCKGCDGSVRVCPLCLSLKNSSVEVFF  321



>ref|XP_010461100.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Camelina sativa]
Length=326

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL E+R++HY+AL+GA EE + RKL+EKEAE+E+A RR++EL AR  QL AEA+A
Sbjct  158  EELRRTLVERRKKHYKALIGAVEEPLVRKLKEKEAEIERATRRHNELVARESQLRAEAEA  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQ RA+AQE  AA+LQAQL Q +   G V   E             +DAESAY+DP+R+ 
Sbjct  218  WQGRAKAQEAAAASLQAQLHQAVNKCGGVSAEE--GLVLGAEISGVDDAESAYVDPERM-  274

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
                P+CKACRK  A+VV+LPCRH+ +C  CD  A ACPLCL++RSSSVE  LC
Sbjct  275  --KRPTCKACRKMEATVVMLPCRHMSICPGCDRTALACPLCLTLRSSSVEAILC  326



>ref|XP_010499827.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Camelina sativa]
Length=311

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL E+R++HY+AL+GA EE++ RKLREKEAE+E+A RR++EL AR  QL AEA+A
Sbjct  143  EELRRTLAERRKKHYKALIGAVEETLVRKLREKEAEIERATRRHNELVARESQLRAEAEA  202

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQ RA+AQE  AA+LQAQL Q +   G V   E             +DAESAY+DP+R+ 
Sbjct  203  WQGRAKAQEAAAASLQAQLHQAVNKCGGVSAEE--GVVLGAGISGVDDAESAYVDPERM-  259

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
                PSCKAC+K  A+VV+LPCRH+ +C  CD  A ACPLCL++R+SSVE  LC
Sbjct  260  --KRPSCKACQKMEATVVMLPCRHMSICPGCDRTALACPLCLTLRNSSVEAILC  311



>ref|XP_002891007.1| hypothetical protein ARALYDRAFT_336359 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67266.1| hypothetical protein ARALYDRAFT_336359 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 126/178 (71%), Gaps = 12/178 (7%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL EKR++HY+ALLGA EE + RKLREKEAE+E+A RR++EL  R  QL AEAQ 
Sbjct  142  EELRRTLVEKRKKHYKALLGAVEEPLVRKLREKEAEIERATRRHNELVTRDSQLRAEAQE  201

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQER-----EDGNapacgaggdaedaesAYID  182
            WQ RA+AQE  AA+LQAQLQQ +   G V  +     EDG           +DAES Y+D
Sbjct  202  WQERAKAQEAAAASLQAQLQQAVNKCGRVSAQDSRAAEDG----TAGISGLDDAESVYVD  257

Query  181  PDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            P+R+     PSCKACR+R A+VVVLPCRHL +C  CD  A ACPLCL++R+SSVE  L
Sbjct  258  PERM---RRPSCKACREREATVVVLPCRHLSICPECDRTALACPLCLTLRNSSVEAIL  312



>ref|NP_199516.1| S-ribonuclease binding protein [Arabidopsis thaliana]
 dbj|BAB10244.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36098.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14227.1| unknown protein [Arabidopsis thaliana]
 gb|AED95461.1| S-ribonuclease binding protein [Arabidopsis thaliana]
Length=300

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+R L E  +R+YR LL   EESV R+LREKEAE+EKA RR+ EL ARA Q+  EA+
Sbjct  125  GEQLKRMLAENSERNYRELLRTTEESVRRRLREKEAEIEKATRRHVELEARATQIETEAR  184

Query  349  awqararaqevtaatlqaqlqqVIM--NAGAVQEREDGNapacgaggdaedaesAYIDPD  176
            AWQ RA A+E  A +LQAQL Q ++  + G V    +  + +     +AEDAESAY+DPD
Sbjct  185  AWQMRAAAREAEATSLQAQLHQAVVVAHGGGVITTVEPQSGSVDGVDEAEDAESAYVDPD  244

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            RV +  GP C+ CR+R A+V+ LPCRHL +C+ CD   + CPLCLS ++SSVEVF
Sbjct  245  RVEM-IGPGCRICRRRSATVLALPCRHLVMCTECDGSVRICPLCLSTKNSSVEVF  298



>ref|XP_006280993.1| hypothetical protein CARUB_v10027000mg [Capsella rubella]
 gb|EOA13891.1| hypothetical protein CARUB_v10027000mg [Capsella rubella]
Length=247

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 5/178 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR  L E  +RHYR LL   EESV R+LREKE E+EKA RR++EL ARA Q+  E++
Sbjct  70   GEQLRCMLAENNERHYRELLRTTEESVRRRLREKETEIEKATRRHAELEARAAQIETESR  129

Query  349  awqararaqevtaatlqaqlqqVIMNA----GAVQEREDGNapacgaggdaedaesAYID  182
            AWQ RA A+E  A +LQAQLQQ ++ A    G V    + N+ +     +AEDAESAY+D
Sbjct  130  AWQVRAAAREAEATSLQAQLQQAVVAAHHHRGGVITTAEQNSGSEDGVDEAEDAESAYVD  189

Query  181  PDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            PDR  +  GP C+ C +R A+V+ LPCRHL LC  CD   + CPLCLS ++SSVEVF 
Sbjct  190  PDRCEMI-GPGCRICWRRSATVLALPCRHLVLCKGCDGSVRVCPLCLSTKNSSVEVFY  246



>ref|XP_006415155.1| hypothetical protein EUTSA_v10008231mg [Eutrema salsugineum]
 gb|ESQ33508.1| hypothetical protein EUTSA_v10008231mg [Eutrema salsugineum]
Length=319

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 124/180 (69%), Gaps = 9/180 (5%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRRTL EKR+ HY+AL+ A EE + RKLREKEAE+++A RR++EL AR  QL AEAQA
Sbjct  143  EELRRTLAEKRKMHYKALISAVEEPLVRKLREKEAEIQRATRRHNELEAREAQLKAEAQA  202

Query  346  wqararaqevtaatlqaqlqqVI-MNAGAVQEREDGNapacg-----aggdaedaesAYI  185
            WQARA AQE  AA+LQAQL Q + ++ G     +D  A               DAESAY+
Sbjct  203  WQARAMAQETAAASLQAQLHQAVNVHGGGGVSAQDSRAAEEELLCAGGVSGLGDAESAYV  262

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            DP+RV     P CK CRKR A+VV+LPCRHL +C  CD  A ACPLCL++R+SSVE  LC
Sbjct  263  DPERVTR---PRCKGCRKREATVVLLPCRHLSICPECDRSALACPLCLTLRNSSVEAILC  319



>ref|XP_010538488.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X2 [Tarenaya 
hassleriana]
Length=308

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 108/183 (59%), Gaps = 28/183 (15%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHA---------R  377
            G+QLR TL E R+RHYR LL AAEE VAR+LREKE E+EKA RR++EL A         R
Sbjct  144  GEQLRCTLAENRERHYRELLRAAEELVARRLREKETEMEKATRRHAELEARAAQLAADAR  203

Query  376  AQQLSaeaqawqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedae  197
              Q+ A  +  +A +   ++  AT   +        G   E ED               E
Sbjct  204  VWQVRAATREAEAASLQTQLQQATTAEREG----RGGGAAELED--------------TE  245

Query  196  sAYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            S Y+DP+RV ++ GP C+ CR R A+VV LPCRHLCLC  CD  A+ACPLCLS ++SSVE
Sbjct  246  SVYVDPNRVEMT-GPICRICRCRSAAVVALPCRHLCLCMECDGAARACPLCLSFKNSSVE  304

Query  16   VFL  8
            VF 
Sbjct  305  VFF  307



>ref|XP_010538489.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X3 [Tarenaya 
hassleriana]
Length=306

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 119/179 (66%), Gaps = 20/179 (11%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLR TL E R+RHYR LL AAEE VAR+LREKE E+EKA RR++EL ARA QL+A+A+
Sbjct  142  GEQLRCTLAENRERHYRELLRAAEELVARRLREKETEMEKATRRHAELEARAAQLAADAR  201

Query  349  awqararaqevtaatlqaqlqqVIM-----NAGAVQEREDGNapacgaggdaedaesAYI  185
             WQ RA  +E  AA+LQ QLQQ          G   E ED               ES Y+
Sbjct  202  VWQVRAATREAEAASLQTQLQQATTAEREGRGGGAAELED--------------TESVYV  247

Query  184  DPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            DP+RV ++ GP C+ CR R A+VV LPCRHLCLC  CD  A+ACPLCLS ++SSVEVF 
Sbjct  248  DPNRVEMT-GPICRICRCRSAAVVALPCRHLCLCMECDGAARACPLCLSFKNSSVEVFF  305



>ref|XP_010538486.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X1 [Tarenaya 
hassleriana]
Length=325

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 107/183 (58%), Gaps = 28/183 (15%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHA---------R  377
            G+QLR TL E R+RHYR LL AAEE VAR+LREKE E+EKA RR++EL A         R
Sbjct  161  GEQLRCTLAENRERHYRELLRAAEELVARRLREKETEMEKATRRHAELEARAAQLAADAR  220

Query  376  AQQLSaeaqawqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedae  197
              Q+ A  +  +A +   ++  AT   +        G   E ED  +             
Sbjct  221  VWQVRAATREAEAASLQTQLQQATTAEREG----RGGGAAELEDTESV------------  264

Query  196  sAYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
              Y+DP+RV ++ GP C+ CR R A+VV LPCRHLCLC  CD  A+ACPLCLS ++SSVE
Sbjct  265  --YVDPNRVEMT-GPICRICRCRSAAVVALPCRHLCLCMECDGAARACPLCLSFKNSSVE  321

Query  16   VFL  8
            VF 
Sbjct  322  VFF  324



>ref|XP_002865147.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41406.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E  + HYR LL   EESV R+LREKEAE+EKA RR++EL ARA Q+  EA+
Sbjct  128  GEQLRRMLAENNEWHYRELLRTTEESVRRRLREKEAEIEKATRRHAELEARAAQIETEAR  187

Query  349  awqararaqevtaatlqaqlqqVIM--NAGAVQEREDGNapacgaggdaedaesAYIDPD  176
            AWQ RA A+EV A +LQAQLQQ ++  + G +    +  + +     +AEDAESAY+DPD
Sbjct  188  AWQMRAAAREVEATSLQAQLQQAVVIAHGGGIITTAEPQSGSVDGVDEAEDAESAYVDPD  247

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            R  +   P C+ CR+R A+V+ LPCRHL LC  CD   + CPLCLS ++S VEVF 
Sbjct  248  RYEIIE-PRCRICRRRSATVLALPCRHLVLCKECDGSVRICPLCLSTKNSGVEVFY  302



>gb|KHN01654.1| Inhibitor of apoptosis protein [Glycine soja]
Length=292

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = -3

Query  190  YIDPDRVVLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            YIDP+RVV++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL++++S+VE
Sbjct  229  YIDPERVVVATTARPKCRGCAKRVASVVVLPCRHLCICTECDAHFRACPVCLTLKNSTVE  288

Query  16   VFL  8
            VFL
Sbjct  289  VFL  291



>ref|XP_009388302.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=307

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 5/174 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+RTL EKRQ+HY  LLGAAE+S AR+LREKEAEVE+ A R+SEL  R  +L  E+ 
Sbjct  138  GEQLQRTLAEKRQKHYGVLLGAAEKSAARRLREKEAEVEREALRSSELEDRLARLRTESM  197

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A A +VTAA+L AQLQ     A    +   GN   CG    AEDAESA ++P   
Sbjct  198  AWQAKAMADQVTAASLHAQLQHAAATAATAPQ---GNPGGCGDPPPAEDAESANVNPGHS  254

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
               P  +C+ CR+R ASVV++PCRHLCLC ACD  A++CP+C S+R+ S+ V L
Sbjct  255  --EPEHACRTCRRRPASVVLVPCRHLCLCDACDGTAESCPVCRSIRTGSIHVVL  306



>gb|KHN21049.1| Baculoviral IAP repeat-containing protein 2 [Glycine soja]
Length=293

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -3

Query  190  YIDPDRVVLSPG--PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            YIDP+RVV++    P C+ C KR+ASVVVLPCRHLC+C+ CDA  +ACP+CL+ ++S+VE
Sbjct  230  YIDPERVVVATTARPKCRGCAKRVASVVVLPCRHLCVCTECDAHFRACPVCLTPKNSTVE  289

Query  16   VFL  8
            VFL
Sbjct  290  VFL  292



>ref|XP_009388296.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=330

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 5/174 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QL+RTL EKRQ+HY  LLGAAE+S AR+LREKEAEVE+ A R+SEL  R  +L  E+ 
Sbjct  161  GEQLQRTLAEKRQKHYGVLLGAAEKSAARRLREKEAEVEREALRSSELEDRLARLRTESM  220

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A A +VTAA+L AQLQ     A    +   GN   CG    AEDAESA ++P   
Sbjct  221  AWQAKAMADQVTAASLHAQLQHAAATAATAPQ---GNPGGCGDPPPAEDAESANVNPGHS  277

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
               P  +C+ CR+R ASVV++PCRHLCLC ACD  A++CP+C S+R+ S+ V L
Sbjct  278  --EPEHACRTCRRRPASVVLVPCRHLCLCDACDGTAESCPVCRSIRTGSIHVVL  329



>ref|XP_009398480.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=327

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 114/175 (65%), Gaps = 9/175 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E+RQRHYRALL AAE+S AR+LREKEAEVE+ ARR +EL  R  +L  E+ 
Sbjct  160  GEQLRRALAERRQRHYRALLSAAEKSAARRLREKEAEVEREARRRAELEDRLGRLRTESM  219

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDR  173
            AWQA+A A + TAA L AQLQQ +          + G+ P       A      Y+DP+R
Sbjct  220  AWQAKAMADQTTAAALHAQLQQAVAARPPPAAGGECGDPPTAEDAESA------YVDPNR  273

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V      +C+ CR R ASVV+LPCRHLCLC AC+A A+ CP+C   R+ SV VFL
Sbjct  274  VEHEV--ACRTCRWRRASVVLLPCRHLCLCDACEAAAELCPVCACARAGSVGVFL  326



>ref|XP_002868046.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44305.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=312

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 116/175 (66%), Gaps = 2/175 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL E R+R Y  LL AAEE V RK+REKEAE+EKA R ++EL AR   L+ EA+
Sbjct  138  GEELRRTLAENRERRYVELLCAAEEIVGRKVREKEAELEKATRLHAELEARVAHLAEEAR  197

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQ RA  +E   ++LQA LQQ I +      ++       G   +AEDAES Y+DP+R+
Sbjct  198  NWQLRAATREAEVSSLQAHLQQAIASRRDTAAKQSTFGDDDGDAEEAEDAESVYVDPERI  257

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACD-AVAQACPLCLSVRSSSVEVFL  8
             L  GPSC+ CR+ +A+V+ LPCRHL LC  CD    +ACP+CL+V ++ VE+  
Sbjct  258  ELF-GPSCRICRQNLATVMALPCRHLALCEGCDGGTLRACPICLAVTNTGVEILY  311



>ref|NP_001078402.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
 gb|AEE83933.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
Length=242

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 2/175 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL + R+R Y  LL AAEE V RKLR+KEAE+EKA RR++EL AR   +  EA+
Sbjct  69   GEELRRTLADNRERRYVELLCAAEEIVGRKLRKKEAELEKATRRHAELEARVAHIVEEAR  128

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQ RA  +E   ++L A LQQ I N      ++       G   +AEDAES Y+DP+R+
Sbjct  129  NWQLRAATREAEVSSLHAHLQQAIANRLDTAAKQSTFGEDGGDAEEAEDAESVYVDPERI  188

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA-QACPLCLSVRSSSVEVFL  8
             L  GPSC+ CR++ A+V+ LPC+HL LC+ CD  A + CP+CL+V++S VEV  
Sbjct  189  ELI-GPSCRICRRKSATVMALPCQHLILCNGCDVGAVRVCPICLAVKTSGVEVLF  242



>emb|CAB10548.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78771.1| hypothetical protein [Arabidopsis thaliana]
Length=297

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 2/175 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL + R+R Y  LL AAEE V RKLR+KEAE+EKA RR++EL AR   +  EA+
Sbjct  124  GEELRRTLADNRERRYVELLCAAEEIVGRKLRKKEAELEKATRRHAELEARVAHIVEEAR  183

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQ RA  +E   ++L A LQQ I N      ++       G   +AEDAES Y+DP+R+
Sbjct  184  NWQLRAATREAEVSSLHAHLQQAIANRLDTAAKQSTFGEDGGDAEEAEDAESVYVDPERI  243

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA-QACPLCLSVRSSSVEVFL  8
             L  GPSC+ CR++ A+V+ LPC+HL LC+ CD  A + CP+CL+V++S VEV  
Sbjct  244  ELI-GPSCRICRRKSATVMALPCQHLILCNGCDVGAVRVCPICLAVKTSGVEVLF  297



>ref|NP_193503.2| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
 gb|AAM91645.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83932.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis 
thaliana]
Length=314

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 2/175 (1%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL + R+R Y  LL AAEE V RKLR+KEAE+EKA RR++EL AR   +  EA+
Sbjct  141  GEELRRTLADNRERRYVELLCAAEEIVGRKLRKKEAELEKATRRHAELEARVAHIVEEAR  200

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
             WQ RA  +E   ++L A LQQ I N      ++       G   +AEDAES Y+DP+R+
Sbjct  201  NWQLRAATREAEVSSLHAHLQQAIANRLDTAAKQSTFGEDGGDAEEAEDAESVYVDPERI  260

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA-QACPLCLSVRSSSVEVFL  8
             L  GPSC+ CR++ A+V+ LPC+HL LC+ CD  A + CP+CL+V++S VEV  
Sbjct  261  ELI-GPSCRICRRKSATVMALPCQHLILCNGCDVGAVRVCPICLAVKTSGVEVLF  314



>ref|XP_009389106.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389107.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389108.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389109.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=320

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 114/173 (66%), Gaps = 10/173 (6%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L E+RQRHYRALL AAEES AR+LREKEAEV + ARR  EL  R   L  E  A
Sbjct  157  EQLRRALAERRQRHYRALLNAAEESAARRLREKEAEVGRLARRRGELENRLALLRTETMA  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            WQA+A A +VTAA L AQ    +  A A  ER++      G    AEDAES + DPDRV 
Sbjct  217  WQAKAMADQVTAAALNAQ----LEKAAAAPERKE----ISGDSPPAEDAESGFEDPDRV-  267

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                 +C++C+ R ASVV+LPCRHLCLC ACDA + +CP+C  V + SV V L
Sbjct  268  -ERERACRSCQCRRASVVLLPCRHLCLCDACDAASDSCPVCRCVTTGSVRVLL  319



>ref|XP_006282676.1| hypothetical protein CARUB_v10005312mg [Capsella rubella]
 gb|EOA15574.1| hypothetical protein CARUB_v10005312mg [Capsella rubella]
Length=309

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 7/179 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRR L E R+R Y  LL A EE V RK+REKEAE+EKA RR++EL ARA  L+ EA+
Sbjct  134  GEELRRALAENRERRYAELLCATEELVGRKVREKEAELEKATRRHAELEARAAHLAEEAR  193

Query  349  awqararaqevtaatlqaqlqqVIMN---AGAVQEREDGNapacgaggdaedaesAYIDP  179
             WQ RA  +E   A+LQA LQQ I N     A+Q    G         +  ++   Y+DP
Sbjct  194  NWQLRAATREAEVASLQAHLQQAIANRRDTTAIQSTIGGGDGDAEETAEDAESV--YVDP  251

Query  178  DRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDA-VAQACPLCLSVRSSSVEVFLC  5
            +R V++ GPSC+ CR+  A+V+ LPCRHL LC+ CD    + CP+CL+V+ + V+V   
Sbjct  252  ERTVMN-GPSCRICRREYATVMALPCRHLALCNGCDGDEVRVCPICLAVKIAGVKVLFT  309



>ref|XP_010529998.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X4 [Tarenaya hassleriana]
Length=305

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            ++DPDR  +  GPSC+ CR+R A+VV LPCRHLCLC+ CD   + CPLCLS+++SSV+VF
Sbjct  245  HVDPDRFDVV-GPSCRNCRRRGATVVALPCRHLCLCTECDNGERVCPLCLSLKNSSVQVF  303

Query  10   L  8
             
Sbjct  304  F  304



>ref|XP_010529996.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Tarenaya hassleriana]
Length=306

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            ++DPDR  +  GPSC+ CR+R A+VV LPCRHLCLC+ CD   + CPLCLS+++SSV+VF
Sbjct  246  HVDPDRFDVV-GPSCRNCRRRGATVVALPCRHLCLCTECDNGERVCPLCLSLKNSSVQVF  304

Query  10   L  8
             
Sbjct  305  F  305



>ref|XP_010529997.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X3 [Tarenaya hassleriana]
Length=306

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            ++DPDR  +  GPSC+ CR+R A+VV LPCRHLCLC+ CD   + CPLCLS+++SSV+VF
Sbjct  246  HVDPDRFDVV-GPSCRNCRRRGATVVALPCRHLCLCTECDNGERVCPLCLSLKNSSVQVF  304

Query  10   L  8
             
Sbjct  305  F  305



>ref|XP_010529995.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Tarenaya hassleriana]
Length=307

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            ++DPDR  +  GPSC+ CR+R A+VV LPCRHLCLC+ CD   + CPLCLS+++SSV+VF
Sbjct  247  HVDPDRFDVV-GPSCRNCRRRGATVVALPCRHLCLCTECDNGERVCPLCLSLKNSSVQVF  305

Query  10   L  8
             
Sbjct  306  F  306



>ref|XP_010434630.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Camelina 
sativa]
Length=288

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL + R+R Y  LL   EE V RK+REKEA +E+A RR++EL ARA  L+  A+
Sbjct  113  GEELRRTLADNRERRYVELLCVTEELVGRKVREKEAVLERATRRHAELQARAAHLAEVAR  172

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesA-YIDPDR  173
             WQ R   +E   +TLQA LQQ I +   +  ++  N    G   +A +   + Y+DP+R
Sbjct  173  NWQLRVATREAEVSTLQAHLQQAIASRRDITAKQSTNGGGDGDAEEAAEDAESVYVDPER  232

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA-QACPLCLSVRSSSVEVFL  8
              +  GPSC+ CR+  A+V+ LPCRHL LC+ CD  A + CP+CL+V+ + VEV  
Sbjct  233  TEM-IGPSCRICRREYATVMALPCRHLVLCNGCDGGAVRVCPICLAVKIAGVEVLF  287



>ref|XP_010449576.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010449577.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Camelina sativa]
Length=287

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 3/176 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRRTL + R+R Y  LL   EE V RK+REKEAE+E+A RR++EL ARA  L+ EA+
Sbjct  112  GEELRRTLADNRERRYVELLCVTEELVGRKVREKEAELERATRRHAELQARAAHLAEEAR  171

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesA-YIDPDR  173
             WQ RA  +E   + LQA LQQVI +   +  ++  N        +A +   + Y+DP+R
Sbjct  172  NWQLRASTREAEVSALQAHLQQVIASRRDITAKQSTNGGGDDDAEEAAEDAESVYLDPER  231

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA-QACPLCLSVRSSSVEVFL  8
              +  GPSC+ CR+  A+V+ LPCRHL LC+ CD  A + CP+CL+V+ + VEV  
Sbjct  232  TEM-IGPSCRICRREYATVMALPCRHLVLCNGCDGGAVRVCPICLAVKIAGVEVLF  286



>ref|XP_010919824.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Elaeis 
guineensis]
Length=337

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL E+RQRHYRALLGAAEES AR+LREKEAEVE+AARR++EL  R  +L AE+ 
Sbjct  167  GEQLRRTLAERRQRHYRALLGAAEESAARRLREKEAEVERAARRSAELEDRLARLRAESM  226

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A A++ TAA+L AQLQQ    A A+ +   G A   G    AEDAESA++DPDRV
Sbjct  227  AWQAKAMAEQTTAASLHAQLQQAAAAAAALPQ---GKADELGGESPAEDAESAHVDPDRV  283

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCS-ACDAVAQACPLCLSVRSSSVEVFL  8
               P  +C+AC  R  SVV+ PCRHLCLCS    A   ACP+C   R+ SV+VFL
Sbjct  284  --DPVRACRACLCRPVSVVLFPCRHLCLCSACDAAAGDACPVCRCPRTGSVQVFL  336



>ref|XP_009114864.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Brassica rapa]
Length=170

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            Y+DP+R+     P CK CR R A+VV+LPCRHL +C  CD  A ACPLCL++R+SSVE  
Sbjct  99   YVDPERM---RQPRCKGCRTREATVVMLPCRHLSICPECDRTALACPLCLTLRNSSVEAI  155

Query  10   LC  5
            LC
Sbjct  156  LC  157



>ref|XP_008788744.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Phoenix dactylifera]
Length=299

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+ LRRTL EKRQRH RALL AA+E+ AR+LREKEAEVE+A RR +EL  R  +L AE+ 
Sbjct  135  GEHLRRTLAEKRQRHCRALLCAADEAAARRLREKEAEVEQAVRRAAELEERLARLKAESL  194

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A A + TA  L AQLQQ    A   +E E            AEDAESA++DPDR 
Sbjct  195  AWQAKAMADQATALALHAQLQQAQAAAAEEREGE-------CRDSPAEDAESAHVDPDR-  246

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              +P  +C++CR  +ASVVVLPCRHLCLC+ C   A  CP+C    + S+ VF 
Sbjct  247  --APPAACRSCRSALASVVVLPCRHLCLCTDCSDAAPPCPVCRCATTGSLPVFF  298



>ref|XP_008794860.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Phoenix 
dactylifera]
Length=338

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E+RQRHYRALLGAAE+S  R+LREKEAEVE+AARR++EL  R  +L AE+ 
Sbjct  167  GEQLRRALAERRQRHYRALLGAAEKSATRRLREKEAEVERAARRSAELEDRLARLRAESM  226

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A A++ TAA+L AQLQQ    A A   +  G A  CG    AEDAESA++DPDRV
Sbjct  227  AWQAKAMAEQATAASLHAQLQQAAAAAAAALPQ--GKADECGGESPAEDAESAHVDPDRV  284

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCS-ACDAVAQACPLCLSVRSSSVEVFL  8
               P  +C+AC  R  SVV+ PCRHLCLCS    A   ACP+C  +R+ SV+VFL
Sbjct  285  --EPERACRACLCRPVSVVLFPCRHLCLCSACDAAAGDACPVCRCLRTGSVQVFL  337



>ref|XP_009385939.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385940.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385941.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385942.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385943.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=307

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QLRR L E+R RHYR LL AA ES AR+LRE+EAE E+AARR++EL  R  +L  E+ A
Sbjct  142  EQLRRGLAERRWRHYRYLLSAANESAARRLREEEAEAERAARRSAELEGRLARLRIESMA  201

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W+A+A A + TA +LQ QLQ+ +  A   +  E            AEDAESA+++P RV 
Sbjct  202  WKAKATADQATATSLQVQLQKAVATAAQARGCE---------ASPAEDAESAFMEPHRV-  251

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA---QACPLCLSVRSSSVEVFL  8
               G +C+ACR+R+ASVV+LPCRHLCLC  CD      ++CP+C   ++ SV V+L
Sbjct  252  -EQGRACRACRERLASVVLLPCRHLCLCDVCDGGGGPVESCPVCRCGKAGSVRVYL  306



>ref|XP_006854019.1| hypothetical protein AMTR_s00048p00028800 [Amborella trichopoda]
 gb|ERN15486.1| hypothetical protein AMTR_s00048p00028800 [Amborella trichopoda]
Length=336

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 115/180 (64%), Gaps = 13/180 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++LRR L EKR++H  ALLGA EE VAR++REKEAE+++A RR++EL  +A QL  E +
Sbjct  163  GEELRRALAEKRRKHCVALLGAIEEGVARRVREKEAEMQEATRRHAELEEQATQLRIETE  222

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacg-aggdaedaesAYIDPDR  173
             WQ++ARAQE   ATLQ +L Q    A A   R  G+    G    +  DAESA++DP  
Sbjct  223  RWQSKARAQEAVVATLQMRLHQA--QALAQDHRGGGHVAFEGCGDSEVGDAESAFVDP--  278

Query  172  VVLSPGPS-----CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                 GPS     C+ C +  A VV+LPCRHLCLC+ C A   ACPLC   RS S+EVF+
Sbjct  279  ---RGGPSSGVGLCRGCGRGEARVVLLPCRHLCLCTGCGAAVVACPLCNVPRSHSLEVFM  335



>gb|KHN42644.1| hypothetical protein glysoja_018887 [Glycine soja]
Length=284

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  145  KACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            + C KR+ASVVVLPCRHLC+C+ CD   +ACP+CL+V++S+VEV+L
Sbjct  238  RGCAKRVASVVVLPCRHLCICAECDTHFRACPVCLTVKNSTVEVYL  283


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLS  362
            +QLRR L EKRQRHYR LL AAEESV R+LREKEAEVEKA R N+EL ARA QLS
Sbjct  155  EQLRRALAEKRQRHYRTLLRAAEESVLRRLREKEAEVEKATRHNAELEARAAQLS  209



>ref|NP_001052694.1| Os04g0402500 [Oryza sativa Japonica Group]
 emb|CAD40789.1| OSJNBb0012E08.13 [Oryza sativa Japonica Group]
 emb|CAE02021.2| OSJNBb0118P14.2 [Oryza sativa Japonica Group]
 dbj|BAF14608.1| Os04g0402500 [Oryza sativa Japonica Group]
Length=316

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V +S   SCKACR   ASV++LPCRHLCLC AC+A A ACP+C + +++SV V L
Sbjct  261  VAVSTATSCKACRVAEASVLLLPCRHLCLCGACEAAADACPVCAATKNASVHVLL  315



>ref|XP_010100437.1| Baculoviral IAP repeat-containing protein 3 [Morus notabilis]
 gb|EXB82571.1| Baculoviral IAP repeat-containing protein 3 [Morus notabilis]
Length=354

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 109/189 (58%), Gaps = 24/189 (13%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + + + +QRH  A L A E+ V++KLREK+ E+E   R+N EL  R +Q++ EAQ+
Sbjct  173  EHMAKGVRDMKQRHISAFLAAIEKGVSKKLREKDVEIENMNRKNKELVERIKQVAMEAQS  232

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G    D  ++Y+DP+ ++
Sbjct  233  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYVDPNNLL  284

Query  166  LSPGP----------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSV  35
              PG                 +C+ACR +  S++++PCRHLCLC  CD     CP+C S+
Sbjct  285  SVPGGALKSTSKNYQGLKEHMTCRACRSKEVSMLLMPCRHLCLCKDCDGFIGVCPVCQSM  344

Query  34   RSSSVEVFL  8
            +++SV+V+L
Sbjct  345  KTASVQVYL  353



>emb|CDX90458.1| BnaA03g43230D [Brassica napus]
Length=304

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 108/177 (61%), Gaps = 9/177 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+R L    +  Y  LL AAEE   R++REKEAE+EKA RR++EL ARA QL+ EA+
Sbjct  133  GEELQRKLALYGESRYVELLYAAEELAGRRVREKEAELEKATRRHAELEARAAQLTEEAR  192

Query  349  awqararaqevtaatlqaqlqqVIMN-AGAVQEREDGNapacgaggdaedaesAYIDPDR  173
             WQ RA  +E   ++L A +Q+VI + A A ++R  G         ++      ++DP+R
Sbjct  193  TWQLRAATREAEVSSLHAHIQKVIASQATAEKQRTIGGETEEAEDAESV-----FVDPER  247

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA--QACPLCLSVRSSSVEVFL  8
            + L  GP C  CR+  A+V+ LPCRHL LC  CD     + CP+CL+V++  VEV  
Sbjct  248  IEL-IGPCCSICRRNSATVMALPCRHLVLCKGCDGGGDVRVCPICLAVKNFGVEVLF  303



>ref|XP_009136861.1| PREDICTED: E3 ubiquitin-protein ligase BOI [Brassica rapa]
Length=309

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 12/177 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+R L    +  Y  LL AAEE   R++REKEAE+EKA RR++EL ARA QL+ EA+
Sbjct  141  GEELQRKLALYGESRYVELLYAAEELAGRRVREKEAELEKATRRHAELEARAAQLTEEAR  200

Query  349  awqararaqevtaatlqaqlqqVIMN-AGAVQEREDGNapacgaggdaedaesAYIDPDR  173
             WQ RA  +E   ++L A +Q+VI + A A ++R  G                 ++DP+R
Sbjct  201  TWQLRAATREAEVSSLHAHIQKVIASQATAEKQRTIGGETEDAESV--------FVDPER  252

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA--QACPLCLSVRSSSVEVFL  8
            + L  GP C  CR+  A+V+ LPCRHL LC  CD     + CP+CL+V++  VEV  
Sbjct  253  IEL-IGPCCSICRRNSATVMALPCRHLVLCKGCDGGGDVRVCPICLAVKNFGVEVLF  308



>gb|EAY93975.1| hypothetical protein OsI_15752 [Oryza sativa Indica Group]
Length=332

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            V +S   SCKACR   ASV++LPCRHLCLC AC+A A ACP+C + +++SV V L
Sbjct  277  VAVSTATSCKACRVAEASVLLLPCRHLCLCGACEAAADACPVCAATKNASVHVLL  331



>ref|XP_007157438.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
 ref|XP_007157439.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
 ref|XP_007157440.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
 gb|ESW29432.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
 gb|ESW29433.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
 gb|ESW29434.1| hypothetical protein PHAVU_002G070200g [Phaseolus vulgaris]
Length=337

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 108/188 (57%), Gaps = 23/188 (12%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QL + + + +Q+H  ALL + E+ ++ KL+EK+ E+E   R+N EL  R +Q++ EAQ+
Sbjct  157  EQLSKGVRDMKQKHMTALLSSIEKGISAKLKEKDVEIENMNRKNRELAERIKQVAIEAQS  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L+  LQQ I  +  V++ ++G       G    D +++YIDP+  +
Sbjct  217  WHYRAKYNESVVNALRNNLQQAI--SQGVEQGKEG------FGDSEVDDDASYIDPNNFL  268

Query  166  LSPGP---------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
              PG                +CKAC+ +  S++++PCRHLCLC  C+     CP+C  ++
Sbjct  269  NLPGAPINSTHKTYQNAENLTCKACKAKAVSMLLMPCRHLCLCKDCEGFINVCPVCQLIK  328

Query  31   SSSVEVFL  8
            ++SVEV+L
Sbjct  329  TASVEVYL  336



>ref|XP_009413247.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413248.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=288

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 4/61 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCL--CSACDAVAQACPLCLSVRSSSVE  17
            Y+DPDRV   P  SC+ACR+R ASVV+LPCRHLCL         A++CP+C SVR+ S++
Sbjct  227  YVDPDRV--EPERSCRACRRRTASVVLLPCRHLCLCDACDAATAAESCPVCRSVRTGSIQ  284

Query  16   V  14
            V
Sbjct  285  V  285



>ref|XP_009413245.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=339

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 4/61 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCL--CSACDAVAQACPLCLSVRSSSVE  17
            Y+DPDRV   P  SC+ACR+R ASVV+LPCRHLCL         A++CP+C SVR+ S++
Sbjct  278  YVDPDRV--EPERSCRACRRRTASVVLLPCRHLCLCDACDAATAAESCPVCRSVRTGSIQ  335

Query  16   V  14
            V
Sbjct  336  V  336



>ref|XP_009413246.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=338

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 4/61 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCL--CSACDAVAQACPLCLSVRSSSVE  17
            Y+DPDRV   P  SC+ACR+R ASVV+LPCRHLCL         A++CP+C SVR+ S++
Sbjct  277  YVDPDRV--EPERSCRACRRRTASVVLLPCRHLCLCDACDAATAAESCPVCRSVRTGSIQ  334

Query  16   V  14
            V
Sbjct  335  V  335



>emb|CDY09609.1| BnaC07g34520D [Brassica napus]
Length=247

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 27/186 (15%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+  L    +R Y  LL AAEE   R++REKEAE+EKA RR++EL ARA QL+ EA+
Sbjct  76   GEELQSKLALYGERRYVELLYAAEELAGRRVREKEAELEKATRRHAELEARAAQLTEEAR  135

Query  349  awqararaqevtaatlqaqlqqVIMN----------AGAVQEREDGNapacgaggdaeda  200
             WQ RA  +E   ++LQA +Q+VI +           G  +E ED  +            
Sbjct  136  TWQLRAATREAEVSSLQAHIQKVIASQATAEKQSAIGGETEEAEDAESV-----------  184

Query  199  esAYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA--QACPLCLSVRSS  26
               ++DP+R+ L  GP C  CR+   +V+ LPCRHL LC  CD     + CP+CL+V++ 
Sbjct  185  ---FVDPERIEL-IGPCCSICRRNSTTVMALPCRHLVLCKGCDGGGDVRVCPICLAVKNF  240

Query  25   SVEVFL  8
             VEV  
Sbjct  241  GVEVLF  246



>ref|XP_010242600.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nelumbo 
nucifera]
 ref|XP_010242601.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nelumbo 
nucifera]
 ref|XP_010242602.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nelumbo 
nucifera]
Length=336

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 104/186 (56%), Gaps = 21/186 (11%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + + E +QRH  + L A E+ V RKLR+KE E+E   R N EL  R +Q++ EAQ+
Sbjct  158  EHIAKGVREMKQRHMVSFLNAIEKGVGRKLRKKELEIENMNRMNKELVERIKQVTMEAQS  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDRV  170
            W  +A+  E     L++ L+Q I   GA Q +E  G++    A          YID + +
Sbjct  218  WHYQAKYNESVVNVLKSNLKQTIA-QGADQGKEGCGDSEVDDAASS-------YIDQNNL  269

Query  169  VLSPGPS------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSS  26
            +  PG S            CKAC+ +  S+++LPCRHLCLC  C+     CP+C S++++
Sbjct  270  LSFPGGSGTNHQGLREQMTCKACKNKEVSMLLLPCRHLCLCVYCEGFIDVCPVCQSIKTA  329

Query  25   SVEVFL  8
            SV+V++
Sbjct  330  SVQVYM  335



>ref|XP_002314611.1| hypothetical protein POPTR_0010s05200g [Populus trichocarpa]
 ref|XP_006378223.1| hypothetical protein POPTR_0010s05200g [Populus trichocarpa]
 gb|EEF00782.1| hypothetical protein POPTR_0010s05200g [Populus trichocarpa]
 gb|ERP56020.1| hypothetical protein POPTR_0010s05200g [Populus trichocarpa]
Length=339

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 110/189 (58%), Gaps = 24/189 (13%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH+ +LL A E+ V++KL+EK+ E+E   R+N EL  R +Q++AEAQ 
Sbjct  158  EHLAKGVRDLKQRHFSSLLAAMEKGVSKKLQEKDREIENINRKNKELIERIRQVAAEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G +  D  ++YI+P+  +
Sbjct  218  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDNEIDDAASYIEPNNYL  269

Query  166  LSPGP----------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSV  35
               G                 +C+AC+ R  S++++PCRHLCLC  CDA+   CP+C  +
Sbjct  270  NFSGDPAKPLPWNYQGLKEHVTCRACKTREVSMLLMPCRHLCLCKECDALINVCPVCRLI  329

Query  34   RSSSVEVFL  8
            +++S +VFL
Sbjct  330  KTNSFQVFL  338



>ref|XP_002455243.1| hypothetical protein SORBIDRAFT_03g006990 [Sorghum bicolor]
 gb|EES00363.1| hypothetical protein SORBIDRAFT_03g006990 [Sorghum bicolor]
Length=171

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 43/72 (60%), Gaps = 10/72 (14%)
 Frame = -3

Query  190  YIDPDRVVLSPGP----SCKACRKRIASVVVLPCRHLCLCSAC------DAVAQACPLCL  41
            Y+DP R    PG     +C  CR + AS+V+LPCRHL LC  C      DA A ACP+CL
Sbjct  100  YMDPCRRTTGPGTLSDCACLGCRLKPASIVLLPCRHLSLCGECFATGDADAAAMACPVCL  159

Query  40   SVRSSSVEVFLC  5
             VR+ SVE  LC
Sbjct  160  CVRTGSVEAILC  171



>ref|XP_010547760.1| PREDICTED: LOW QUALITY PROTEIN: probable BOI-related E3 ubiquitin-protein 
ligase 2 [Tarenaya hassleriana]
Length=356

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 105/194 (54%), Gaps = 27/194 (14%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            DQ+ + + + +QRH  + L A E+ V++K++EK+ E+E   ++N EL  R +Q++ EAQ 
Sbjct  168  DQMAKGVRDMKQRHMASFLSALEKGVSKKIQEKDLEIESMNKKNRELVERIKQIAMEAQN  227

Query  346  wqararaqevtaatlqaqlqqVI---MNAGAVQEREDGNapacgaggdaedaesAYIDPD  176
            W  RA+  E     L+  LQQ +    NAGA  + ++G       G    D+ ++YIDP+
Sbjct  228  WHYRAKYNESVVNVLKTNLQQAMSQGXNAGAGDQGKEG------FGDSEIDSAASYIDPN  281

Query  175  R---VVLSPGPS---------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACP  50
                +V  PG                 CK C  +  SV+++PCRHL LC  CD     CP
Sbjct  282  NYLGIVGIPGRGFPQKGRGRNPEGAMRCKGCNAKEVSVLLVPCRHLSLCKDCDGFIGVCP  341

Query  49   LCLSVRSSSVEVFL  8
            +C S+++SSV+VF 
Sbjct  342  VCQSLKTSSVQVFF  355



>ref|XP_010475941.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Camelina sativa]
Length=333

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + G     CK C  +  SV+++PCRHL LC+ CD V + CP+C S+++SSV
Sbjct  269  YIDPNNKKNNMGSQRMRCKMCSAKEVSVLLVPCRHLSLCTECDVVTKICPVCKSLKTSSV  328

Query  19   EVFL  8
            +VF 
Sbjct  329  QVFF  332



>gb|ABD65150.1| hypothetical protein 40.t00029 [Brassica oleracea]
Length=311

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 27/186 (15%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G++L+  L    +R Y  LL AAEE   R++REKEAE+EKA RR++EL ARA QL+ EA+
Sbjct  140  GEELQSKLALYGERRYVELLYAAEELAGRRVREKEAELEKATRRHAELEARAAQLTEEAR  199

Query  349  awqararaqevtaatlqaqlqqVIMN----------AGAVQEREDGNapacgaggdaeda  200
             WQ RA  +E   ++LQA +Q+VI +           G  +E ED  +            
Sbjct  200  TWQLRAATREAEVSSLQAHIQKVIASQATAEKQSAIGGETEEAEDAESV-----------  248

Query  199  esAYIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVA--QACPLCLSVRSS  26
               ++DP+R+ L  GP C  CR+   +V+ LPCRHL LC  CD     + CP+CL+V++ 
Sbjct  249  ---FVDPERIEL-IGPCCSICRRNSTTVMALPCRHLVLCKGCDGGGDVRVCPICLAVKNF  304

Query  25   SVEVFL  8
             VEV  
Sbjct  305  GVEVLF  310



>ref|XP_010037555.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Eucalyptus grandis]
Length=359

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 100/177 (56%), Gaps = 4/177 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + + + RQRH  A L A E+ V +KL EK+ E+E   R+N EL  R +Q++AE Q+
Sbjct  184  ENITKGVRDLRQRHTTAFLSAVEKGVGKKLHEKDLELENMNRKNKELEERVKQVTAEVQS  243

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDRV  170
            W  RA+  E     L++ LQQ +M  G +Q +E  G++    A         +++D    
Sbjct  244  WHYRAKYNESVVNVLKSNLQQ-VMAQGTMQGKEGCGDSEVDDAASYTNQNHLSFVDGFGT  302

Query  169  --VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
              V     +CK+C+ +  S+++LPC+HLCLC  C A    CPLC  +R+  V+V++C
Sbjct  303  SGVTRNRMTCKSCKIKEVSILLLPCKHLCLCKDCAAFIDVCPLCNMIRTDLVQVYMC  359



>ref|XP_008786211.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Phoenix 
dactylifera]
Length=337

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR L E+RQRHYRALLGA EES AR+LREKEAEVE+AARR +EL  R   L+    
Sbjct  166  GEQLRRALAERRQRHYRALLGAVEESAARRLREKEAEVERAARRRAELEDR---LARLRT  222

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
               A         A   +   Q+   A A      G A  CG    AEDA+SA++DPDRV
Sbjct  223  ESMAWQAKAMAEQAAAASLHAQLQQAAAAAAALPHGKAEECGGELPAEDAQSAHVDPDRV  282

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLC--LCSACDAVAQACPLCLSVRSSSVEVFL  8
               P  +C+ACR R  SVV+LPCRHLC     A  A + ACP+C  +R+ SV+VF 
Sbjct  283  --DPERACRACRYRPVSVVLLPCRHLCLCSACAAAAASDACPVCRCLRTGSVQVFF  336



>ref|XP_009390342.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390413.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=289

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSAC---DAVAQACPLCLSVRSSSV  20
            Y+DP RV +    +C+ACR R+ASVV+LPCRHLCLC AC   ++ A++CP+C  V +  +
Sbjct  227  YVDPGRVEMKR--ACRACRARLASVVLLPCRHLCLCDACHGGESPAESCPVCGCVTTGRI  284

Query  19   EVFL  8
             V L
Sbjct  285  RVLL  288



>ref|NP_001146990.1| S-ribonuclease binding protein SBP1 [Zea mays]
 gb|ACG24931.1| S-ribonuclease binding protein SBP1 [Zea mays]
Length=322

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 108/181 (60%), Gaps = 12/181 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR + ++ +RH RA+L  A++S AR+LREK AE E+ ARR +EL  R  +L  EA 
Sbjct  148  GEQLRRAVADRLRRHNRAILVKADQSAARRLREKAAEAEREARRGAELEERLARLRGEAA  207

Query  349  awqararaqevtaatlqaqlqqVIMNAGA-VQEREDGNapacgaggdaedaesAYIDPDR  173
            AWQA+A +++  A  L AQLQQ      A V+E   G+A    +   A      ++DP R
Sbjct  208  AWQAKALSEQAAAVALHAQLQQAAAAVRASVEELAAGDAGPAESSASA------FVDPRR  261

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQA-----CPLCLSVRSSSVEVFL  8
                P  +C ACR R ASVV+LPCRHL LC  C A   A     CP+CL VR+ SVE  L
Sbjct  262  AGPPPDHACLACRLRPASVVLLPCRHLSLCGECFAAGDADAAMPCPVCLCVRTGSVEAIL  321

Query  7    C  5
            C
Sbjct  322  C  322



>ref|XP_003517702.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoformX2 [Glycine 
max]
 ref|XP_006573033.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X3 [Glycine 
max]
 ref|XP_006573034.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X4 [Glycine 
max]
 ref|XP_006573035.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X5 [Glycine 
max]
Length=337

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 107/188 (57%), Gaps = 23/188 (12%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QL + + + +Q+H  ALL + E+ +  KL+EK+ E+E   R+N EL  R +Q++ EAQ+
Sbjct  157  EQLSKGVRDMKQKHVAALLTSIEKGINTKLKEKDVEIENMNRKNRELAERIKQVAVEAQS  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E    TL+  LQQ I + GA Q +E       G G    D +++YIDP+  +
Sbjct  217  WHYRAKYNESVVNTLRNNLQQAI-SQGAEQGKE-------GFGESEVDDDASYIDPNNFL  268

Query  166  LSPGP---------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
              P                 +C+AC+ +  S++++PCRHLCLC  C+     CP+C  ++
Sbjct  269  NIPAAPINSTHKSYQDMENLTCRACKTKTVSMLLMPCRHLCLCKDCEGFINVCPVCQLIK  328

Query  31   SSSVEVFL  8
            ++SVEV+L
Sbjct  329  TASVEVYL  336



>ref|XP_002511385.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51987.1| ATP binding protein, putative [Ricinus communis]
Length=301

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 100/173 (58%), Gaps = 2/173 (1%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            D +R+ + E  +R   + L A E  + +KL EKE E++   RRN+EL  R +Q+S E Q+
Sbjct  128  DNMRKGMRELGERQTISFLSAIETGIGKKLHEKEVEIQNMNRRNNELVERIKQISTEVQS  187

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDRV  170
            WQ RA+  E     L++ L+Q ++  G +Q +E  G++    A   A +   + ++ + V
Sbjct  188  WQCRAKYNESVVNALKSNLKQ-VLAQGVIQRKEGCGDSEVDSAASYAYENHWSILEANSV  246

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
                   C+AC+ + AS+++LPCRHLCLC  C     ACP+C  ++++ VEVF
Sbjct  247  TFKRQMVCRACKTKEASILLLPCRHLCLCKDCAGSVDACPICQILKTAGVEVF  299



>gb|KHN14568.1| Baculoviral IAP repeat-containing protein 3 [Glycine soja]
Length=337

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 107/188 (57%), Gaps = 23/188 (12%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QL + + + +Q+H  ALL + E+ +  KL+EK+ E+E   R+N EL  R +Q++ EAQ+
Sbjct  157  EQLSKGVRDMKQKHVAALLTSIEKGINTKLKEKDVEIENMNRKNRELAERIKQVAVEAQS  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E    TL+  LQQ I + GA Q +E       G G    D +++YIDP+  +
Sbjct  217  WHYRAKYNESVVNTLRNNLQQAI-SQGAEQGKE-------GFGESEVDDDASYIDPNNFL  268

Query  166  LSPGP---------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
              P                 +C+AC+ +  S++++PCRHLCLC  C+     CP+C  ++
Sbjct  269  NIPAAPINSTHKSYQDMENLTCRACKTKTVSMLLMPCRHLCLCKDCEGFINVCPVCQLIK  328

Query  31   SSSVEVFL  8
            ++SVEV+L
Sbjct  329  TASVEVYL  336



>gb|KCW49269.1| hypothetical protein EUGRSUZ_K02834 [Eucalyptus grandis]
Length=333

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 100/177 (56%), Gaps = 4/177 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + + + RQRH  A L A E+ V +KL EK+ E+E   R+N EL  R +Q++AE Q+
Sbjct  158  ENITKGVRDLRQRHTTAFLSAVEKGVGKKLHEKDLELENMNRKNKELEERVKQVTAEVQS  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDRV  170
            W  RA+  E     L++ LQQ +M  G +Q +E  G++    A         +++D    
Sbjct  218  WHYRAKYNESVVNVLKSNLQQ-VMAQGTMQGKEGCGDSEVDDAASYTNQNHLSFVDGFGT  276

Query  169  --VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
              V     +CK+C+ +  S+++LPC+HLCLC  C A    CPLC  +R+  V+V++C
Sbjct  277  SGVTRNRMTCKSCKIKEVSILLLPCKHLCLCKDCAAFIDVCPLCNMIRTDLVQVYMC  333



>ref|XP_002892588.1| hypothetical protein ARALYDRAFT_471187 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68847.1| hypothetical protein ARALYDRAFT_471187 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = -3

Query  190  YIDPD--RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            YIDP+  ++ +     CK C  +  SV+++PCRHL LC  CD   + CP+C S++SSSV+
Sbjct  216  YIDPNNNKMGIHQRMRCKMCNGKEVSVLLVPCRHLSLCKECDVFTKICPVCKSLKSSSVQ  275

Query  16   VFL  8
            VF 
Sbjct  276  VFF  278



>ref|XP_010458424.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Camelina 
sativa]
Length=333

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP++   + G     CK C  +  SV+++PCRHL LC+ CD   + CP+C S+++SSV
Sbjct  269  YIDPNKKNNNMGSQRMRCKMCSAKEVSVLLVPCRHLSLCTECDVFTKICPVCKSLKTSSV  328

Query  19   EVFL  8
            +VF 
Sbjct  329  QVFF  332



>ref|XP_010935032.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Elaeis guineensis]
Length=323

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            ++DPDR   +P  +C++CR  +ASVVVLPCRHLCLC+ C   A +CP+C    + S+ VF
Sbjct  265  HVDPDR---APPATCRSCRVALASVVVLPCRHLCLCADCSDAAPSCPVCGCATTGSLHVF  321

Query  10   L  8
            L
Sbjct  322  L  322



>ref|XP_006653358.1| PREDICTED: uncharacterized protein LOC102701815 [Oryza brachyantha]
Length=275

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            SCKACR   A V++LPCRHLCLC ACDA   ACP+C + +++SV V L
Sbjct  227  SCKACRGAEACVLLLPCRHLCLCGACDAATDACPVCAATKNASVHVLL  274



>ref|XP_010651528.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Vitis vinifera]
Length=353

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 15/76 (20%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---------------CKACRKRIASVVVLPCRHLCLCSACDAVAQA  56
            YIDP  +V+  GP                C+AC+ +  S++++PCRHLC+C  C+ +   
Sbjct  277  YIDPHNMVIPGGPGRANSQNKEGLKEQMICRACKSKEVSILLIPCRHLCICKECEGLISV  336

Query  55   CPLCLSVRSSSVEVFL  8
            CP+C S++++ V+V+L
Sbjct  337  CPVCQSMKTTGVQVYL  352



>gb|AFW72845.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=331

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQA-----CPLCLSVRSS  26
            ++DP R    P  +C ACR R ASVV+LPCRHL LC  C A   A     CP+CL VR+ 
Sbjct  265  FVDPRRAGPPPDHACLACRLRPASVVLLPCRHLSLCGECFAAGDADAAMPCPVCLCVRTG  324

Query  25   SVEVFLC  5
            SVE  LC
Sbjct  325  SVEAILC  331



>ref|XP_010248512.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Nelumbo nucifera]
 ref|XP_010248513.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Nelumbo nucifera]
Length=336

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 12/73 (16%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPL  47
            YID + ++  PG S            CKAC+ +  S+++LPCRHLCLC  C+     CP+
Sbjct  263  YIDQNNLLSFPGGSGTSHQGLREQMTCKACKNKEVSMLLLPCRHLCLCVYCEEFIDVCPI  322

Query  46   CLSVRSSSVEVFL  8
            C S++++SV+V++
Sbjct  323  CQSIKTASVQVYM  335



>ref|XP_008643570.1| PREDICTED: S-ribonuclease binding protein SBP1 isoform X1 [Zea 
mays]
 gb|AFW72846.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=355

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQA-----CPLCLSVRSS  26
            ++DP R    P  +C ACR R ASVV+LPCRHL LC  C A   A     CP+CL VR+ 
Sbjct  289  FVDPRRAGPPPDHACLACRLRPASVVLLPCRHLSLCGECFAAGDADAAMPCPVCLCVRTG  348

Query  25   SVEVFLC  5
            SVE  LC
Sbjct  349  SVEAILC  355



>ref|XP_010920103.1| PREDICTED: E3 ubiquitin-protein ligase BOI [Elaeis guineensis]
Length=270

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            CK+C  R + V++LPCRHLC C  CDAV  +CP C SV+  S+EVFL
Sbjct  223  CKSCGSRYSRVLLLPCRHLCACELCDAVLDSCPFCGSVKEGSIEVFL  269



>ref|XP_010475940.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Camelina sativa]
Length=333

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + G     CK C  +  SV+++PCRHL LC+ CD   + CP+C S+++SSV
Sbjct  269  YIDPNNKKNNMGSQRMRCKMCSAKEVSVLLVPCRHLSLCTECDVFTKICPVCKSLKTSSV  328

Query  19   EVFL  8
            +VF 
Sbjct  329  QVFF  332



>ref|XP_007222413.1| hypothetical protein PRUPE_ppa008184mg [Prunus persica]
 gb|EMJ23612.1| hypothetical protein PRUPE_ppa008184mg [Prunus persica]
Length=342

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 107/192 (56%), Gaps = 27/192 (14%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH  + L A E+ V++K+REK+ E+E   R+N EL  R +Q++ EAQ 
Sbjct  158  EHLAKGVRDMKQRHMASFLAAIEKGVSKKIREKDLEIENMNRKNRELVDRIKQVAVEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YIDP+  +
Sbjct  218  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYIDPNNYL  269

Query  166  LSP-GP------------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLC  44
              P GP                  +CKAC+ +  S++++PCRHLCLC  CD     CP+C
Sbjct  270  SVPVGPVKSVSKNYLGLKEQMASRACKACKAKEVSILLMPCRHLCLCKDCDGFVSVCPVC  329

Query  43   LSVRSSSVEVFL  8
             S++++S +V+L
Sbjct  330  ESMKTASFQVYL  341



>ref|XP_004953488.1| PREDICTED: RING finger protein B-like isoform X1 [Setaria italica]
Length=374

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 91/181 (50%), Gaps = 14/181 (8%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQL-Saea  353
            G+QLRR + ++ +RH RA+L  A++S AR+LREK AE E+ ARR +EL  R  +L    A
Sbjct  202  GEQLRRAMADRLRRHNRAILVKADQSAARRLREKAAEAEREARRGAELEERLARLRGEAA  261

Query  352  qawqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDR  173
                     Q           Q   +   +V+E  D       +          Y+DP R
Sbjct  262  AWQAKALSEQAAAVTLHAQLQQAAAVARASVEELGDAGPAESSSSA--------YVDPRR  313

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSAC-----DAVAQACPLCLSVRSSSVEVFL  8
               SP  +C  CR R ASVV+LPCRHL LC  C        A ACP+CL VR+ SVE  L
Sbjct  314  TGPSPDRACLGCRLRPASVVLLPCRHLSLCGECFAASDADAAMACPVCLCVRTGSVEAIL  373

Query  7    C  5
            C
Sbjct  374  C  374



>ref|XP_008221847.1| PREDICTED: E3 ubiquitin-protein ligase BOI [Prunus mume]
Length=342

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 107/192 (56%), Gaps = 27/192 (14%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH  + L A E+ V++K+REK+ E+E   R+N EL  R +Q++ EAQ 
Sbjct  158  EHLAKGVRDMKQRHMASFLAAIEKGVSKKIREKDLEIENMNRKNRELVDRIKQVAVEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YIDP+  +
Sbjct  218  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYIDPNNYL  269

Query  166  LSP-GP------------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLC  44
              P GP                  +CKAC+ +  S++++PCRHLCLC  CD     CP+C
Sbjct  270  GVPVGPVKSVSNNYLGLKEQMASRACKACKAKEVSILLMPCRHLCLCKDCDGFVSVCPVC  329

Query  43   LSVRSSSVEVFL  8
             S++++S +V+L
Sbjct  330  ESMKTASFQVYL  341



>ref|XP_004953489.1| PREDICTED: RING finger protein B-like isoform X2 [Setaria italica]
Length=345

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSAC-----DAVAQACPLCLSVRSS  26
            Y+DP R   SP  +C  CR R ASVV+LPCRHL LC  C        A ACP+CL VR+ 
Sbjct  279  YVDPRRTGPSPDRACLGCRLRPASVVLLPCRHLSLCGECFAASDADAAMACPVCLCVRTG  338

Query  25   SVEVFLC  5
            SVE  LC
Sbjct  339  SVEAILC  345



>ref|XP_008340066.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Malus domestica]
Length=342

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 105/192 (55%), Gaps = 27/192 (14%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH  + L A E+ V++K+ EK+ E+E   R+N EL  R +Q++ EAQ 
Sbjct  158  EHLAKGVRDMKQRHMSSFLAAIEKGVSKKMIEKDLEIENMNRKNRELVDRIKQVAVEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YIDP+  +
Sbjct  218  WHYRAKYNESVVNVLKSDLQQAI-SQGADQGKE-------GFGDSEVDDAASYIDPNNYL  269

Query  166  LSP-GP------------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLC  44
              P GP                  +C+AC+ +  S +++PCRHLCLC  CD     CP+C
Sbjct  270  TIPAGPAKTVSKNYLGLKEQTGSRTCRACKAKEVSTLLMPCRHLCLCKDCDGFVNVCPVC  329

Query  43   LSVRSSSVEVFL  8
             S++++S +V+L
Sbjct  330  ESMKTASFQVYL  341



>ref|XP_010087677.1| Baculoviral IAP repeat-containing protein 3 [Morus notabilis]
 gb|EXB29619.1| Baculoviral IAP repeat-containing protein 3 [Morus notabilis]
Length=335

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +++ + + E RQR   + L A E+ V RKL EKE E+E    +N EL  R +Q+S E Q+
Sbjct  160  EKVLKGVTELRQRQTVSFLNAIEKGVNRKLNEKEIELENMKCKNKELIERIKQVSVEVQS  219

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYID-PDR  173
            W  + +  E     L++ LQQ +M  GA+  +E  G++    A         + ID P  
Sbjct  220  WHYKTKYNESVVTFLKSNLQQ-VMAQGAIHGKEGCGDSEVDDAASYTNANRLSIIDVPGS  278

Query  172  VVLSPGP-SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             V +  P +C+AC+ R  SV++LPCRHLCLC  C+     CP+C  +++++V+V++
Sbjct  279  SVFTKKPINCRACKVREVSVLLLPCRHLCLCKDCEGFIDICPVCSVMKTATVQVYM  334



>ref|XP_008797654.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Phoenix dactylifera]
Length=294

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            CKACR +   V++LPCRHLCLC AC+     CP+C SV+++S+E+FLC
Sbjct  247  CKACRDKDVCVLLLPCRHLCLCVACEPKIDTCPICHSVKNASLEIFLC  294



>gb|EEC67459.1| hypothetical protein OsI_34686 [Oryza sativa Indica Group]
Length=351

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 115/187 (61%), Gaps = 16/187 (9%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++LRR L E R+RHYR+LLGAAE + AR++REKEAE   AARR +EL  R  +L AEA A
Sbjct  166  ERLRRALGEVRRRHYRSLLGAAEAAAARRMREKEAEASNAARRGAELEERVARLRAEAAA  225

Query  346  wqararaqevtaatlqaqlqqVIMNA----GAVQEREDGNapacgaggdaedaesAYIDP  179
            WQA+A A + TAA L AQLQQ    A    G+    +D N     A  D  ++   ++DP
Sbjct  226  WQAKALADQSTAAALHAQLQQAAAAAAQARGSKSPEDDDNINPNAAAADDAESG--FVDP  283

Query  178  DRV-----VLSPGPSCKACRKRIASVVVLPCRHLCLCSACD-----AVAQACPLCLSVRS  29
            DRV        P   C+ CR R +SVV+LPCRHLC+C AC+     A+A ACP C    +
Sbjct  284  DRVEEVTPPPPPSRPCRTCRARPSSVVLLPCRHLCVCEACEPAVSTAIAAACPTCRGAVT  343

Query  28   SSVEVFL  8
             +V+VF+
Sbjct  344  GTVQVFI  350



>ref|XP_009144425.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Brassica 
rapa]
 ref|XP_009144426.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Brassica 
rapa]
Length=338

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + G     CK C  +  SV+V+PCRHL LC  CD     CP+C S+++SSV
Sbjct  274  YIDPNNSNNNMGSQRMRCKMCHGKEVSVLVVPCRHLSLCKECDVFTGFCPVCKSLKTSSV  333

Query  19   EVFL  8
            +VF 
Sbjct  334  QVFF  337



>ref|XP_011001522.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Populus euphratica]
Length=317

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -3

Query  514  RTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqawqar  335
            + + E  QRH  +LL + E+ ++ KL EKE +++   R+N +L  R +Q+S E  +W  R
Sbjct  146  KGVRELGQRHTVSLLSSIEQGISSKLHEKELQIQNINRKNKDLVERIKQVSMEVHSWHCR  205

Query  334  araqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYID--PDRVVL  164
             +  E     L++ L+Q +M  GA+  +E  G++    A   A       +D   + + L
Sbjct  206  TKYNESVVNVLKSNLEQ-VMAQGAMHGKEGYGDSEVDTATSYANQNHMRLVDGSANSISL  264

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                +C+AC+   ASV++ PCRHLCLC  C+ +   CP+C   +SSSVEVFL
Sbjct  265  KKQMTCRACKINEASVLLFPCRHLCLCKVCEGLIDVCPVCRIAKSSSVEVFL  316



>emb|CDP07370.1| unnamed protein product [Coffea canephora]
Length=239

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +CK C+ R  S+V LPCRHLC C+ C+++ + CP C SV+ SS+E+FL
Sbjct  191  ACKLCKARRLSIVFLPCRHLCSCTTCESLLEVCPTCESVKDSSIEIFL  238



>emb|CDY20611.1| BnaC08g14470D [Brassica napus]
Length=341

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + G     CK C  +  SV+V+PCRHL LC  CD     CP+C S+++SSV
Sbjct  277  YIDPNNSNNNMGSQRMRCKMCHGKEVSVLVVPCRHLSLCKECDVFTGFCPVCKSLKTSSV  336

Query  19   EVFL  8
            +VF 
Sbjct  337  QVFF  340



>gb|EAY87115.1| hypothetical protein OsI_08517 [Oryza sativa Indica Group]
Length=341

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 109/180 (61%), Gaps = 12/180 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR + ++ +RH RALL AAE S AR+LREK  E E+ ARR +EL  R  +L +EA 
Sbjct  169  GEQLRRAMADRVRRHNRALLVAAERSAARRLREKALEAEREARRGAELEERLARLRSEAA  228

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A +++  A +L AQLQQ    A A      G+    G  G AE + SAY+DP R 
Sbjct  229  AWQAKALSEQAAAVSLHAQLQQAAAAARA-----SGDELRGGEAGPAESSSSAYVDPRRS  283

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDA-----VAQACPLCLSVRSSSVEVFLC  5
                  +C  CR R A+VV+LPCRHL LC  C A     VA ACP+C  VR+  VE  LC
Sbjct  284  --GSDRACLTCRLRPATVVLLPCRHLSLCGDCFAAGDVDVAMACPVCHCVRTGGVEAILC  341



>dbj|BAD07587.1| S-ribonuclease binding protein SBP1-like [Oryza sativa Japonica 
Group]
Length=342

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 109/180 (61%), Gaps = 12/180 (7%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRR + ++ +RH RALL AAE S AR+LREK  E E+ ARR +EL  R  +L +EA 
Sbjct  170  GEQLRRAMADRVRRHNRALLVAAERSAARRLREKALEAEREARRGAELEERLARLRSEAA  229

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+A +++  A +L AQLQQ    A A      G+    G  G AE + SAY+DP R 
Sbjct  230  AWQAKALSEQAAAVSLHAQLQQAAAAARA-----SGDELRGGEAGPAESSSSAYVDPRRS  284

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDA-----VAQACPLCLSVRSSSVEVFLC  5
                  +C  CR R A+VV+LPCRHL LC  C A     VA ACP+C  VR+  VE  LC
Sbjct  285  --GSDRACLTCRLRPATVVLLPCRHLSLCGDCFAAGDVDVAMACPVCHCVRTGGVEAILC  342



>ref|XP_010251199.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Nelumbo nucifera]
Length=336

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 103/186 (55%), Gaps = 21/186 (11%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + + E +QRH  + L A E+ V RKLREKE E+E   R+N EL  R +Q++ EAQ+
Sbjct  158  EHIAKGVREMKQRHMASFLNAIEKGVGRKLREKELEIENMNRKNRELLERIKQVAVEAQS  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDRV  170
            W  RA+  E     L+  L+Q I   GA Q +E  G++    A          YID +  
Sbjct  218  WHYRAKYNESVVNVLKNNLKQAIA-QGADQGKEGCGDSEVDDAASS-------YIDQNNR  269

Query  169  VLSPGPS------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSS  26
            +  PG S            CKAC+ +  S+++LPCRHLCLC  C+     CP+C S++++
Sbjct  270  MSFPGGSGTSHQALKEQMTCKACKSKEVSILLLPCRHLCLCMDCEGFIDVCPVCQSMKTA  329

Query  25   SVEVFL  8
            SV+V++
Sbjct  330  SVQVYM  335



>ref|XP_004489827.1| PREDICTED: RING finger protein B-like isoform X1 [Cicer arietinum]
 ref|XP_004489828.1| PREDICTED: RING finger protein B-like isoform X2 [Cicer arietinum]
Length=326

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            Y D D +      SCK+C++    V+++PCRHLCLC  CDA    CPLC  ++++S+EV+
Sbjct  271  YQDMDNL------SCKSCKENEVCVMLMPCRHLCLCKDCDAFVNVCPLCRLIKTASIEVY  324

Query  10   L  8
            L
Sbjct  325  L  325



>ref|XP_006853348.1| hypothetical protein AMTR_s00032p00100570 [Amborella trichopoda]
 gb|ERN14815.1| hypothetical protein AMTR_s00032p00100570 [Amborella trichopoda]
Length=309

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  124  ASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            ASV+VLPCRHLC+CSACDA  QACP+C SV+ +SV+V+L
Sbjct  270  ASVLVLPCRHLCVCSACDARLQACPICNSVKKASVQVYL  308



>ref|XP_006376864.1| hypothetical protein POPTR_0012s08380g [Populus trichocarpa]
 gb|ERP54661.1| hypothetical protein POPTR_0012s08380g [Populus trichocarpa]
Length=331

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -3

Query  514  RTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqawqar  335
            + + E  QRH  +LL + E+ ++ KL EKE +++   R+N +L  R +Q+S E  +W  R
Sbjct  160  KGVRELGQRHTVSLLSSIEQGISSKLHEKELQMQNINRKNKDLVERIKQVSMEVHSWHCR  219

Query  334  araqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYID--PDRVVL  164
             +  E     L++ L+Q +M  GA+  +E  G++    A   A       +D   + + L
Sbjct  220  TKYNESVVNVLKSNLEQ-VMAQGAMHGKEGYGDSEVDTAASYANQNHMRLVDGSANSISL  278

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                +C+AC+   AS+++ PCRHLCLC  C+ +   CP+C   +SSSVEVFL
Sbjct  279  KKQMTCRACKINEASILLFPCRHLCLCKVCEGLIDVCPVCRIAKSSSVEVFL  330



>ref|XP_010682528.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 13/74 (18%)
 Frame = -3

Query  190  YIDPDRVVLSPG--------PS-----CKACRKRIASVVVLPCRHLCLCSACDAVAQACP  50
            YIDP   + + G        PS     C+ACR R  S++++PCRHLC+C  CD     CP
Sbjct  263  YIDPTNYLTTVGGRGKSIAVPSSEHLTCRACRSREVSILLMPCRHLCVCKECDGFISVCP  322

Query  49   LCLSVRSSSVEVFL  8
            +C   +S+SVEV+L
Sbjct  323  VCNIPKSASVEVYL  336



>ref|NP_001169020.1| uncharacterized protein LOC100382853 [Zea mays]
 gb|ACN31427.1| unknown [Zea mays]
Length=309

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  154  PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            PSCKAC    A V+VLPCRHLCLC AC+A A+ CP+C +V+++S++V L
Sbjct  261  PSCKACGGGDACVLVLPCRHLCLCRACEAGAEVCPVCGAVKNASLQVLL  309



>ref|XP_011001520.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X1 [Populus euphratica]
 ref|XP_011001521.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X1 [Populus euphratica]
Length=333

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -3

Query  514  RTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqawqar  335
            + + E  QRH  +LL + E+ ++ KL EKE +++   R+N +L  R +Q+S E  +W  R
Sbjct  162  KGVRELGQRHTVSLLSSIEQGISSKLHEKELQIQNINRKNKDLVERIKQVSMEVHSWHCR  221

Query  334  araqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYID--PDRVVL  164
             +  E     L++ L+Q +M  GA+  +E  G++    A   A       +D   + + L
Sbjct  222  TKYNESVVNVLKSNLEQ-VMAQGAMHGKEGYGDSEVDTATSYANQNHMRLVDGSANSISL  280

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                +C+AC+   ASV++ PCRHLCLC  C+ +   CP+C   +SSSVEVFL
Sbjct  281  KKQMTCRACKINEASVLLFPCRHLCLCKVCEGLIDVCPVCRIAKSSSVEVFL  332



>ref|XP_002318654.1| hypothetical protein POPTR_0012s08380g [Populus trichocarpa]
 gb|EEE96874.1| hypothetical protein POPTR_0012s08380g [Populus trichocarpa]
Length=357

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 97/176 (55%), Gaps = 4/176 (2%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +   + + E  QRH  +LL + E+ ++ KL EKE +++   R+N +L  R +Q+S E  +
Sbjct  182  ENFIKGVRELGQRHTVSLLSSIEQGISSKLHEKELQMQNINRKNKDLVERIKQVSMEVHS  241

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYID--PD  176
            W  R +  E     L++ L+Q +M  GA+  +E  G++    A   A       +D   +
Sbjct  242  WHCRTKYNESVVNVLKSNLEQ-VMAQGAMHGKEGYGDSEVDTAASYANQNHMRLVDGSAN  300

Query  175  RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             + L    +C+AC+   AS+++ PCRHLCLC  C+ +   CP+C   +SSSVEVFL
Sbjct  301  SISLKKQMTCRACKINEASILLFPCRHLCLCKVCEGLIDVCPVCRIAKSSSVEVFL  356



>ref|XP_008389682.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Malus domestica]
 ref|XP_008389684.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Malus domestica]
Length=342

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 106/192 (55%), Gaps = 27/192 (14%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH  + L A ++ V++K+REK+ E+E    +N EL  R +Q++ EAQ 
Sbjct  158  EHLAKGVRDMKQRHMASFLAAIDKGVSKKMREKDLEIENMNSKNQELVDRIKQVAVEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YIDP+  +
Sbjct  218  WHYRAKYNESVVNALKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYIDPNNYL  269

Query  166  LSP-GPS------------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLC  44
              P GP+                  C+AC+ +  S++++PCRHLCLC  CD     CP+C
Sbjct  270  TIPVGPAKSVPKNYLGLKEQTGSRACRACKAKEVSMLLMPCRHLCLCKDCDGFVNVCPVC  329

Query  43   LSVRSSSVEVFL  8
             S++++S +V+L
Sbjct  330  ESMKTASFQVYL  341



>ref|XP_009380014.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=352

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFLC  5
            +CKAC +R  S+++LPCRHLCLC  C+A A ACP+C S +++ ++VF+C
Sbjct  304  ACKACGERDVSILLLPCRHLCLCKDCEAKADACPVCGSAKNAYLQVFMC  352



>ref|NP_001151332.1| inhibitor of apoptosis-like protein [Zea mays]
 gb|ACG42401.1| inhibitor of apoptosis-like protein [Zea mays]
Length=298

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  154  PSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            PSCKAC    A V+VLPCRHLCLC AC+A A+ CP+C +V+++S++V L
Sbjct  250  PSCKACGGGDACVLVLPCRHLCLCRACEAGAEVCPVCGAVKNASLQVLL  298



>emb|CAN63942.1| hypothetical protein VITISV_032504 [Vitis vinifera]
Length=346

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---------------CKACRKRIASVVVLPCRHLCLCSACDAVAQA  56
            YIDP  + +  GP                C+AC+ +  S++++PCRHLC+C  C+ +   
Sbjct  270  YIDPHNMAIPGGPGRANSQXKEGLKEQMICRACKSKEVSILLIPCRHLCICKECEGLISV  329

Query  55   CPLCLSVRSSSVEVFL  8
            CP+C S++++ V+V+L
Sbjct  330  CPVCQSMKTTGVQVYL  345



>ref|XP_009148408.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Brassica rapa]
Length=336

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -3

Query  190  YIDPDRVVL-SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            YIDP+   + +    C+ C  R  SV+++PCRHL LC  CD     CP+C S+++SSV+V
Sbjct  274  YIDPNNKKMGNQRMRCRMCNAREVSVLLVPCRHLSLCKECDVFTGVCPVCKSLKTSSVQV  333

Query  13   FL  8
            F 
Sbjct  334  FF  335



>gb|KGN62297.1| hypothetical protein Csa_2G348840 [Cucumis sativus]
Length=333

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 11/71 (15%)
 Frame = -3

Query  187  IDPDRVVLSPG----PS-------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCL  41
            IDP+  V  PG    PS       C+AC+ +  S++++PCRHLCLC  CD +   CP+C 
Sbjct  262  IDPNNYVNVPGGTIKPSTSKEYMICRACKAKEVSILLMPCRHLCLCKDCDGLVNVCPVCH  321

Query  40   SVRSSSVEVFL  8
             ++++ ++V+L
Sbjct  322  LIKTAGIQVYL  332



>ref|XP_002975512.1| hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii]
 ref|XP_002993531.1| hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii]
 gb|EFJ05423.1| hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii]
 gb|EFJ23141.1| hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii]
Length=246

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 7/177 (4%)
 Frame = -3

Query  523  QLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqaw  344
            Q+RR +EEK+Q+  RALL + E  VAR+LREK+ E+EK  RRN EL  R +QL+ EA+ W
Sbjct  71   QMRRAIEEKQQQQSRALLNSVERFVARRLREKDIEMEKINRRNMELEERVKQLTVEARLW  130

Query  343  qararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV-  167
            Q +A+  E+  A+L++ LQQ +  A + ++  +G         ++   + A  D  R   
Sbjct  131  QNKAKNGEMMVASLRSNLQQAV--ALSREQSREGVGDTDADDAESSHPDDAADDHARTYK  188

Query  166  ----LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                L    +C+ CR     +++LPCRHLCLC  C+A    CPLC   +++SV+V++
Sbjct  189  ENKELREKRTCRVCRSNDVCILLLPCRHLCLCKECEARLDTCPLCRHSKNASVQVYM  245



>ref|XP_011045293.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045294.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045295.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045296.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045297.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045298.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045299.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011045300.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Populus euphratica]
Length=339

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 109/189 (58%), Gaps = 24/189 (13%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + L + + RH  +LL A E+ V++KL+EK+ E+EK  R+N EL  R +Q++AEAQ 
Sbjct  158  EHLAKGLRDLKHRHISSLLSAMEKGVSKKLQEKDREIEKINRKNKELIERIRQVAAEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G +  D  ++YI+P+  +
Sbjct  218  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDNEIDDAASYIEPNNYL  269

Query  166  LSPGP----------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSV  35
               G                 +C+AC+ R  S++++PCRHLCLC  CDA+   CP+C  +
Sbjct  270  NFTGHPAKPLLWNYQGLKEHVTCRACKTREVSMLLMPCRHLCLCKECDALINVCPVCRLI  329

Query  34   RSSSVEVFL  8
            +++S +V+L
Sbjct  330  KTNSFQVYL  338



>emb|CDY20963.1| BnaA08g25620D [Brassica napus]
Length=338

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS---CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + G     CK C  +  SV+V+PCRHL LC  CD     CP+C S++++SV
Sbjct  274  YIDPNNSNNNMGSQRMRCKMCHGKEVSVLVVPCRHLSLCKECDVFTGFCPVCKSLKTASV  333

Query  19   EVFL  8
            +VF 
Sbjct  334  QVFF  337



>ref|XP_011045301.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Populus euphratica]
 ref|XP_011045302.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X2 [Populus euphratica]
Length=325

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 109/189 (58%), Gaps = 24/189 (13%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + L + + RH  +LL A E+ V++KL+EK+ E+EK  R+N EL  R +Q++AEAQ 
Sbjct  144  EHLAKGLRDLKHRHISSLLSAMEKGVSKKLQEKDREIEKINRKNKELIERIRQVAAEAQN  203

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I + GA Q +E       G G +  D  ++YI+P+  +
Sbjct  204  WHYRAKYNESVVNVLKSNLQQAI-SQGADQGKE-------GFGDNEIDDAASYIEPNNYL  255

Query  166  LSPGP----------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSV  35
               G                 +C+AC+ R  S++++PCRHLCLC  CDA+   CP+C  +
Sbjct  256  NFTGHPAKPLLWNYQGLKEHVTCRACKTREVSMLLMPCRHLCLCKECDALINVCPVCRLI  315

Query  34   RSSSVEVFL  8
            +++S +V+L
Sbjct  316  KTNSFQVYL  324



>gb|KDP26612.1| hypothetical protein JCGZ_17770 [Jatropha curcas]
Length=340

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 98/190 (52%), Gaps = 25/190 (13%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + + + L + +QRH  + L A E+ V +KL EK+ E+E   R+N EL  R +Q++ EAQ 
Sbjct  158  EHMAKGLRDMKQRHITSFLTAIEKGVTKKLWEKDLEIENMNRKNKELIERIKQVAMEAQN  217

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W  RA+  E     L++ LQQ I   G   +   G++    A          YIDP   +
Sbjct  218  WHYRAKYNESVVNVLKSNLQQAISQGGDQGKEGFGDSEVDDAAS--------YIDPTNYL  269

Query  166  LSPGP-----------------SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLS  38
              PG                  +C+AC+ +   ++++PCRHLCLC  CD +   CP+C  
Sbjct  270  NIPGGPARALSRNYQGGLKDHMTCRACKSKEVCMLLMPCRHLCLCKDCDMLIGVCPVCQL  329

Query  37   VRSSSVEVFL  8
            +++SSV+V+L
Sbjct  330  IKTSSVQVYL  339



>gb|EPS57462.1| hypothetical protein M569_17355, partial [Genlisea aurea]
Length=245

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            CKAC  R ASV+++PCRHLCLC  C+ VA  CP+C  V+S+S+ V++
Sbjct  199  CKACGAREASVLMMPCRHLCLCVECEGVASVCPVCKVVKSASLHVYM  245



>ref|XP_008809449.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Phoenix dactylifera]
Length=258

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            CKAC  R   V++LPCRHLC C  C+A   ACPLC SV+  SVEVFL
Sbjct  211  CKACGSRELRVLLLPCRHLCACERCEAFLDACPLCGSVKERSVEVFL  257



>ref|NP_001176584.1| Os11g0542100 [Oryza sativa Japonica Group]
 dbj|BAH01030.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH95312.1| Os11g0542100 [Oryza sativa Japonica Group]
Length=327

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            CKAC +R A+V++LPCRHLCLC AC+A A+ACP+CL+V+  SV
Sbjct  277  CKACGEREAAVLLLPCRHLCLCRACEARAEACPVCLAVKKVSV  319



>emb|CDX93396.1| BnaA06g06520D [Brassica napus]
Length=336

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -3

Query  190  YIDPDRVVL-SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            YIDP+   + +    C+ C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+V
Sbjct  274  YIDPNNKKMGNQRMRCRMCNAKEVSVLLVPCRHLSLCKECDVFTSVCPVCKSLKTSSVQV  333

Query  13   FL  8
            F 
Sbjct  334  FF  335



>gb|ABA94142.1| expressed protein [Oryza sativa Japonica Group]
Length=304

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            CKAC +R A+V++LPCRHLCLC AC+A A+ACP+CL+V+  SV
Sbjct  254  CKACGEREAAVLLLPCRHLCLCRACEARAEACPVCLAVKKVSV  296



>ref|XP_006305283.1| hypothetical protein CARUB_v10009658mg [Capsella rubella]
 gb|EOA38181.1| hypothetical protein CARUB_v10009658mg [Capsella rubella]
Length=339

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            CK C  +  SV+++PCRHL LC+ CD + + CP+C S+++SSV+VF 
Sbjct  292  CKTCNAKEVSVLLVPCRHLSLCTECDVITKICPVCKSLKTSSVQVFF  338



>ref|XP_008799430.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Phoenix 
dactylifera]
Length=324

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 103/174 (59%), Gaps = 8/174 (5%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
            G+QLRRTL EKR RH  ++L AAE + AR LREKEAEV++A R  +EL  R  +L   + 
Sbjct  158  GEQLRRTLAEKRHRHCASMLCAAEAAAARTLREKEAEVDRAVRWRTELEGRLARLKEVSL  217

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            AWQA+  A +  AA LQAQLQQ    A A  E  +       A          ++DPDR 
Sbjct  218  AWQAKTMADQEAAAVLQAQLQQAQAAAAAAAEERETECRDPRAQDAESA----HVDPDR-  272

Query  169  VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
              +P   C++CR+  ASVVVLPCRHLCLC  C A A +CP+C    + S+ VF 
Sbjct  273  --APSAMCRSCREAPASVVVLPCRHLCLCPDCGA-AHSCPVCHCATTGSLHVFF  323



>ref|XP_001752458.1| predicted protein [Physcomitrella patens]
 gb|EDQ82697.1| predicted protein, partial [Physcomitrella patens]
Length=206

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            L    +C++CR    S+++LPCRHLCLC  C+A   ACPLC +++++SV+V++
Sbjct  154  LREQRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDACPLCQTLKNASVQVYM  206



>ref|XP_008444346.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 [Cucumis 
melo]
Length=333

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 11/71 (15%)
 Frame = -3

Query  187  IDPDRVVLSPG----PS-------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCL  41
            IDP+  +  PG    PS       C+AC+ +  S++++PCRHLCLC  CD +   CP+C 
Sbjct  262  IDPNNYLSVPGGTIKPSTSKEYMICRACKAKEVSILLMPCRHLCLCKDCDGLVNVCPVCH  321

Query  40   SVRSSSVEVFL  8
             ++++ ++V+L
Sbjct  322  LIKTAGIQVYL  332



>ref|XP_004297394.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Fragaria vesca subsp. vesca]
 ref|XP_011463142.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Fragaria vesca subsp. vesca]
Length=342

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +CKACR +  S++++PCRHLCLC  CD     CP+C S++++S +V+L
Sbjct  294  ACKACRAKEVSILLMPCRHLCLCKDCDEFISVCPVCESMKTASFQVYL  341



>ref|XP_006392142.1| hypothetical protein EUTSA_v10023576mg [Eutrema salsugineum]
 gb|ESQ29428.1| hypothetical protein EUTSA_v10023576mg [Eutrema salsugineum]
Length=341

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK+C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  289  STGMRCKSCNAKEVSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFF  340



>ref|XP_006356429.1| PREDICTED: baculoviral IAP repeat-containing protein 2-like [Solanum 
tuberosum]
Length=332

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 102/194 (53%), Gaps = 31/194 (16%)
 Frame = -3

Query  526  DQLRRTLEEK--------RQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQ  371
            DQ  +T EE         +QRH  +LL A E++V  KL+EK+ E+E   R+N EL  R +
Sbjct  148  DQYLKTQEETWARGVRDIKQRHMASLLSAVEKNVGTKLQEKDIELENINRKNRELVERMK  207

Query  370  QLSaeaqawqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesA  191
            Q++AEAQ W  RA+  E    TL+  LQQ + +A   +E    N     A          
Sbjct  208  QVTAEAQNWCYRAKCNESLVNTLKTNLQQAMQSAEQGKEGMGDNELDDAAS---------  258

Query  190  YIDPDRVVLSPGPS-------------CKACRKRIASVVVLPCRHLCLCSACDAVAQACP  50
            YIDP+   LS  PS             CK C+ +  SV+++PCRHLCLC  C+ +   CP
Sbjct  259  YIDPNNR-LSNIPSGSGKCTSTKKGIICKVCKLKEVSVLLMPCRHLCLCKDCEGLVSVCP  317

Query  49   LCLSVRSSSVEVFL  8
            +C  + ++SVEVFL
Sbjct  318  ICQLMTTASVEVFL  331



>ref|XP_003519957.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X1 [Glycine 
max]
 ref|XP_006574625.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like isoform X2 [Glycine 
max]
Length=337

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 108/188 (57%), Gaps = 23/188 (12%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QL + + + +Q+H  ALL + E+ ++ KL+EK+ E+E   R+N EL  R +Q++ E Q+
Sbjct  157  EQLSKGVRDMKQKHMAALLTSIEKGISTKLKEKDVEIENMNRKNRELAERIKQVAVEVQS  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDR--  173
            W  RA+  E    TL+  LQQ I + GA Q +E       G G    D +++YIDP+   
Sbjct  217  WHYRAKYNESIVNTLRNNLQQAI-SQGAEQGKE-------GFGDSEVDDDASYIDPNNFL  268

Query  172  -VVLSP------------GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
             ++ +P              +C+AC+ +  S++++PCRHLCLC  C+     CP+C  ++
Sbjct  269  NILAAPINSTHKSYQDMENLTCRACKVKTVSMLLMPCRHLCLCKDCEGFINVCPICQLIK  328

Query  31   SSSVEVFL  8
            ++SVEV L
Sbjct  329  TASVEVHL  336



>ref|XP_003570124.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Brachypodium 
distachyon]
Length=345

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 8/70 (11%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQ--------ACPLCLSV  35
            Y+DP R       +C+ACR R ASVV+LPCRHL LC  C A           ACP+C  V
Sbjct  276  YVDPRRAGSEHRSACRACRGRPASVVLLPCRHLSLCGDCLAAGDMDVSSGPLACPVCHCV  335

Query  34   RSSSVEVFLC  5
            R+ SVE  LC
Sbjct  336  RTGSVEAILC  345



>gb|KHN00365.1| Baculoviral IAP repeat-containing protein 3 [Glycine soja]
Length=337

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 108/188 (57%), Gaps = 23/188 (12%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +QL + + + +Q+H  ALL + E+ ++ KL+EK+ E+E   R+N EL  R +Q++ E Q+
Sbjct  157  EQLSKGVRDMKQKHMAALLTSIEKGISTKLKEKDVEIENMNRKNRELAERIKQVAVEVQS  216

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDR--  173
            W  RA+  E    TL+  LQQ I + GA Q +E       G G    D +++YIDP+   
Sbjct  217  WHYRAKYNESIVNTLRNNLQQAI-SQGAEQGKE-------GFGDSEVDDDASYIDPNNFL  268

Query  172  -VVLSP------------GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVR  32
             ++ +P              +C+AC+ +  S++++PCRHLCLC  C+     CP+C  ++
Sbjct  269  NILAAPINSTHKSYQDMENLTCRACKVKTVSMLLMPCRHLCLCKDCEGFINVCPICQLIK  328

Query  31   SSSVEVFL  8
            ++SVEV L
Sbjct  329  TASVEVHL  336



>ref|XP_009404714.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Musa acuminata subsp. malaccensis]
Length=337

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            ++L+  +EE R+++++ALL   E+  A++LREKEAE+EKA R+N+EL  R +QL+ E + 
Sbjct  156  ERLQSGVEEARKKYFKALLWGMEQRAAKRLREKEAELEKARRKNAELEERVRQLATEGEM  215

Query  346  wqararaqevtaatlqaqlqqVIM-NAGAVQERE-------DGNapacgaggdaedaesA  191
            W A AR  E  AA+L+A L+Q+++ NA A Q +E       D  +         +    A
Sbjct  216  WFAVARNNESIAASLRADLEQILLRNAAAAQVKEGYGDTDDDAQSCRSVEATGRKSIAPA  275

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
                D V   P  +CK+C +    V++LPC+HLCLC +C++   ACP C +V+++ +++F
Sbjct  276  PAPTDEVRRWPRAACKSCAEGDVCVLLLPCKHLCLCKSCESKTHACPCCGTVKNACLQIF  335

Query  10   L  8
            +
Sbjct  336  M  336



>gb|EEE51417.1| hypothetical protein OsJ_32495 [Oryza sativa Japonica Group]
Length=298

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 10/71 (14%)
 Frame = -3

Query  190  YIDPDRV-----VLSPGPSCKACRKRIASVVVLPCRHLCLCSACD-----AVAQACPLCL  41
            ++DPDRV        P   C+ CR R +SVV+LPCRHLC+C AC+     A+A ACP C 
Sbjct  227  FVDPDRVEEVTPPPPPSRPCRTCRARPSSVVLLPCRHLCVCEACEPAVSTAIAAACPTCR  286

Query  40   SVRSSSVEVFL  8
               + +V+VF+
Sbjct  287  GAVTGTVQVFI  297



>ref|XP_006302505.1| hypothetical protein CARUB_v10020606mg [Capsella rubella]
 ref|XP_006302506.1| hypothetical protein CARUB_v10020606mg [Capsella rubella]
 gb|EOA35403.1| hypothetical protein CARUB_v10020606mg [Capsella rubella]
 gb|EOA35404.1| hypothetical protein CARUB_v10020606mg [Capsella rubella]
Length=339

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK+C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  287  STGMRCKSCNIKDVSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKNSSVQVFF  338



>gb|KDP31086.1| hypothetical protein JCGZ_11462 [Jatropha curcas]
Length=331

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +C+ACR + +S+++LPCRHLCLC  C    +ACP+C   +++ VEVF+
Sbjct  283  TCRACRAKESSMLLLPCRHLCLCRDCAGFTEACPVCQITKTAGVEVFM  330



>emb|CDY37958.1| BnaC05g08160D [Brassica napus]
Length=339

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -3

Query  190  YIDPD--RVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            YIDP+  + + +    C+ C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+
Sbjct  276  YIDPNNNKKMGNQRMRCRMCNAKEVSVLLVPCRHLSLCKECDVFTGVCPVCKSLKTSSVQ  335

Query  16   VFL  8
            VF 
Sbjct  336  VFF  338



>gb|EPS71986.1| hypothetical protein M569_02783, partial [Genlisea aurea]
Length=258

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            C+ C+  +ASV+++PCRHLCLC  CD V   CP+C   +S S EV+L
Sbjct  211  CRFCKGNMASVLLMPCRHLCLCRECDVVVNDCPVCWIKKSFSFEVYL  257



>ref|XP_010510934.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
 ref|XP_010510935.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
Length=340

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK+C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  288  SAGMRCKSCNIKEVSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFF  339



>ref|XP_004975499.1| PREDICTED: uncharacterized protein LOC101772356 [Setaria italica]
Length=341

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -3

Query  187  IDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +  D V  +  PSCK+C    A V++LPCRHLCLC AC+A A  CP+C + +++S+ V L
Sbjct  281  VADDAVSRAASPSCKSCGGGDACVLLLPCRHLCLCRACEAAADVCPVCAATKNASLHVLL  340



>ref|XP_010911797.1| PREDICTED: E3 ubiquitin-protein ligase BOI-like [Elaeis guineensis]
Length=260

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -3

Query  187  IDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            ++  R V+  G  CKAC  R + V++LPCRHL  C  C+A   ACPLC S+++ SVEVFL
Sbjct  201  MEEPRAVMGMG-LCKACGSRESRVLLLPCRHLSACDRCEAFLDACPLCGSIKAGSVEVFL  259



>gb|EYU35171.1| hypothetical protein MIMGU_mgv1a018739mg, partial [Erythranthe 
guttata]
Length=303

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = -3

Query  187  IDPDRVVLSPGP---SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            +DP RV     P    CK CR+R A+V+V PCRH+ +C+ CD   ++CP C  ++++S+E
Sbjct  242  VDPSRV----APVTLDCKTCRRRPATVMVWPCRHISVCTVCDTATRSCPSCRKLKTTSIE  297

Query  16   VFL  8
            V L
Sbjct  298  VRL  300



>ref|XP_002452733.1| hypothetical protein SORBIDRAFT_04g031490 [Sorghum bicolor]
 gb|EES05709.1| hypothetical protein SORBIDRAFT_04g031490 [Sorghum bicolor]
Length=353

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 42/72 (58%), Gaps = 10/72 (14%)
 Frame = -3

Query  190  YIDPDRVVLSPGPS----CKACRKRIASVVVLPCRHLCLCSAC------DAVAQACPLCL  41
            Y+DP R    PG S    C  CR R ASVV+LPCRHL LC  C      D  A ACP+CL
Sbjct  282  YVDPCRRTTGPGTSSDRACLGCRLRPASVVLLPCRHLSLCGECFAAGDADDAAMACPVCL  341

Query  40   SVRSSSVEVFLC  5
             VR+ SVE  LC
Sbjct  342  CVRTGSVEAILC  353



>ref|XP_010473239.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
 ref|XP_010473240.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
 ref|XP_010473241.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
 ref|XP_010473242.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Camelina sativa]
Length=340

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK+C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  288  SAGMRCKSCNIKEISVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFF  339



>ref|XP_006417440.1| hypothetical protein EUTSA_v10008132mg [Eutrema salsugineum]
 gb|ESQ35793.1| hypothetical protein EUTSA_v10008132mg [Eutrema salsugineum]
Length=338

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = -3

Query  190  YIDPDRV--VLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVE  17
            YIDP+    + +    CK C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+
Sbjct  275  YIDPNNNNNMGTQRMRCKMCNAKEVSVLLVPCRHLSLCKECDVFTGVCPVCKSLKTSSVQ  334

Query  16   VFL  8
            VF 
Sbjct  335  VFF  337



>emb|CBI28557.3| unnamed protein product [Vitis vinifera]
Length=335

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = -3

Query  190  YIDPDRVVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVF  11
            YIDP  +       C+AC+ +  S++++PCRHLC+C  C+ +   CP+C S++++ V+V+
Sbjct  277  YIDPHNM---EQMICRACKSKEVSILLIPCRHLCICKECEGLISVCPVCQSMKTTGVQVY  333

Query  10   L  8
            L
Sbjct  334  L  334



>ref|NP_176260.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
 ref|NP_974055.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
 ref|NP_001117519.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
 gb|AAY57587.1| RING finger family protein [Arabidopsis thaliana]
 dbj|BAF01142.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI93905.1| At1g60610 [Arabidopsis thaliana]
 gb|AEE33703.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
 gb|AEE33704.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
 gb|AEE33705.1| putative S-ribonuclease binding protein [Arabidopsis thaliana]
Length=340

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  288  STGMRCKLCNVKNVSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFF  339



>gb|AAB71973.1| Unknown protein [Arabidopsis thaliana]
Length=372

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  163  SPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            S G  CK C  +  SV+++PCRHL LC  CD     CP+C S+++SSV+VF 
Sbjct  320  STGMRCKLCNVKNVSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFF  371



>ref|XP_006438334.1| hypothetical protein CICLE_v10032055mg [Citrus clementina]
 ref|XP_006483893.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
isoform X1 [Citrus sinensis]
 gb|ESR51574.1| hypothetical protein CICLE_v10032055mg [Citrus clementina]
 gb|KDO82361.1| hypothetical protein CISIN_1g019869mg [Citrus sinensis]
Length=334

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 106/182 (58%), Gaps = 19/182 (10%)
 Frame = -3

Query  520  LRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqawq  341
            L + +++ +QRH  + L A E+ +A+KL+EK+ E+E   R+N EL  R +Q++AEAQ W 
Sbjct  160  LAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWH  219

Query  340  araraqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVVLS  161
             RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YI+ +  +  
Sbjct  220  YRAKYNESVVNLLKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYINTNNYLTV  271

Query  160  P-GPS----------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            P GP           C+AC+ + ASV+++PCRHLCLC  CD +   CP+C  V+++SV V
Sbjct  272  PSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLV  331

Query  13   FL  8
             L
Sbjct  332  HL  333



>gb|EYU28443.1| hypothetical protein MIMGU_mgv1a0093071mg, partial [Erythranthe 
guttata]
Length=331

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = -3

Query  190  YIDPDRVV----LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSS  23
            Y+DP+  +    L    +C++C+ +  SV+++PCRHLCLC  C+     CP+C  V ++ 
Sbjct  266  YVDPNNYLKSSSLRKNVTCRSCKAKEVSVLLMPCRHLCLCKECEGFVTVCPVCQMVTTAC  325

Query  22   VEVFL  8
            +EV+L
Sbjct  326  LEVYL  330



>ref|XP_006652240.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3-like 
[Oryza brachyantha]
Length=330

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 105/179 (59%), Gaps = 10/179 (6%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +++R  LE+ R+RH RA++   E + A +LR  E E+E+A  RN EL  R +Q++AE  A
Sbjct  155  ERMRVGLEDARRRHVRAVVSTVERAAAGRLRAAEVELERARCRNVELEERLRQMTAEGHA  214

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W + A++ E  AA L+A L Q++ + GA+    +GN    G   DA+       + D+  
Sbjct  215  WLSVAKSHEAVAAGLRATLDQLMQSPGAL----NGNTGGEGDAEDAQSCCFETPEGDQAG  270

Query  166  LSPGPS------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
                 S      CK+C   +ASV++LPCRHLCLCS C+A   ACP+C + +++S+ V L
Sbjct  271  ADDAASKSVAALCKSCGAGVASVLLLPCRHLCLCSGCEAALDACPVCGAKKNASLHVLL  329



>gb|AAM61038.1| S-ribonuclease binding protein SBP1, putative [Arabidopsis thaliana]
Length=337

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  190  YIDPDR---VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSV  20
            YIDP+    + +     CK C  +  SV+++PCRHL LC  CD   + CP+C S++SS V
Sbjct  273  YIDPNNNNNMGIHQRMRCKMCNVKEVSVLIVPCRHLSLCKECDVFTKICPVCKSLKSSCV  332

Query  19   EVFL  8
            +VF 
Sbjct  333  QVFF  336



>ref|XP_009390377.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Musa acuminata subsp. malaccensis]
Length=312

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 100/173 (58%), Gaps = 3/173 (2%)
 Frame = -3

Query  529  GDQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaq  350
             ++LR  LEE R+RH R  L A E+ V ++L EKEAE+E+A RRN+EL  + +Q+S E Q
Sbjct  137  NERLRTGLEEARKRHCRVFLSAMEQQVTKRLMEKEAELERAVRRNAELEEKVRQMSEENQ  196

Query  349  awqararaqevtaatlqaqlqqVIMNAGAVQERED-GNapacgaggdaedaesAYIDPDR  173
             W + A+  E   ++L+A L   ++   AV  RE  G++ +     D   +    ++ D 
Sbjct  197  IWFSMAKNNEAAVSSLKASLGHALLQNAAVAAREGYGDSKSTPLAADDAHSCCFEVEEDD  256

Query  172  VVLSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
                   +C+ACR   A  ++LPCRH+ LC  C+  A ACP+C S +++ V+V
Sbjct  257  TRWRM--TCRACRGTDACFLLLPCRHVSLCKDCEPEADACPVCGSAKNACVQV  307



>ref|XP_006483894.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
isoform X2 [Citrus sinensis]
 gb|KDO82362.1| hypothetical protein CISIN_1g019869mg [Citrus sinensis]
Length=279

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 106/182 (58%), Gaps = 19/182 (10%)
 Frame = -3

Query  520  LRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqawq  341
            L + +++ +QRH  + L A E+ +A+KL+EK+ E+E   R+N EL  R +Q++AEAQ W 
Sbjct  105  LAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWH  164

Query  340  araraqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVVLS  161
             RA+  E     L++ LQQ I + GA Q +E       G G    D  ++YI+ +  +  
Sbjct  165  YRAKYNESVVNLLKSNLQQAI-SQGADQGKE-------GFGDSEVDDAASYINTNNYLTV  216

Query  160  P-GPS----------CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEV  14
            P GP           C+AC+ + ASV+++PCRHLCLC  CD +   CP+C  V+++SV V
Sbjct  217  PSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLV  276

Query  13   FL  8
             L
Sbjct  277  HL  278



>gb|KJB17203.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
 gb|KJB17204.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
 gb|KJB17205.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
 gb|KJB17206.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
 gb|KJB17207.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
 gb|KJB17208.1| hypothetical protein B456_002G185700 [Gossypium raimondii]
Length=339

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 104/187 (56%), Gaps = 20/187 (11%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            + L + + + +QRH  + L A E+ V++KLREK+ E+E   R+N EL  R +Q++ EAQ 
Sbjct  158  EHLTKGIRDMKQRHTASFLAAIEKGVSKKLREKDVELETVNRKNRELVDRIKQVTMEAQN  217

Query  346  wqararaqevtaatlqaqlqqVI-MNAGAVQEREDGNapacgaggdaedaesAYIDPDRV  170
            W  RA+  E     L+  L+QV+  + G  Q+ ++G       G    D  ++YIDP+ +
Sbjct  218  WHHRAKYNESVVNVLKRNLEQVMSQSQGGEQQGKEG------FGESEVDDAASYIDPNNL  271

Query  169  VLSP-------------GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRS  29
            +  P             G  C+AC  +  SV+++PCRHLC+C  CD +   CP+C   ++
Sbjct  272  LSIPDVGGAKCVSRNRHGMICRACNAKEVSVLLMPCRHLCICKDCDVLISVCPVCQVKKT  331

Query  28   SSVEVFL  8
            + V+V+L
Sbjct  332  ARVQVYL  338



>gb|KDO36308.1| hypothetical protein CISIN_1g026366mg [Citrus sinensis]
Length=239

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            C+AC  +  S+++LPCRHLCLC  C+ +   CP+C ++R++SVEV+L
Sbjct  192  CRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYL  238



>ref|XP_009397722.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Musa acuminata subsp. malaccensis]
Length=243

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  157  GPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            G +C++CR+R  SV++LPCRHLCLC+AC  V   CP+C   ++ SV+V +
Sbjct  188  GTACRSCRERKPSVLLLPCRHLCLCAACGPVVDTCPVCGCTKNGSVQVNM  237



>gb|EMS54504.1| hypothetical protein TRIUR3_32073 [Triticum urartu]
Length=324

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 100/173 (58%), Gaps = 0/173 (0%)
 Frame = -3

Query  526  DQLRRTLEEKRQRHYRALLGAAEESVarklrekeaevekaarRNSELHARAQQLSaeaqa  347
            +++R  LEE R+RH RA+L   E + A +L+  EAE+E+A  RN EL  R +Q++AE QA
Sbjct  151  ERIRAGLEEARRRHARAVLATVERAAAGRLQAVEAELERARYRNGELEERLRQMTAEGQA  210

Query  346  wqararaqevtaatlqaqlqqVIMNAGAVQEREDGNapacgaggdaedaesAYIDPDRVV  167
            W   A++ E  AA L+A L Q++    AV    +G+A    +      A     D     
Sbjct  211  WLGVAKSHEAVAAGLRATLDQLLQPPCAVAGAAEGDADDAQSCCFETPAGDNADDAASKA  270

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            ++  PSCKAC +  A V++LPCRHL LC AC+     CP+C + +++S+ V L
Sbjct  271  VAAAPSCKACGQGDACVLLLPCRHLSLCGACEPAVDTCPVCGATKNASLHVLL  323



>emb|CAN75320.1| hypothetical protein VITISV_003762 [Vitis vinifera]
Length=360

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +C+AC+ R  SV++LPCRHLCLC  C+     CP+C  ++++SV+VF+
Sbjct  312  NCRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCXVMKTASVQVFM  359



>ref|XP_009773985.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nicotiana 
sylvestris]
 ref|XP_009773986.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Nicotiana 
sylvestris]
Length=332

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  148  CKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            C+AC+ + ASV++ PCRHLCLC  C+    +CP+C  ++++SV+V++
Sbjct  285  CRACKSKEASVLLFPCRHLCLCKECEGFINSCPVCQVMKTASVQVYM  331



>ref|XP_006857405.1| hypothetical protein AMTR_s00067p00146050 [Amborella trichopoda]
 gb|ERN18872.1| hypothetical protein AMTR_s00067p00146050 [Amborella trichopoda]
Length=281

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
             + GP CKAC  R   VVVLPCRHLC+C  C+   + C +C+  +S++V V++
Sbjct  228  FTVGPRCKACGTRERRVVVLPCRHLCVCEGCEVGLERCLICMGKKSATVHVYM  280



>gb|EMT06341.1| hypothetical protein F775_08568 [Aegilops tauschii]
Length=351

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +C+ C  + A+V+V+PCRHLCLC+ CD VA ACP+C   +S SVE+ L
Sbjct  303  ACRLCGAKEAAVLVMPCRHLCLCADCDRVADACPVCQYPKSGSVEINL  350



>ref|XP_002282390.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 isoform 
X1 [Vitis vinifera]
 ref|XP_010663157.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 isoform 
X1 [Vitis vinifera]
 ref|XP_010663158.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 isoform 
X1 [Vitis vinifera]
 ref|XP_010663159.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1 isoform 
X1 [Vitis vinifera]
 emb|CBI15014.3| unnamed protein product [Vitis vinifera]
Length=334

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +C+AC+ R  SV++LPCRHLCLC  C+     CP+C  ++++SV+VF+
Sbjct  286  NCRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCRVMKTASVQVFM  333



>ref|XP_010663160.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Vitis vinifera]
 ref|XP_010663161.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Vitis vinifera]
Length=287

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  151  SCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            +C+AC+ R  SV++LPCRHLCLC  C+     CP+C  ++++SV+VF+
Sbjct  239  NCRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCRVMKTASVQVFM  286



>gb|AEW09099.1| hypothetical protein CL3803Contig1_04, partial [Pinus radiata]
 gb|AFG55653.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55654.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55655.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55656.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55657.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55658.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55659.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55660.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55661.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55662.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55663.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55664.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55665.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55666.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55667.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55668.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55669.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
 gb|AFG55670.1| hypothetical protein CL3803Contig1_04, partial [Pinus taeda]
Length=59

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  166  LSPGPSCKACRKRIASVVVLPCRHLCLCSACDAVAQACPLCLSVRSSSVEVFL  8
            L    +C+ CR  ++ +++LPCRHLCLC  C+   + CPLC S +++SV+V++
Sbjct  6    LKEQRTCRVCRTNMSCILLLPCRHLCLCKDCEGRLEKCPLCNSAKNASVQVYM  58



Lambda      K        H        a         alpha
   0.317    0.137    0.446    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335