BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003C11 637 bp,

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600966.1|  PREDICTED: uncharacterized protein LOC104096...    312   3e-97   Nicotiana tomentosiformis
ref|XP_009600955.1|  PREDICTED: uncharacterized protein LOC104096...    313   2e-96   Nicotiana tomentosiformis
ref|XP_006361556.1|  PREDICTED: LOW QUALITY PROTEIN: transforming...    310   1e-95   
ref|XP_010321000.1|  PREDICTED: uncharacterized protein LOC101266...    305   2e-95   Solanum lycopersicum
ref|XP_009779161.1|  PREDICTED: uncharacterized protein LOC104228...    307   3e-95   Nicotiana sylvestris
ref|XP_011460453.1|  PREDICTED: uncharacterized protein LOC101303...    306   8e-95   Fragaria vesca subsp. vesca
ref|XP_009779160.1|  PREDICTED: uncharacterized protein LOC104228...    307   2e-94   Nicotiana sylvestris
ref|XP_007024845.1|  Transforming growth factor-beta receptor-ass...    305   4e-94   Theobroma cacao [chocolate]
ref|XP_007024846.1|  Transforming growth factor-beta receptor-ass...    305   5e-94   Theobroma cacao [chocolate]
ref|XP_004239204.1|  PREDICTED: transforming growth factor-beta r...    305   7e-94   Solanum lycopersicum
ref|XP_011460451.1|  PREDICTED: transforming growth factor-beta r...    305   1e-93   Fragaria vesca subsp. vesca
ref|XP_007024844.1|  Transforming growth factor-beta receptor-ass...    305   2e-93   Theobroma cacao [chocolate]
ref|XP_008350678.1|  PREDICTED: uncharacterized protein LOC103414040    290   6e-92   
gb|KDO77488.1|  hypothetical protein CISIN_1g0435721mg                  298   2e-91   Citrus sinensis [Valencia orange]
gb|KJB69956.1|  hypothetical protein B456_011G051400                    296   2e-91   Gossypium raimondii
ref|XP_006448769.1|  hypothetical protein CICLE_v10014143mg             299   3e-91   Citrus clementina
ref|XP_008388246.1|  PREDICTED: uncharacterized protein LOC103450...    290   3e-91   Malus domestica [apple tree]
ref|XP_008388247.1|  PREDICTED: uncharacterized protein LOC103450...    289   4e-91   Malus domestica [apple tree]
ref|XP_008388245.1|  PREDICTED: uncharacterized protein LOC103450...    290   5e-91   Malus domestica [apple tree]
ref|XP_006468420.1|  PREDICTED: transforming growth factor-beta r...    298   6e-91   Citrus sinensis [Valencia orange]
gb|KJB69957.1|  hypothetical protein B456_011G051400                    297   8e-91   Gossypium raimondii
ref|XP_006468419.1|  PREDICTED: transforming growth factor-beta r...    297   1e-90   Citrus sinensis [Valencia orange]
ref|XP_009353909.1|  PREDICTED: transforming growth factor-beta r...    294   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_008383345.1|  PREDICTED: transforming growth factor-beta r...    293   5e-90   Malus domestica [apple tree]
ref|XP_006583505.1|  PREDICTED: transforming growth factor-beta r...    292   1e-89   Glycine max [soybeans]
ref|XP_006576684.1|  PREDICTED: transforming growth factor-beta r...    294   2e-89   Glycine max [soybeans]
ref|XP_009353907.1|  PREDICTED: transforming growth factor-beta r...    293   4e-89   Pyrus x bretschneideri [bai li]
ref|XP_008383344.1|  PREDICTED: transforming growth factor-beta r...    293   6e-89   Malus domestica [apple tree]
ref|XP_008225718.1|  PREDICTED: transforming growth factor-beta r...    291   2e-88   Prunus mume [ume]
ref|XP_006583504.1|  PREDICTED: transforming growth factor-beta r...    291   2e-88   Glycine max [soybeans]
gb|KDP36452.1|  hypothetical protein JCGZ_08582                         290   7e-88   Jatropha curcas
ref|XP_004510243.1|  PREDICTED: transforming growth factor-beta r...    286   1e-87   
gb|EYU19062.1|  hypothetical protein MIMGU_mgv1a000832mg                287   5e-87   Erythranthe guttata [common monkey flower]
ref|XP_004510242.1|  PREDICTED: transforming growth factor-beta r...    286   2e-86   Cicer arietinum [garbanzo]
ref|XP_010645967.1|  PREDICTED: uncharacterized protein LOC100251...    284   3e-86   Vitis vinifera
gb|KCW73504.1|  hypothetical protein EUGRSUZ_E02010                     284   6e-86   Eucalyptus grandis [rose gum]
gb|KEH18118.1|  vacuolar sorting protein 39 domain protein              284   7e-86   Medicago truncatula
ref|XP_002270724.1|  PREDICTED: transforming growth factor-beta r...    284   1e-85   Vitis vinifera
ref|XP_010056709.1|  PREDICTED: transforming growth factor-beta r...    283   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010091724.1|  Transforming growth factor-beta receptor-ass...    283   4e-85   Morus notabilis
ref|XP_007214553.1|  hypothetical protein PRUPE_ppa000766mg             281   7e-85   Prunus persica
emb|CDP17599.1|  unnamed protein product                                280   5e-84   Coffea canephora [robusta coffee]
ref|XP_010534908.1|  PREDICTED: transforming growth factor-beta r...    277   2e-83   Tarenaya hassleriana [spider flower]
ref|XP_010255459.1|  PREDICTED: transforming growth factor-beta r...    272   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006385814.1|  hypothetical protein POPTR_0003s14840g             270   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_009115590.1|  PREDICTED: uncharacterized protein LOC103840...    270   6e-81   Brassica rapa
ref|XP_009115589.1|  PREDICTED: transforming growth factor-beta r...    270   1e-80   Brassica rapa
ref|XP_011022389.1|  PREDICTED: transforming growth factor-beta r...    270   2e-80   Populus euphratica
ref|XP_007134510.1|  hypothetical protein PHAVU_010G053600g             269   2e-80   Phaseolus vulgaris [French bean]
ref|XP_006368804.1|  hypothetical protein POPTR_0001s11570g             268   5e-80   Populus trichocarpa [western balsam poplar]
emb|CDY04778.1|  BnaC05g18110D                                          268   6e-80   Brassica napus [oilseed rape]
ref|XP_011011629.1|  PREDICTED: LOW QUALITY PROTEIN: transforming...    268   7e-80   Populus euphratica
ref|XP_011026984.1|  PREDICTED: LOW QUALITY PROTEIN: transforming...    266   1e-79   Populus euphratica
ref|XP_010477558.1|  PREDICTED: transforming growth factor-beta r...    266   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010498774.1|  PREDICTED: transforming growth factor-beta r...    266   4e-79   Camelina sativa [gold-of-pleasure]
gb|KFK44374.1|  hypothetical protein AALP_AA1G248900                    265   5e-79   Arabis alpina [alpine rockcress]
ref|XP_002890538.1|  hypothetical protein ARALYDRAFT_472531             265   5e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010460053.1|  PREDICTED: transforming growth factor-beta r...    265   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006416148.1|  hypothetical protein EUTSA_v10006692mg             263   1e-78   Eutrema salsugineum
gb|AAB72173.1|  unknown                                                 264   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459073.1|  PREDICTED: transforming growth factor-beta r...    264   1e-78   Cucumis melo [Oriental melon]
ref|NP_173699.5|  vacuolar sorting protein 39                           264   1e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21395.1|  BnaA09g30320D                                          264   2e-78   Brassica napus [oilseed rape]
ref|XP_006416149.1|  hypothetical protein EUTSA_v10006692mg             263   3e-78   Eutrema salsugineum
ref|XP_010687266.1|  PREDICTED: transforming growth factor-beta r...    261   2e-77   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006303895.1|  hypothetical protein CARUB_v10008204mg             260   3e-77   Capsella rubella
ref|XP_002523291.1|  conserved hypothetical protein                     259   8e-77   Ricinus communis
ref|XP_010930302.1|  PREDICTED: vam6/Vps39-like protein isoform X3      252   3e-74   Elaeis guineensis
ref|XP_010930301.1|  PREDICTED: vam6/Vps39-like protein isoform X2      252   3e-74   Elaeis guineensis
ref|XP_010930300.1|  PREDICTED: transforming growth factor-beta r...    252   3e-74   Elaeis guineensis
gb|EPS65966.1|  hypothetical protein M569_08810                         239   2e-72   Genlisea aurea
ref|XP_008801094.1|  PREDICTED: transforming growth factor-beta r...    246   5e-72   Phoenix dactylifera
ref|XP_009401136.1|  PREDICTED: transforming growth factor-beta r...    232   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858739.1|  hypothetical protein AMTR_s00066p00129430          227   3e-65   
gb|KHN10897.1|  Transforming growth factor-beta receptor-associat...    225   1e-64   Glycine soja [wild soybean]
ref|XP_004960592.1|  PREDICTED: transforming growth factor-beta r...    219   9e-63   
gb|EEC78350.1|  hypothetical protein OsI_18103                          218   1e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004960591.1|  PREDICTED: transforming growth factor-beta r...    219   2e-62   Setaria italica
ref|NP_001054400.1|  Os05g0104100                                       219   2e-62   
ref|XP_006653942.1|  PREDICTED: transforming growth factor-beta r...    218   2e-62   Oryza brachyantha
ref|XP_008648684.1|  PREDICTED: transforming growth factor-beta r...    218   3e-62   Zea mays [maize]
ref|XP_003569134.1|  PREDICTED: transforming growth factor-beta r...    215   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_002439096.1|  hypothetical protein SORBIDRAFT_09g000420          213   2e-60   Sorghum bicolor [broomcorn]
dbj|BAK03364.1|  predicted protein                                      212   3e-60   Hordeum vulgare subsp. vulgare [barley]
gb|EMT31210.1|  hypothetical protein F775_11411                         201   1e-56   Aegilops tauschii
ref|XP_010534942.1|  PREDICTED: transforming growth factor-beta r...    202   2e-56   Tarenaya hassleriana [spider flower]
gb|EMS66323.1|  hypothetical protein TRIUR3_01888                       198   1e-55   Triticum urartu
ref|XP_001762235.1|  predicted protein                                  179   3e-48   Physcomitrella patens
ref|XP_002993618.1|  hypothetical protein SELMODRAFT_449189             161   2e-41   Selaginella moellendorffii
ref|XP_002973436.1|  hypothetical protein SELMODRAFT_442094             155   2e-39   Selaginella moellendorffii
gb|KGN66916.1|  hypothetical protein Csa_1G715220                       139   2e-36   Cucumis sativus [cucumbers]
ref|XP_004172009.1|  PREDICTED: uncharacterized protein LOC101228448    141   2e-36   
ref|XP_008459074.1|  PREDICTED: transforming growth factor-beta r...    144   3e-36   Cucumis melo [Oriental melon]
ref|XP_011090061.1|  PREDICTED: transforming growth factor-beta r...    141   2e-35   Sesamum indicum [beniseed]
ref|XP_004145488.1|  PREDICTED: uncharacterized protein LOC101209704    142   9e-35   
gb|KEH18119.1|  vacuolar sorting protein 39 domain protein              137   2e-33   Medicago truncatula
gb|KGN66917.1|  hypothetical protein Csa_1G715230                       122   2e-29   Cucumis sativus [cucumbers]
ref|XP_004150633.1|  PREDICTED: uncharacterized protein LOC101216195    123   2e-28   
gb|KHN12252.1|  Transforming growth factor-beta receptor-associat...    108   7e-24   Glycine soja [wild soybean]
gb|AFW75088.1|  hypothetical protein ZEAMMB73_441101                  85.9    1e-16   Zea mays [maize]
ref|XP_004345885.1|  CNH domain containing protein                    69.3    3e-10   Acanthamoeba castellanii str. Neff



>ref|XP_009600966.1| PREDICTED: uncharacterized protein LOC104096302 isoform X2 [Nicotiana 
tomentosiformis]
Length=847

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S PP MK L KE KVMLM+DNVGVIVD EGQPVGGSLVF EA +++GE+G+ 
Sbjct  238  VIFSLPDSSVPPRMKFLAKECKVMLMVDNVGVIVDNEGQPVGGSLVFGEASETMGEIGAY  297

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            +VV+RNGK+ELYH+KSGNCVQ+V F  EVG+ C+VADE + RGKLVA+A  SK++CY+KV
Sbjct  298  IVVVRNGKLELYHKKSGNCVQQVSFPGEVGSPCVVADEEDGRGKLVAVAAGSKIMCYRKV  357

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++ LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  358  PCEEQIKDLLRKKNFREAISLVEELQNEGEMTRETLSFVHAQVGFLLLFDLHFEEAVDHF  417

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSE M+PSELFPFI R+PNRWSL
Sbjct  418  LLSEIMEPSELFPFITRDPNRWSL  441



>ref|XP_009600955.1| PREDICTED: uncharacterized protein LOC104096302 isoform X1 [Nicotiana 
tomentosiformis]
Length=979

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S PP MK L KE KVMLM+DNVGVIVD EGQPVGGSLVF EA +++GE+G+ 
Sbjct  238  VIFSLPDSSVPPRMKFLAKECKVMLMVDNVGVIVDNEGQPVGGSLVFGEASETMGEIGAY  297

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            +VV+RNGK+ELYH+KSGNCVQ+V F  EVG+ C+VADE + RGKLVA+A  SK++CY+KV
Sbjct  298  IVVVRNGKLELYHKKSGNCVQQVSFPGEVGSPCVVADEEDGRGKLVAVAAGSKIMCYRKV  357

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++ LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  358  PCEEQIKDLLRKKNFREAISLVEELQNEGEMTRETLSFVHAQVGFLLLFDLHFEEAVDHF  417

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSE M+PSELFPFI R+PNRWSL
Sbjct  418  LLSEIMEPSELFPFITRDPNRWSL  441



>ref|XP_006361556.1| PREDICTED: LOW QUALITY PROTEIN: transforming growth factor-beta 
receptor-associated protein 1 homolog [Solanum tuberosum]
Length=948

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P MK+L KE KVMLM+DNVGVIVD+EGQPVGGSLVF EAP+++GE+G+ 
Sbjct  207  VIFSLPDPSVLPRMKLLAKECKVMLMVDNVGVIVDSEGQPVGGSLVFSEAPETMGEIGAY  266

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSGN VQRV    EVG+ C+VADE + RGKLV +AT SKV+CY+KV
Sbjct  267  VVVVRSGKLELYHKKSGNYVQRVQIVGEVGSPCVVADEEDGRGKLVVVATGSKVMCYRKV  326

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++ LSFVHAQVGFLLLFDL F EAVDHF
Sbjct  327  PSEEQIKDLLRKKNFREAISLVEELQNEGEMTRETLSFVHAQVGFLLLFDLRFEEAVDHF  386

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETM+PSELFPFIMR+PNRWSL
Sbjct  387  LLSETMEPSELFPFIMRDPNRWSL  410



>ref|XP_010321000.1| PREDICTED: uncharacterized protein LOC101266820 isoform X2 [Solanum 
lycopersicum]
Length=768

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P MK+L KE KVMLM+DNVGVIVD+EGQPV GSLVF EAP+++GE+G+ 
Sbjct  204  VIFSLPDPSVLPRMKLLAKECKVMLMVDNVGVIVDSEGQPVCGSLVFSEAPETMGEIGAY  263

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSGN VQRV    EVG+ C+VADE + RGKLV +AT SKV+CY+KV
Sbjct  264  VVVVRSGKLELYHKKSGNYVQRVQIVGEVGSPCVVADEEDGRGKLVLVATDSKVMCYRKV  323

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++ LSFVHAQVGFLLLFDL F EA+DHF
Sbjct  324  PSEEQIKDLLRKKNFREAISLVEELQNEGEMTRETLSFVHAQVGFLLLFDLRFEEAIDHF  383

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETM+PSELFPFIMR+PNRWSL
Sbjct  384  LLSETMEPSELFPFIMRDPNRWSL  407



>ref|XP_009779161.1| PREDICTED: uncharacterized protein LOC104228400 isoform X2 [Nicotiana 
sylvestris]
Length=846

 Score =   307 bits (786),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S PP MK L KE KVMLM+DNVGVIVD+EGQPVGGSLVF EA +++GE+G+ 
Sbjct  237  VIFSLPDSSVPPRMKFLAKECKVMLMVDNVGVIVDSEGQPVGGSLVFGEASETMGEIGAY  296

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            +VV+RNGK+ELYH+KSGNC Q+V F  EVG+  +VADE + RGKLV +A  SK++CY+KV
Sbjct  297  IVVVRNGKLELYHKKSGNCGQQVSFPGEVGSPFVVADEEDGRGKLVVVAAGSKIMCYRKV  356

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++MLSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  357  PCEEQIKDLLRKKNFREAISLVEELQNEGEMTREMLSFVHAQVGFLLLFDLHFEEAVDHF  416

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSE M+PSELFPFI R+PNRWSL
Sbjct  417  LLSEIMEPSELFPFITRDPNRWSL  440



>ref|XP_011460453.1| PREDICTED: uncharacterized protein LOC101303970 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=860

 Score =   306 bits (784),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF   PDSIGE+ S 
Sbjct  268  VIFSLPDVSSPPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHRDPDSIGEISSY  327

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV ++GK+ELYH+K+G CVQ V F  E VG  CIVADE +  GKL+ +AT +KVICY+K
Sbjct  328  VVVAKDGKMELYHKKTGRCVQMVTFGGEGVGGPCIVADEEDGSGKLIVVATPTKVICYRK  387

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL++EL  EGE++KDMLSFVHAQVGFLLLFDLHF EAVDH
Sbjct  388  LPSEEQIKDLLRKKNFKEAISLVEELECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVDH  447

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  448  FLQSETMQPSEVFPFIMRDPNRWSL  472



>ref|XP_009779160.1| PREDICTED: uncharacterized protein LOC104228400 isoform X1 [Nicotiana 
sylvestris]
Length=978

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S PP MK L KE KVMLM+DNVGVIVD+EGQPVGGSLVF EA +++GE+G+ 
Sbjct  237  VIFSLPDSSVPPRMKFLAKECKVMLMVDNVGVIVDSEGQPVGGSLVFGEASETMGEIGAY  296

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            +VV+RNGK+ELYH+KSGNC Q+V F  EVG+  +VADE + RGKLV +A  SK++CY+KV
Sbjct  297  IVVVRNGKLELYHKKSGNCGQQVSFPGEVGSPFVVADEEDGRGKLVVVAAGSKIMCYRKV  356

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++MLSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  357  PCEEQIKDLLRKKNFREAISLVEELQNEGEMTREMLSFVHAQVGFLLLFDLHFEEAVDHF  416

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSE M+PSELFPFI R+PNRWSL
Sbjct  417  LLSEIMEPSELFPFITRDPNRWSL  440



>ref|XP_007024845.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 2 [Theobroma cacao]
 gb|EOY27467.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 2 [Theobroma cacao]
Length=895

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREA-PDSIGELGS  178
            ++FSLPDLS PPL+K+L +EWKV+L++DNVGV+VDA GQPVGGSLVFR+  PDS+GEL S
Sbjct  252  VIFSLPDLSRPPLLKLLWREWKVLLLVDNVGVVVDALGQPVGGSLVFRKGGPDSVGELSS  311

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
              VV+R+GK+ELYH+KSGNC+Q V F  E   +CIVADE N  G++VA+AT +KVICY+K
Sbjct  312  YAVVVRDGKMELYHKKSGNCIQTVTFGVEGVGQCIVADEENRSGEVVAVATPTKVICYRK  371

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKKN  EA+SL++EL  EGE++K+MLS  HAQVGFLLLFDLHF EAVDH
Sbjct  372  VPSEEQIKDLLRKKNFKEAISLVEELECEGEMSKEMLSLFHAQVGFLLLFDLHFEEAVDH  431

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  432  FLQSETMQPSEVFPFIMRDPNRWSL  456



>ref|XP_007024846.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 3 [Theobroma cacao]
 gb|EOY27468.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 3 [Theobroma cacao]
Length=890

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREA-PDSIGELGS  178
            ++FSLPDLS PPL+K+L +EWKV+L++DNVGV+VDA GQPVGGSLVFR+  PDS+GEL S
Sbjct  252  VIFSLPDLSRPPLLKLLWREWKVLLLVDNVGVVVDALGQPVGGSLVFRKGGPDSVGELSS  311

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
              VV+R+GK+ELYH+KSGNC+Q V F  E   +CIVADE N  G++VA+AT +KVICY+K
Sbjct  312  YAVVVRDGKMELYHKKSGNCIQTVTFGVEGVGQCIVADEENRSGEVVAVATPTKVICYRK  371

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKKN  EA+SL++EL  EGE++K+MLS  HAQVGFLLLFDLHF EAVDH
Sbjct  372  VPSEEQIKDLLRKKNFKEAISLVEELECEGEMSKEMLSLFHAQVGFLLLFDLHFEEAVDH  431

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  432  FLQSETMQPSEVFPFIMRDPNRWSL  456



>ref|XP_004239204.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Solanum lycopersicum]
Length=945

 Score =   305 bits (781),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P MK+L KE KVMLM+DNVGVIVD+EGQPV GSLVF EAP+++GE+G+ 
Sbjct  204  VIFSLPDPSVLPRMKLLAKECKVMLMVDNVGVIVDSEGQPVCGSLVFSEAPETMGEIGAY  263

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSGN VQRV    EVG+ C+VADE + RGKLV +AT SKV+CY+KV
Sbjct  264  VVVVRSGKLELYHKKSGNYVQRVQIVGEVGSPCVVADEEDGRGKLVLVATDSKVMCYRKV  323

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL NEGE+T++ LSFVHAQVGFLLLFDL F EA+DHF
Sbjct  324  PSEEQIKDLLRKKNFREAISLVEELQNEGEMTRETLSFVHAQVGFLLLFDLRFEEAIDHF  383

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETM+PSELFPFIMR+PNRWSL
Sbjct  384  LLSETMEPSELFPFIMRDPNRWSL  407



>ref|XP_011460451.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011460452.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Fragaria vesca subsp. vesca]
Length=1010

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF   PDSIGE+ S 
Sbjct  268  VIFSLPDVSSPPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHRDPDSIGEISSY  327

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV ++GK+ELYH+K+G CVQ V F  E VG  CIVADE +  GKL+ +AT +KVICY+K
Sbjct  328  VVVAKDGKMELYHKKTGRCVQMVTFGGEGVGGPCIVADEEDGSGKLIVVATPTKVICYRK  387

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL++EL  EGE++KDMLSFVHAQVGFLLLFDLHF EAVDH
Sbjct  388  LPSEEQIKDLLRKKNFKEAISLVEELECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVDH  447

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  448  FLQSETMQPSEVFPFIMRDPNRWSL  472



>ref|XP_007024844.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 1 [Theobroma cacao]
 gb|EOY27466.1| Transforming growth factor-beta receptor-associated protein 1 
isoform 1 [Theobroma cacao]
Length=994

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREA-PDSIGELGS  178
            ++FSLPDLS PPL+K+L +EWKV+L++DNVGV+VDA GQPVGGSLVFR+  PDS+GEL S
Sbjct  252  VIFSLPDLSRPPLLKLLWREWKVLLLVDNVGVVVDALGQPVGGSLVFRKGGPDSVGELSS  311

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
              VV+R+GK+ELYH+KSGNC+Q V F  E   +CIVADE N  G++VA+AT +KVICY+K
Sbjct  312  YAVVVRDGKMELYHKKSGNCIQTVTFGVEGVGQCIVADEENRSGEVVAVATPTKVICYRK  371

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKKN  EA+SL++EL  EGE++K+MLS  HAQVGFLLLFDLHF EAVDH
Sbjct  372  VPSEEQIKDLLRKKNFKEAISLVEELECEGEMSKEMLSLFHAQVGFLLLFDLHFEEAVDH  431

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  432  FLQSETMQPSEVFPFIMRDPNRWSL  456



>ref|XP_008350678.1| PREDICTED: uncharacterized protein LOC103414040 [Malus domestica]
Length=517

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD    P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDACSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSDLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFD-DEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  +EVG  CIVADE +  GKL+ +AT +K++CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEEVGGPCIVADEEDGSGKLLVVATPTKIVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>gb|KDO77488.1| hypothetical protein CISIN_1g0435721mg, partial [Citrus sinensis]
Length=910

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PP++K+L KE KV+L++DNVGV VDA GQPVGGSLVFR++PD++GEL   
Sbjct  257  VIFTLPDVSCPPMLKLLSKEQKVLLLVDNVGVFVDAHGQPVGGSLVFRKSPDAVGELSMY  316

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R GK+ELYH+KSG CVQ V F  E G +CI  DE    GKL+ +AT +KVICYQKV
Sbjct  317  VVVLRGGKMELYHKKSGICVQAVTFGGEGGGQCIATDEECGAGKLLVVATPTKVICYQKV  376

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL +EL  EGE+ K+MLSFVHAQ+GFLLLFDLHF EAVDHF
Sbjct  377  PSEEQIKDLLRKKDFKEAISLAEELECEGEMAKEMLSFVHAQIGFLLLFDLHFEEAVDHF  436

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  437  LHSETMQPSEVFPFIMRDPNRWSL  460



>gb|KJB69956.1| hypothetical protein B456_011G051400 [Gossypium raimondii]
Length=799

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREA-PDSIGELGS  178
            ++FSLPDLS PPL+K+L + W+V+L++DNVGVIVDA GQPVGGSLVFR+  PDSIG+L S
Sbjct  58   VIFSLPDLSRPPLLKLLWRNWEVLLLVDNVGVIVDALGQPVGGSLVFRKGGPDSIGDLSS  117

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
             VVV+R+GK++LYH+KSGNC+Q + F  E   +CIVADE N  G+  A+AT +KVICY+K
Sbjct  118  YVVVVRDGKMDLYHKKSGNCIQTLTFGVEGVGQCIVADEENRSGEFAAVATPTKVICYRK  177

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKKN  EA+SL++EL  EGE++K++LS  HAQVGFLLLFDLHF EAVDH
Sbjct  178  VPSEEQIKDLLRKKNFNEAISLVEELECEGELSKEVLSLFHAQVGFLLLFDLHFKEAVDH  237

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  238  FLRSETMQPSEVFPFIMRDPNRWSL  262



>ref|XP_006448769.1| hypothetical protein CICLE_v10014143mg [Citrus clementina]
 gb|ESR62009.1| hypothetical protein CICLE_v10014143mg [Citrus clementina]
Length=997

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PP++K+L KE KV+L++DNVGV VDA GQPVGGSLVFR++PD++GEL   
Sbjct  257  VIFTLPDVSCPPMLKLLSKEQKVLLLVDNVGVFVDAHGQPVGGSLVFRKSPDAVGELSMY  316

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R GK+ELYH+KSG CVQ V F  E G +CI ADE    GKL+ +AT +KVICYQKV
Sbjct  317  VVVLRGGKMELYHKKSGICVQAVTFGGEGGGQCIAADEECGAGKLLVVATPTKVICYQKV  376

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL +EL  EGE+ K+MLSFVHAQ+GFLLLFDLHF EAVDHF
Sbjct  377  PSEEQIKDLLRKKDFKEAISLAEELDCEGEMAKEMLSFVHAQIGFLLLFDLHFEEAVDHF  436

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  437  LHSETMQPSEVFPFIMRDPNRWSL  460



>ref|XP_008388246.1| PREDICTED: uncharacterized protein LOC103450659 isoform X2 [Malus 
domestica]
Length=593

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD    P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDACSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSDLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFD-DEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  +EVG  CIVADE +  GKL+ +AT +K++CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEEVGGPCIVADEEDGSGKLLVVATPTKIVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>ref|XP_008388247.1| PREDICTED: uncharacterized protein LOC103450659 isoform X3 [Malus 
domestica]
Length=554

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD    P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDACSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSDLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFD-DEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  +EVG  CIVADE +  GKL+ +AT +K++CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEEVGGPCIVADEEDGSGKLLVVATPTKIVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>ref|XP_008388245.1| PREDICTED: uncharacterized protein LOC103450659 isoform X1 [Malus 
domestica]
Length=611

 Score =   290 bits (743),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD    P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDACSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSDLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFD-DEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  +EVG  CIVADE +  GKL+ +AT +K++CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEEVGGPCIVADEEDGSGKLLVVATPTKIVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>ref|XP_006468420.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Citrus sinensis]
Length=997

 Score =   298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PP++K+L KE KV+L++DNVGV VDA GQPVGGSLVFR++PD++GEL   
Sbjct  257  VIFTLPDVSCPPMLKLLSKEQKVLLLVDNVGVFVDAHGQPVGGSLVFRKSPDAVGELSMY  316

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R GK+ELYH+KSG CVQ V F  E G +CI  DE    GKL+ +AT +KVICYQKV
Sbjct  317  VVVLRGGKMELYHKKSGICVQAVTFGGEGGGQCIATDEECGAGKLLVVATPTKVICYQKV  376

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL +EL  EGE+ K+MLSFVHAQ+GFLLLFDLHF EAVDHF
Sbjct  377  PSEEQIKDLLRKKDFKEAISLAEELECEGEMAKEMLSFVHAQIGFLLLFDLHFEEAVDHF  436

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  437  LHSETMQPSEVFPFIMRDPNRWSL  460



>gb|KJB69957.1| hypothetical protein B456_011G051400 [Gossypium raimondii]
Length=965

 Score =   297 bits (761),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREA-PDSIGELGS  178
            ++FSLPDLS PPL+K+L + W+V+L++DNVGVIVDA GQPVGGSLVFR+  PDSIG+L S
Sbjct  224  VIFSLPDLSRPPLLKLLWRNWEVLLLVDNVGVIVDALGQPVGGSLVFRKGGPDSIGDLSS  283

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
             VVV+R+GK++LYH+KSGNC+Q + F  E   +CIVADE N  G+  A+AT +KVICY+K
Sbjct  284  YVVVVRDGKMDLYHKKSGNCIQTLTFGVEGVGQCIVADEENRSGEFAAVATPTKVICYRK  343

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKKN  EA+SL++EL  EGE++K++LS  HAQVGFLLLFDLHF EAVDH
Sbjct  344  VPSEEQIKDLLRKKNFNEAISLVEELECEGELSKEVLSLFHAQVGFLLLFDLHFKEAVDH  403

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  404  FLRSETMQPSEVFPFIMRDPNRWSL  428



>ref|XP_006468419.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Citrus sinensis]
Length=1006

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PP++K+L KE KV+L++DNVGV VDA GQPVGGSLVFR++PD++GEL   
Sbjct  257  VIFTLPDVSCPPMLKLLSKEQKVLLLVDNVGVFVDAHGQPVGGSLVFRKSPDAVGELSMY  316

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R GK+ELYH+KSG CVQ V F  E G +CI  DE    GKL+ +AT +KVICYQKV
Sbjct  317  VVVLRGGKMELYHKKSGICVQAVTFGGEGGGQCIATDEECGAGKLLVVATPTKVICYQKV  376

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL +EL  EGE+ K+MLSFVHAQ+GFLLLFDLHF EAVDHF
Sbjct  377  PSEEQIKDLLRKKDFKEAISLAEELECEGEMAKEMLSFVHAQIGFLLLFDLHFEEAVDHF  436

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  437  LHSETMQPSEVFPFIMRDPNRWSL  460



>ref|XP_009353909.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X2 [Pyrus x bretschneideri]
Length=855

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S  P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDVSSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSNLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  E VG  CIVADE +  GKL+ +AT +KV+CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEGVGGPCIVADEEDGSGKLLVVATPTKVVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>ref|XP_008383345.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Malus domestica]
Length=855

 Score =   293 bits (751),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S  P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDVSSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSNLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  E VG  CIVADE +  GKL+ +AT +KV+CYQK
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEGVGGPCIVADEQDGSGKLLVVATPTKVVCYQK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLL KKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLXKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEIFPFIMRDPNRWSL  468



>ref|XP_006583505.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Glycine max]
Length=829

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KEW+V+L++DNVGVIVD  GQPVGGSLVFR   D +GE+ S 
Sbjct  264  VIFSLPDVSRPPRLKLLHKEWRVLLLVDNVGVIVDPHGQPVGGSLVFRHGLDLVGEIDSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ELYH++   CVQ +PF  E   +C+VA E +  G+LVA+AT++KV+CYQK+
Sbjct  324  VVVVSDGKIELYHKRHCGCVQVLPFGGEGVGRCVVASEEDRGGRLVAVATATKVVCYQKL  383

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+SL++EL +EGE++KD+LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  384  PSVEQIKDLLRKKNYKGAISLVEELESEGEMSKDLLSFVHAQVGFLLLFDLHFKEAVDHF  443

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETMQPSE+FPFIMR+PNRWSL
Sbjct  444  LLSETMQPSEVFPFIMRDPNRWSL  467



>ref|XP_006576684.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Glycine max]
Length=1000

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KEW+V+L++DNVGVIVD  GQPVGGSLVFR   DS+GE+ S 
Sbjct  260  VIFSLPDVSWPPRLKLLHKEWRVLLLVDNVGVIVDPHGQPVGGSLVFRHGLDSMGEIDSY  319

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ LYH++ G CVQ +PF  E   +C+VA E +  G+LVA+AT++KV+CYQK+
Sbjct  320  VVVVSDGKIGLYHKRHGGCVQVLPFGGEGVGRCVVASEEDKGGRLVAVATATKVVCYQKL  379

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+SL++EL +EGE++KD+LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  380  PSVEQIKDLLRKKNYKGAISLVEELESEGEMSKDLLSFVHAQVGFLLLFDLHFKEAVDHF  439

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETMQPSE+FPFIMR+PNRWSL
Sbjct  440  LLSETMQPSEVFPFIMRDPNRWSL  463



>ref|XP_009353907.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353908.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Pyrus x bretschneideri]
Length=1006

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S  P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDVSSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSNLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  E VG  CIVADE +  GKL+ +AT +KV+CY+K
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEGVGGPCIVADEEDGSGKLLVVATPTKVVCYRK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLRKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEVFPFIMRDPNRWSL  468



>ref|XP_008383344.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Malus domestica]
Length=1006

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S  P +K+LCKEW V+L++DNVG+I +A GQPVGGSLVF    DSIGE+ S 
Sbjct  264  VIFSLPDVSSLPRLKLLCKEWNVLLLVDNVGIIANAHGQPVGGSLVFHSNLDSIGEISSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV+ R+GK+ELYH+K+G C+Q + F  E VG  CIVADE +  GKL+ +AT +KV+CYQK
Sbjct  324  VVIARDGKLELYHKKTGRCIQMITFGGEGVGGPCIVADEQDGSGKLLVVATPTKVVCYQK  383

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLL KKN  EA+SL+++L  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  384  LPSEEQIKDLLXKKNFKEAISLVEDLECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  443

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPFIMR+PNRWSL
Sbjct  444  FLQSETMQPSEIFPFIMRDPNRWSL  468



>ref|XP_008225718.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Prunus mume]
 ref|XP_008225719.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Prunus mume]
Length=1009

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P +K+LCKEW ++L++DNVG+I +A GQPVGGSLVF   PDSIGE+ S 
Sbjct  267  VIFSLPDGSSLPRLKLLCKEWNLLLLVDNVGIIANAHGQPVGGSLVFHSNPDSIGEITSY  326

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV R+GK+ELYH+K+G C+Q V F  E VG  C+VADE +  G LV +AT +KV+C++K
Sbjct  327  VVVARDGKLELYHKKTGTCIQMVTFGGEGVGGPCVVADEEDRTGNLVVVATPTKVVCFRK  386

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL++EL  EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  387  LPSEEQIKDLLRKKNFKEAISLVEELECEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  446

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE MQPSE+FPFIMR+PNRWSL
Sbjct  447  FLQSEAMQPSEVFPFIMRDPNRWSL  471



>ref|XP_006583504.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Glycine max]
Length=1004

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KEW+V+L++DNVGVIVD  GQPVGGSLVFR   D +GE+ S 
Sbjct  264  VIFSLPDVSRPPRLKLLHKEWRVLLLVDNVGVIVDPHGQPVGGSLVFRHGLDLVGEIDSY  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ELYH++   CVQ +PF  E   +C+VA E +  G+LVA+AT++KV+CYQK+
Sbjct  324  VVVVSDGKIELYHKRHCGCVQVLPFGGEGVGRCVVASEEDRGGRLVAVATATKVVCYQKL  383

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+SL++EL +EGE++KD+LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  384  PSVEQIKDLLRKKNYKGAISLVEELESEGEMSKDLLSFVHAQVGFLLLFDLHFKEAVDHF  443

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETMQPSE+FPFIMR+PNRWSL
Sbjct  444  LLSETMQPSEVFPFIMRDPNRWSL  467



>gb|KDP36452.1| hypothetical protein JCGZ_08582 [Jatropha curcas]
Length=1018

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KE KV++++DNVG+IV+  GQPVGGSLVFR +PDSIGEL S 
Sbjct  277  VIFSLPDISSPPQLKLLWKEKKVLMLVDNVGIIVNEHGQPVGGSLVFRGSPDSIGELSSY  336

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VV++R+GK+ELY+++SGNC+Q +    E    CI+A E +  G++VA+AT++KVICY +V
Sbjct  337  VVLVRDGKMELYNKRSGNCIQTIILGGEGVGPCILASEDSGNGQIVAVATTTKVICYHEV  396

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+SL++EL +EGEI+ +MLSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  397  PSEEQIKDLLRKKNFREAISLVEELKSEGEISNEMLSFVHAQVGFLLLFDLHFEEAVNHF  456

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  457  LQSETMQPSEVFPFIMRDPNRWSL  480



>ref|XP_004510243.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Cicer arietinum]
Length=834

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L +EW+V+L++DNVGVIVD +GQPVGGSLVFR    S+GEL   
Sbjct  258  VIFSLPDVSRPPRLKLLHREWRVLLLVDNVGVIVDVQGQPVGGSLVFRHGLQSVGELSFY  317

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ELY++K+G C Q +PF  E    C+VA E +  GK+VA+AT++KV+CYQK+
Sbjct  318  VVVVSDGKIELYNKKNGVCAQVLPFGGEGIGPCVVASEEDKSGKIVAVATATKVVCYQKL  377

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+ L++EL +EGE++KD+LSF+HAQVGFLLLFDLHF EAVDHF
Sbjct  378  PSVEQIKDLLRKKNYKGAICLVEELESEGEMSKDLLSFIHAQVGFLLLFDLHFEEAVDHF  437

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLS+TMQPSE+FPFIMR+PNRWSL
Sbjct  438  LLSDTMQPSEIFPFIMRDPNRWSL  461



>gb|EYU19062.1| hypothetical protein MIMGU_mgv1a000832mg [Erythranthe guttata]
Length=969

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+FSLPD SG P +K+L KE  ++LM+DNVG+IVD EGQPVGGSLVF+E PDS  E+GS 
Sbjct  225  LIFSLPDSSGMPRLKLLVKESNMLLMVDNVGIIVDIEGQPVGGSLVFKETPDSFREIGSY  284

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VV  RN  VELYH+K G CVQR    +  G  C++ADE N+ G LV +ATS K+ICY KV
Sbjct  285  VVATRNSAVELYHKKIGCCVQRFVVGNGGGGPCLLADEENESGNLVVVATSLKLICYGKV  344

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
              E QIKD+LRKK+  EA+SL+ EL NEGE+TK+MLSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  345  SEEAQIKDMLRKKSFKEAMSLVKELENEGEMTKEMLSFVHAQVGFLLLFDLHFKEAVDHF  404

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSE MQPSELFPFIMR+PNRW+L
Sbjct  405  LLSENMQPSELFPFIMRDPNRWTL  428



>ref|XP_004510242.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Cicer arietinum]
Length=997

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L +EW+V+L++DNVGVIVD +GQPVGGSLVFR    S+GEL   
Sbjct  258  VIFSLPDVSRPPRLKLLHREWRVLLLVDNVGVIVDVQGQPVGGSLVFRHGLQSVGELSFY  317

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ELY++K+G C Q +PF  E    C+VA E +  GK+VA+AT++KV+CYQK+
Sbjct  318  VVVVSDGKIELYNKKNGVCAQVLPFGGEGIGPCVVASEEDKSGKIVAVATATKVVCYQKL  377

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+ L++EL +EGE++KD+LSF+HAQVGFLLLFDLHF EAVDHF
Sbjct  378  PSVEQIKDLLRKKNYKGAICLVEELESEGEMSKDLLSFIHAQVGFLLLFDLHFEEAVDHF  437

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLS+TMQPSE+FPFIMR+PNRWSL
Sbjct  438  LLSDTMQPSEIFPFIMRDPNRWSL  461



>ref|XP_010645967.1| PREDICTED: uncharacterized protein LOC100251277 isoform X2 [Vitis 
vinifera]
Length=885

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            +LFSLPD +  P +K+L KE KV+L++DNVG+IV+A GQPVGGSLVFR  PDS+GE+ S 
Sbjct  270  VLFSLPDPTSMPHLKLLRKEHKVLLLVDNVGIIVNAYGQPVGGSLVFRHFPDSVGEISSY  329

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV  +GK+ELYH+KSG C+Q      E     +VAD  +  G LV +AT SKVICY+KV
Sbjct  330  VVVASDGKMELYHKKSGVCIQMASVAAEGSGMSVVADAEDASGNLVVVATPSKVICYRKV  389

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA++L++EL +EGE+TK+MLSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  390  PSEEQIKDLLRKKNFKEAITLVEELESEGEMTKEMLSFVHAQVGFLLLFDLHFEEAVDHF  449

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  450  LQSETMQPSEIFPFIMRDPNRWSL  473



>gb|KCW73504.1| hypothetical protein EUGRSUZ_E02010 [Eucalyptus grandis]
Length=941

 Score =   284 bits (726),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P +K+L KEWKV+L++DNVGVIVD+ GQP GGSLVFR   +S+ E+ S 
Sbjct  275  VIFSLPDGSSSPRLKLLRKEWKVLLLVDNVGVIVDSYGQPAGGSLVFRRGLESVAEVSSY  334

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            V+V+++GK+++YH+KSG+C+Q  PF  E    C VADE N  G LV +A+ SKV CY+KV
Sbjct  335  VMVVKDGKMDVYHKKSGSCIQTPPFAGEGVGPCFVADEENANGNLVVVASPSKVFCYRKV  394

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL++EL +EGE++KDMLSFVHAQVGFLLLFDLHF +AV+HF
Sbjct  395  PSEEQIKDLLRKKSFNEAISLVEELESEGEMSKDMLSFVHAQVGFLLLFDLHFEQAVNHF  454

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SE MQPSE+FPFIMR+PNRWSL
Sbjct  455  LQSEIMQPSEVFPFIMRDPNRWSL  478



>gb|KEH18118.1| vacuolar sorting protein 39 domain protein [Medicago truncatula]
Length=985

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L ++W+V+L++DNVG+IVD +GQPVGGSLVFR   DS+GEL   
Sbjct  245  VIFSLPDVSRPPRLKLLYRDWRVLLLVDNVGIIVDEKGQPVGGSLVFRRGLDSVGELSFY  304

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GKVELY++K+G CVQ + F  E    C+VA E +  GKLVA+AT++KV+CY+K+
Sbjct  305  VVVVSDGKVELYNKKNGGCVQVLAFGGEGIGPCVVASEEDKGGKLVAVATATKVVCYRKL  364

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  DQIKDLLRKKN   A+SL++EL  EGE++ ++LSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  365  PSVDQIKDLLRKKNYKGAISLVEELEYEGEMSNELLSFVHAQVGFLLLFDLHFEEAVNHF  424

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETMQPSE+FPFIMR+PNRWSL
Sbjct  425  LLSETMQPSEIFPFIMRDPNRWSL  448



>ref|XP_002270724.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Vitis vinifera]
 emb|CBI20547.3| unnamed protein product [Vitis vinifera]
Length=1011

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            +LFSLPD +  P +K+L KE KV+L++DNVG+IV+A GQPVGGSLVFR  PDS+GE+ S 
Sbjct  270  VLFSLPDPTSMPHLKLLRKEHKVLLLVDNVGIIVNAYGQPVGGSLVFRHFPDSVGEISSY  329

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV  +GK+ELYH+KSG C+Q      E     +VAD  +  G LV +AT SKVICY+KV
Sbjct  330  VVVASDGKMELYHKKSGVCIQMASVAAEGSGMSVVADAEDASGNLVVVATPSKVICYRKV  389

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA++L++EL +EGE+TK+MLSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  390  PSEEQIKDLLRKKNFKEAITLVEELESEGEMTKEMLSFVHAQVGFLLLFDLHFEEAVDHF  449

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  450  LQSETMQPSEIFPFIMRDPNRWSL  473



>ref|XP_010056709.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Eucalyptus grandis]
 gb|KCW73503.1| hypothetical protein EUGRSUZ_E02010 [Eucalyptus grandis]
Length=1016

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD S  P +K+L KEWKV+L++DNVGVIVD+ GQP GGSLVFR   +S+ E+ S 
Sbjct  275  VIFSLPDGSSSPRLKLLRKEWKVLLLVDNVGVIVDSYGQPAGGSLVFRRGLESVAEVSSY  334

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            V+V+++GK+++YH+KSG+C+Q  PF  E    C VADE N  G LV +A+ SKV CY+KV
Sbjct  335  VMVVKDGKMDVYHKKSGSCIQTPPFAGEGVGPCFVADEENANGNLVVVASPSKVFCYRKV  394

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKK+  EA+SL++EL +EGE++KDMLSFVHAQVGFLLLFDLHF +AV+HF
Sbjct  395  PSEEQIKDLLRKKSFNEAISLVEELESEGEMSKDMLSFVHAQVGFLLLFDLHFEQAVNHF  454

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SE MQPSE+FPFIMR+PNRWSL
Sbjct  455  LQSEIMQPSEVFPFIMRDPNRWSL  478



>ref|XP_010091724.1| Transforming growth factor-beta receptor-associated protein 1-like 
protein [Morus notabilis]
 gb|EXB45087.1| Transforming growth factor-beta receptor-associated protein 1-like 
protein [Morus notabilis]
Length=1071

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L +EW V+L++DNVGVIV+A GQPV GS+VFR   DSIGE+   
Sbjct  328  VIFSLPDVSHPPRLKLLSREWNVLLLVDNVGVIVNAHGQPVAGSIVFRHGLDSIGEISLY  387

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV+R+GK++LYH+KS  CVQ V F  E VG  CIVAD  +   KLV +AT  KVICYQK
Sbjct  388  VVVVRDGKMDLYHKKSATCVQTVAFGGEAVGGPCIVADGEDGNRKLVVVATPGKVICYQK  447

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            + PE+QIKDLLRKKN  EA+SL +EL  EGE+TKD+LSF+HAQ GFLLLF LHF EAV+H
Sbjct  448  LTPEEQIKDLLRKKNFKEAISLAEELECEGEMTKDVLSFIHAQAGFLLLFGLHFEEAVNH  507

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SETMQPSE+FPF+MR+PNRWSL
Sbjct  508  FLQSETMQPSEIFPFVMRDPNRWSL  532



>ref|XP_007214553.1| hypothetical protein PRUPE_ppa000766mg [Prunus persica]
 gb|EMJ15752.1| hypothetical protein PRUPE_ppa000766mg [Prunus persica]
Length=1009

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD SG P +K+LCKEW ++L++DNVG+I +A GQPVGGSLVF   PDSIGE+ S 
Sbjct  267  VIFSLPDGSGLPRLKLLCKEWNLLLLVDNVGIIANAHGQPVGGSLVFHSKPDSIGEISSY  326

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV R+GK+ELYH+K+G C+Q V F  E VG  C+VADE +  G LV +AT +KV+C++K
Sbjct  327  VVVARDGKLELYHKKTGTCIQMVTFGGEGVGGPCVVADEEDRTGNLVVVATPTKVVCFRK  386

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P E+QIKDLLRKKN  EA+SL++EL +EGE++KDMLSFVHAQVGFLLLFDLHF EAV+H
Sbjct  387  LPSEEQIKDLLRKKNFKEAISLVEELESEGELSKDMLSFVHAQVGFLLLFDLHFEEAVNH  446

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE MQPSE+FPFIMR+PNRWSL
Sbjct  447  FLQSEAMQPSEVFPFIMRDPNRWSL  471



>emb|CDP17599.1| unnamed protein product [Coffea canephora]
Length=1112

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+FSLP+LSG P +K+L +E +V+L++DNVGV VD EGQPVGGSLVFR  PDSIGE+GS 
Sbjct  392  LIFSLPELSGQPQLKLLVRECRVLLLVDNVGVTVDTEGQPVGGSLVFRGVPDSIGEIGSH  451

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFD-DEVGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV ++NGK+ELY++KSGNCVQ V    D  G  C+VA + +  G+ VA++ SSKVI Y+K
Sbjct  452  VVAVKNGKMELYYKKSGNCVQVVMLSSDAGGGTCVVASQEDVSGEFVAVSMSSKVIFYRK  511

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL +EGE+TK+ LSF+HAQVGFLLLFDL F EAV+H
Sbjct  512  VPWEEQIKDLLRKKCFKEAISLVEELQSEGELTKETLSFIHAQVGFLLLFDLQFEEAVNH  571

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FLLSETMQPSELFPFIMR+PN WSL
Sbjct  572  FLLSETMQPSELFPFIMRDPNPWSL  596



>ref|XP_010534908.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010534916.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010534923.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010534933.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Tarenaya hassleriana]
Length=986

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SG PL+K+LCKEWKV+L++DNVGVIVDA GQPVGGSLVFR  PDS+GEL   
Sbjct  246  MIFALPDVSGSPLLKLLCKEWKVLLLVDNVGVIVDANGQPVGGSLVFRRRPDSVGELCID  305

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VV + +GK+E+Y + +G CVQ V F  E   + ++A E +  G +VA+A+ SK+I YQKV
Sbjct  306  VVAVGDGKMEIYQKNTGICVQSVTFGPEGCGQSVLAAEESGNGSIVAVASLSKLIFYQKV  365

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
              E+QIKDLLRKKN  EA+SL++EL  EGEI+K+MLSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  366  AYEEQIKDLLRKKNYREAISLVEELDLEGEISKEMLSFVHAQVGFLLLFDLHFEEAVNHF  425

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SE MQPSE+FPFIMR+PNRWSL
Sbjct  426  LRSERMQPSEVFPFIMRDPNRWSL  449



>ref|XP_010255459.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Nelumbo nucifera]
Length=1059

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +FSLPD S PP +K L K+  V+L +DNVG+IV+A GQPVGGSLVFR  PDS+GE+ S V
Sbjct  319  MFSLPDSSSPPCLKCLLKDHNVLLFVDNVGIIVNAFGQPVGGSLVFRNLPDSVGEISSHV  378

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V++ G+++LYH+++  C+Q + F  E    C+VA+E +  G+LV +AT SK ICY+KV 
Sbjct  379  IVVKGGRMDLYHKRTSLCIQSLSFAGEGVGPCLVANEESRTGELVVVATPSKAICYRKVS  438

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
             E+QIKDLLRKKN  +A+SL++EL  +GE+TK+MLSFVHAQVGFLLLFDLHF EA++HFL
Sbjct  439  AEEQIKDLLRKKNFKDAISLVEELECDGEMTKEMLSFVHAQVGFLLLFDLHFEEAINHFL  498

Query  545  LSETMQPSELFPFIMREPNRWSL  613
            LSETM+PSE+FPFIMR+PNRWSL
Sbjct  499  LSETMEPSEVFPFIMRDPNRWSL  521



>ref|XP_006385814.1| hypothetical protein POPTR_0003s14840g [Populus trichocarpa]
 gb|ERP63611.1| hypothetical protein POPTR_0003s14840g [Populus trichocarpa]
Length=885

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S  PL+K+L KE KV+L++DNVG++VDA GQPVGGSLVFR+ PDS+GEL S 
Sbjct  228  VIFTLPDVSCLPLLKLLWKEKKVLLLVDNVGIVVDAHGQPVGGSLVFRKGPDSVGELASY  287

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            V+V+R+GK+ELYH+K G CVQ V F  E    CIVADE +  GKLVA+AT +KVI Y++V
Sbjct  288  VMVVRDGKMELYHKKLGGCVQTVSFGSEGFGPCIVADEESGNGKLVAVATPTKVIFYRRV  347

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EAVSL++EL ++GEI+ +MLSFVHAQ+GFLLLFDLHF EAV+HF
Sbjct  348  PTEEQIKDLLRKKNFKEAVSLVEELKSDGEISNEMLSFVHAQIGFLLLFDLHFEEAVNHF  407

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  408  LQSETMQPSEVFPFIMRDPNRWSL  431



>ref|XP_009115590.1| PREDICTED: uncharacterized protein LOC103840821 isoform X2 [Brassica 
rapa]
Length=933

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQPVGGSLVFR  PDS+GEL   
Sbjct  246  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPVGGSLVFRRRPDSVGELSFY  305

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+EL+ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SKVI Y++
Sbjct  306  LVTVGDGKMELHQKKSGACVQSVSFGPEGCGPSVLAVDEAGD-GNLLAVTTMSKVIFYRR  364

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  365  VPYEEQIKDLLRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  424

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE+M+PSE+FPFIMR+PNRWSL
Sbjct  425  FLKSESMEPSEVFPFIMRDPNRWSL  449



>ref|XP_009115589.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Brassica rapa]
Length=987

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQPVGGSLVFR  PDS+GEL   
Sbjct  246  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPVGGSLVFRRRPDSVGELSFY  305

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+EL+ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SKVI Y++
Sbjct  306  LVTVGDGKMELHQKKSGACVQSVSFGPEGCGPSVLAVDEAGD-GNLLAVTTMSKVIFYRR  364

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  365  VPYEEQIKDLLRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  424

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE+M+PSE+FPFIMR+PNRWSL
Sbjct  425  FLKSESMEPSEVFPFIMRDPNRWSL  449



>ref|XP_011022389.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1-like [Populus euphratica]
Length=1002

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S  PL+K+L KE KV+L++DNVG+IVDA GQPVGGSLVFR+ PDS+GEL S 
Sbjct  261  VIFTLPDVSSLPLLKLLWKEKKVLLLVDNVGIIVDAHGQPVGGSLVFRKGPDSVGELSSY  320

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            V+V+R+GK+ELYH+K G CVQ   F  E    CIVADE +  GKLVA+AT +KVI Y++V
Sbjct  321  VMVVRDGKMELYHKKLGGCVQTFSFGSEGFGPCIVADEESGNGKLVAVATPTKVIFYRRV  380

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EAVSL++EL ++GEI+ +MLSFVHAQ+GFLLLFDLHF EAV+HF
Sbjct  381  PAEEQIKDLLRKKNFKEAVSLVEELKSDGEISNEMLSFVHAQIGFLLLFDLHFEEAVNHF  440

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  441  LQSETMQPSEVFPFIMRDPNRWSL  464



>ref|XP_007134510.1| hypothetical protein PHAVU_010G053600g [Phaseolus vulgaris]
 gb|ESW06504.1| hypothetical protein PHAVU_010G053600g [Phaseolus vulgaris]
Length=1000

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KEW+V+L++DNVGVIVDA GQPVGGSLVFR   DS+GE+GS 
Sbjct  260  VIFSLPDVSRPPRLKLLHKEWRVLLLVDNVGVIVDAHGQPVGGSLVFRNGLDSVGEIGSY  319

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+ +GK+ELYH++ G CVQ +PF  E   +C+VA E +  GKLV +AT++KV+CYQK+
Sbjct  320  VVVVSDGKIELYHKRYGGCVQVLPFGGEGVGRCVVASEEDRDGKLVVVATATKVVCYQKL  379

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+SL++EL  EGE++KD+LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  380  PSVEQIKDLLRKKNYKGAISLVEELELEGEMSKDLLSFVHAQVGFLLLFDLHFKEAVDHF  439

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLS+TMQPSE+FPFIMR+PNRWSL
Sbjct  440  LLSDTMQPSEVFPFIMRDPNRWSL  463



>ref|XP_006368804.1| hypothetical protein POPTR_0001s11570g [Populus trichocarpa]
 gb|ERP65373.1| hypothetical protein POPTR_0001s11570g [Populus trichocarpa]
Length=1004

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F++PD S  PL+K+L KE KV+L++DNVG++VDA GQPVGGSLVFR+ PDS+GEL S 
Sbjct  263  VIFTMPDGSSLPLLKLLRKEKKVLLLVDNVGIVVDAHGQPVGGSLVFRKGPDSVGELASY  322

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSG+ VQ V F  E    CIVADE +  G LVA+AT +KVICY++V
Sbjct  323  VVVVRDGKMELYHKKSGSLVQTVSFGSEGVGPCIVADEESGNGTLVAVATPTKVICYRRV  382

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+S+++EL + GE++ +MLSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  383  PTEEQIKDLLRKKNFKEAISMVEELESNGEMSNEMLSFVHAQVGFLLLFDLHFEEAVNHF  442

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  443  LQSETMQPSEVFPFIMRDPNRWSL  466



>emb|CDY04778.1| BnaC05g18110D [Brassica napus]
Length=986

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQPVGGSLVFR  PDS+GEL   
Sbjct  245  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPVGGSLVFRRRPDSVGELSFY  304

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SKVI Y++
Sbjct  305  LVTVGDGKMEIHQKKSGACVQSVGFGPEGCGPSVLAVDEAGD-GNLLAVTTMSKVIFYRR  363

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  364  VPYEEQIKDLLRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  423

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE+M+PSE+FPFIMR+PNRWSL
Sbjct  424  FLKSESMEPSEVFPFIMRDPNRWSL  448



>ref|XP_011011629.1| PREDICTED: LOW QUALITY PROTEIN: transforming growth factor-beta 
receptor-associated protein 1 homolog [Populus euphratica]
Length=993

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F++PD S   L+K+L KE K ++++DNVG++VDA GQP GGSLVFR+ PDS+GEL S 
Sbjct  263  VIFTMPDGSSLALLKLLRKEKKALMLVDNVGIVVDAHGQPAGGSLVFRKGPDSVGELASY  322

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSG+ VQ V F  E    CIVADE +  G LVA+AT +KVICY++V
Sbjct  323  VVVVRDGKMELYHKKSGSRVQTVSFGSEGVGPCIVADEESGNGTLVAVATPTKVICYRRV  382

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+S+++EL + GE++ +MLSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  383  PTEEQIKDLLRKKNFKEAISMVEELESNGEMSNEMLSFVHAQVGFLLLFDLHFEEAVNHF  442

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIMR+PNRWSL
Sbjct  443  LQSETMQPSEVFPFIMRDPNRWSL  466



>ref|XP_011026984.1| PREDICTED: LOW QUALITY PROTEIN: transforming growth factor-beta 
receptor-associated protein 1 homolog [Populus euphratica]
Length=915

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F++PD S   L+K+L KE K ++++DNVG++VDA GQPVGGSLVFR+ PDS+GEL S 
Sbjct  185  VIFTMPDGSSLALLKLLRKEKKALMLVDNVGIVVDAHGQPVGGSLVFRKGPDSVGELASY  244

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELYH+KSG+ VQ V F  E    CIVADE +  G LVA+AT +KVICY++V
Sbjct  245  VVVVRDGKMELYHKKSGSRVQTVSFGSEGVGPCIVADEESGNGTLVAVATPTKVICYRRV  304

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P E+QIKDLLRKKN  EA+S+++EL + GE++ +MLSFVHAQVGFLLLFDLHF EAV+HF
Sbjct  305  PTEEQIKDLLRKKNFKEAISMVEELESNGEMSNEMLSFVHAQVGFLLLFDLHFEEAVNHF  364

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SET QPSE+FPFIMR+PNRWSL
Sbjct  365  LQSETTQPSEVFPFIMRDPNRWSL  388



>ref|XP_010477558.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1-like [Camelina sativa]
Length=980

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G     ADE  D G L+A+ + SK++ Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGTEGCGPSLFAADEAGD-GNLLAVTSLSKLLFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>ref|XP_010498774.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1-like [Camelina sativa]
Length=983

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G     ADE  D G L+A+ + SK++ Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGTEGCGPSLFAADEAGD-GNLLAVTSLSKLLFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>gb|KFK44374.1| hypothetical protein AALP_AA1G248900 [Arabis alpina]
Length=982

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  241  VIFALPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  300

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G   + ADE  D G L+A+ T SK++ Y++
Sbjct  301  LVTVGDGKMEIHQKKSGACVQSVSFGPEGYGPSLLAADEAGD-GNLLAVTTLSKLMFYRR  359

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  360  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  419

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  420  FLKSEKMEPSEVFPFIMRDPNRWSL  444



>ref|XP_002890538.1| hypothetical protein ARALYDRAFT_472531 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66797.1| hypothetical protein ARALYDRAFT_472531 [Arabidopsis lyrata subsp. 
lyrata]
Length=942

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVF+  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFQRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  +  G   + ADE  D G L+A+ T SK+I Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPQGCGPSLLAADEAGD-GNLLAVTTLSKLIFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEEMEPSEVFPFIMRDPNRWSL  445



>ref|XP_010460053.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1-like [Camelina sativa]
Length=983

 Score =   265 bits (676),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G     ADE  D G L+A+ + SK++ Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPEGCGPSLFSADEAGD-GNLLAVTSLSKLLFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>ref|XP_006416148.1| hypothetical protein EUTSA_v10006692mg [Eutrema salsugineum]
 gb|ESQ34501.1| hypothetical protein EUTSA_v10006692mg [Eutrema salsugineum]
Length=878

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSAPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SK++ Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPEGCGPSFLAVDEAGD-GNLLAVTTLSKLLFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDL+RKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAVD 
Sbjct  361  VPYEEQIKDLMRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVDQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>gb|AAB72173.1| unknown [Arabidopsis thaliana]
Length=947

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  +  G   + ADE  D G L+ + T SK+I Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPQGCGPSLLAADEAGD-GNLLVVTTLSKLIFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   E +SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYRETISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>ref|XP_008459073.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Cucumis melo]
Length=1011

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+F LP+LS PP +K+L KE KV+L++D VG+ V+A GQP+GGSLVF + P+S+ E+ S 
Sbjct  276  LIFKLPELSSPPCLKLLRKECKVLLLVDRVGITVNAYGQPIGGSLVFHDIPNSVAEISSY  335

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV  +G+++LYHR +G+C+Q + F+      CIV+DE +  G ++A A +SKV+CYQK+
Sbjct  336  VVVASSGQLKLYHRNTGSCIQTITFNGNGTEPCIVSDEDDGSGDVIAAAVTSKVMCYQKL  395

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P ++QIKDLLR+KN  EA+SL ++L   GE++KDML FVHAQ+GFLLLFDL F EAV+HF
Sbjct  396  PCDEQIKDLLRRKNFKEAISLAEDLECAGEMSKDMLYFVHAQIGFLLLFDLQFEEAVNHF  455

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPF+M++PNRWSL
Sbjct  456  LQSETMQPSEIFPFVMKDPNRWSL  479



>ref|NP_173699.5| vacuolar sorting protein 39 [Arabidopsis thaliana]
 gb|AEE30297.1| vacuolar sorting protein 39 [Arabidopsis thaliana]
Length=961

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  +  G   + ADE  D G L+ + T SK+I Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPQGCGPSLLAADEAGD-GNLLVVTTLSKLIFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   E +SL++EL ++GEI+KDMLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYRETISLVEELDSQGEISKDMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>emb|CDY21395.1| BnaA09g30320D [Brassica napus]
Length=987

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PPL+K+LCKEWKV+L++DNVGV+VD  GQPVGGSLVFR  PDS+GEL   
Sbjct  246  VIFTLPDVSDPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPVGGSLVFRRRPDSVGELSFY  305

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+EL+ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SKVI Y++
Sbjct  306  LVTVGDGKMELHQKKSGACVQSVSFGPEGCGPSVLAVDEAGD-GNLLAVTTMSKVIFYRR  364

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            V  E+QIKDLLRKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  365  VSYEEQIKDLLRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  424

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE+M+PSE+FPFIMR+PNRWSL
Sbjct  425  FLKSESMEPSEVFPFIMRDPNRWSL  449



>ref|XP_006416149.1| hypothetical protein EUTSA_v10006692mg [Eutrema salsugineum]
 gb|ESQ34502.1| hypothetical protein EUTSA_v10006692mg [Eutrema salsugineum]
Length=983

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+S PPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPDVSAPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +KSG CVQ V F  E  G   +  DE  D G L+A+ T SK++ Y++
Sbjct  302  LVTVGDGKMEIHQKKSGACVQSVSFGPEGCGPSFLAVDEAGD-GNLLAVTTLSKLLFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDL+RKK   EA+SL++EL +EGEI+K+MLSF+HAQ+G+LLLFDL F EAVD 
Sbjct  361  VPYEEQIKDLMRKKRYREAISLVEELDSEGEISKEMLSFLHAQIGYLLLFDLRFEEAVDQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>ref|XP_010687266.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Beta vulgaris subsp. vulgaris]
Length=997

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+FSLPD++  P +K+L K+ KVML++DN G+IVD+ GQPVGGSLVF  AP SI EL + 
Sbjct  256  LIFSLPDMTATPCLKLLLKDKKVMLLVDNAGIIVDSHGQPVGGSLVFGCAPRSIAELSTY  315

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVG-NKCIVADEGNDRGKLVALATSSKVICYQK  358
            VVV  NGK+ELYH++ G CVQ + F    G + C +ADE    G+ VA+ATSSKV+ Y+K
Sbjct  316  VVVAGNGKMELYHKRLGTCVQTLSFVGSTGTSNCFLADEEEVNGEFVAVATSSKVLFYRK  375

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            +P EDQIKD+LRKKN  EA+SL++EL  EG+++KDMLSFVHAQVGFLLLFDLHF EAVDH
Sbjct  376  IPSEDQIKDMLRKKNFKEAISLVEELEVEGDMSKDMLSFVHAQVGFLLLFDLHFEEAVDH  435

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FLLSETMQPSE+FPF++R+PNRWSL
Sbjct  436  FLLSETMQPSEIFPFVIRDPNRWSL  460



>ref|XP_006303895.1| hypothetical protein CARUB_v10008204mg [Capsella rubella]
 gb|EOA36793.1| hypothetical protein CARUB_v10008204mg [Capsella rubella]
Length=983

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LP++SGPPL+K+LCKEWKV+L++DNVGV+VD  GQP+GGSLVFR  PDS+GEL   
Sbjct  242  VIFTLPNVSGPPLLKLLCKEWKVLLLVDNVGVVVDTNGQPIGGSLVFRRRPDSVGELSFY  301

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            +V + +GK+E++ +K G CVQ V F  E  G   + ADE  D G L+A+ + SK+I Y++
Sbjct  302  LVTVGDGKMEIHQKKLGACVQSVSFGPEGCGPSLLAADEAGD-GDLLAVTSLSKLIFYRR  360

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            VP E+QIKDLLRKK   EA+SL++EL ++GEI+K+MLSF+HAQ+G+LLLFDL F EAV+ 
Sbjct  361  VPYEEQIKDLLRKKRYREAISLVEELDSQGEISKEMLSFLHAQIGYLLLFDLRFEEAVNQ  420

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL SE M+PSE+FPFIMR+PNRWSL
Sbjct  421  FLKSEKMEPSEVFPFIMRDPNRWSL  445



>ref|XP_002523291.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39092.1| conserved hypothetical protein [Ricinus communis]
Length=1005

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPDL  PP +K+L KE KV++++DNVG++V+  GQPVGGSL+FR +PDS+GEL SC
Sbjct  264  VIFTLPDLCSPPQLKLLWKEKKVLMLVDNVGIVVNEHGQPVGGSLIFRHSPDSVGELSSC  323

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV+R+GK+ELY+++SG+C+Q + F  E    C+VA+E    GKL+  AT++KV CY KV
Sbjct  324  VVVVRDGKMELYNKRSGSCIQTLIFGAEGVGPCVVANEECGDGKLIIAATTTKVFCYSKV  383

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
              E+QIKDLLRKKN  EA+SL++EL +EGE++ +MLSFVHAQVGFLLLFDL F EAV+HF
Sbjct  384  SCEEQIKDLLRKKNFKEAISLLEELESEGEMSNEMLSFVHAQVGFLLLFDLQFEEAVNHF  443

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            L SETMQPSE+FPFIM++PNRWSL
Sbjct  444  LQSETMQPSEVFPFIMQDPNRWSL  467



>ref|XP_010930302.1| PREDICTED: vam6/Vps39-like protein isoform X3 [Elaeis guineensis]
Length=945

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F LPD SGPP +K L +  +V+L++DNVGV+VD  GQPVGGSL+F+  P+SI E+ S V
Sbjct  285  IFMLPDSSGPPRLKSLWRSKEVLLLVDNVGVVVDRLGQPVGGSLIFQYIPESIAEMSSYV  344

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V R+G+V+LY +K+G  VQ + F  +    CIVA +    G++V +AT  K +C+ KV 
Sbjct  345  IVARDGRVDLYRKKTGANVQSLSFAKDGVGSCIVAIDDRGSGEVVVVATPYKALCFCKVS  404

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
            PE+QIK+LLRKKN  EA+ L++E  +EGE+TK+MLSFVHAQVGFLLLFDLHF +AV+HFL
Sbjct  405  PEEQIKNLLRKKNYKEAICLMEEFESEGEMTKEMLSFVHAQVGFLLLFDLHFEDAVNHFL  464

Query  545  LSETMQPSELFPFIMREPNRWS  610
            LSETMQPSE+FPFIM++PNRWS
Sbjct  465  LSETMQPSEIFPFIMQDPNRWS  486



>ref|XP_010930301.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Elaeis guineensis]
Length=960

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F LPD SGPP +K L +  +V+L++DNVGV+VD  GQPVGGSL+F+  P+SI E+ S V
Sbjct  285  IFMLPDSSGPPRLKSLWRSKEVLLLVDNVGVVVDRLGQPVGGSLIFQYIPESIAEMSSYV  344

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V R+G+V+LY +K+G  VQ + F  +    CIVA +    G++V +AT  K +C+ KV 
Sbjct  345  IVARDGRVDLYRKKTGANVQSLSFAKDGVGSCIVAIDDRGSGEVVVVATPYKALCFCKVS  404

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
            PE+QIK+LLRKKN  EA+ L++E  +EGE+TK+MLSFVHAQVGFLLLFDLHF +AV+HFL
Sbjct  405  PEEQIKNLLRKKNYKEAICLMEEFESEGEMTKEMLSFVHAQVGFLLLFDLHFEDAVNHFL  464

Query  545  LSETMQPSELFPFIMREPNRWS  610
            LSETMQPSE+FPFIM++PNRWS
Sbjct  465  LSETMQPSEIFPFIMQDPNRWS  486



>ref|XP_010930300.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Elaeis guineensis]
Length=1028

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F LPD SGPP +K L +  +V+L++DNVGV+VD  GQPVGGSL+F+  P+SI E+ S V
Sbjct  285  IFMLPDSSGPPRLKSLWRSKEVLLLVDNVGVVVDRLGQPVGGSLIFQYIPESIAEMSSYV  344

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V R+G+V+LY +K+G  VQ + F  +    CIVA +    G++V +AT  K +C+ KV 
Sbjct  345  IVARDGRVDLYRKKTGANVQSLSFAKDGVGSCIVAIDDRGSGEVVVVATPYKALCFCKVS  404

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
            PE+QIK+LLRKKN  EA+ L++E  +EGE+TK+MLSFVHAQVGFLLLFDLHF +AV+HFL
Sbjct  405  PEEQIKNLLRKKNYKEAICLMEEFESEGEMTKEMLSFVHAQVGFLLLFDLHFEDAVNHFL  464

Query  545  LSETMQPSELFPFIMREPNRWS  610
            LSETMQPSE+FPFIM++PNRWS
Sbjct  465  LSETMQPSEIFPFIMQDPNRWS  486



>gb|EPS65966.1| hypothetical protein M569_08810 [Genlisea aurea]
Length=499

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 154/212 (73%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    LLFSLPD-LSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGS  178
            L+FS P+  S  P +K+  KE +V+L+ DNVG++VD EG P GGSLVF   PD + E GS
Sbjct  215  LIFSFPEEASFIPQLKLFSKESRVLLVTDNVGIVVDLEGDPFGGSLVFNGVPDMLKETGS  274

Query  179  CVVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSK------  340
             VV  R   VELYH+K+G CVQRV   +     C++ADE  + GK + +ATS K      
Sbjct  275  YVVASRGLAVELYHKKTGCCVQRVAVGNGTEGHCLLADEEIENGKYIFIATSFKSSISKS  334

Query  341  -VICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLH  517
             +ICY KV  E+QIKDLLRKK+  EA+SL++EL NEG+ITK+MLSFVHAQVG LLLFDL 
Sbjct  335  KLICYSKVSEEEQIKDLLRKKHFKEAISLVEELENEGDITKEMLSFVHAQVGLLLLFDLQ  394

Query  518  FAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            F EA+DHFLL+E MQP E+FPFI+R+PNRW+L
Sbjct  395  FREAIDHFLLAENMQPLEVFPFILRDPNRWTL  426



>ref|XP_008801094.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Phoenix dactylifera]
Length=1028

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F LPD S PP +K L +  +V+L++DNVGV+V++ GQPVGGSL+F+  P+SI E+ S V
Sbjct  285  IFMLPDSSAPPRLKSLWRSKEVLLLVDNVGVVVNSLGQPVGGSLIFQYIPESIAEMSSYV  344

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V R G+V+LY +K+  CVQ + F       CIVA +    G++V +AT  K +C+ KV 
Sbjct  345  IVARGGRVDLYRKKTSACVQSLSFAKGGVGPCIVAIDDRGNGEVVVVATPYKALCFCKVS  404

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
             E+QIK+LLRKKN  EA+ L++E  +EGE+TK+MLSFVHAQVGFLLLFDLHF +AV+HFL
Sbjct  405  AEEQIKNLLRKKNYKEAICLMEEFESEGEMTKEMLSFVHAQVGFLLLFDLHFEDAVNHFL  464

Query  545  LSETMQPSELFPFIMREPNRWS  610
            LSETMQPSE+FPFIM++PNRWS
Sbjct  465  LSETMQPSEIFPFIMQDPNRWS  486



>ref|XP_009401136.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Musa acuminata subsp. malaccensis]
Length=1015

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            LF LP+ SGPP +K L    +V+L++DNVGV+V+A GQPVGGSL+F+ APDSI E+ S V
Sbjct  273  LFMLPESSGPPRLKSLWGSKEVLLLVDNVGVVVNASGQPVGGSLIFQYAPDSITEMPSYV  332

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVP  364
            +V ++G+++L+ RKSGNCVQ V +      +CIVA +   +G+++ +AT  K IC+ ++P
Sbjct  333  IVAKHGRMDLFRRKSGNCVQSVSYAKGGIGQCIVASDDQGKGEVIVVATPYKAICFHRLP  392

Query  365  PEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFL  544
             E+QIK LLRKK + EAV L++E  +E E+TK++LSFVHAQVGFLLLFDLHF EA++HFL
Sbjct  393  AEEQIKHLLRKKKLKEAVCLLEEFESEEEMTKELLSFVHAQVGFLLLFDLHFEEAINHFL  452

Query  545  LSETMQPSELFPFIMREPNRWS  610
            LSETMQP E+FPFIMR+PNRWS
Sbjct  453  LSETMQPPEIFPFIMRDPNRWS  474



>ref|XP_006858739.1| hypothetical protein AMTR_s00066p00129430 [Amborella trichopoda]
 gb|ERN20206.1| hypothetical protein AMTR_s00066p00129430 [Amborella trichopoda]
Length=987

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 152/205 (74%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+FSLP+ SG P +K      +++L++DNVGVIVD  G P+GGSL+FR  P+SIG   + 
Sbjct  243  LIFSLPESSGHPYLKPFPMHRELLLLVDNVGVIVDGHGNPIGGSLIFRSNPESIGRTKTH  302

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQK  358
            VV   NG++++YHRK+G+ VQ +       G   ++A++ +  G+L+ ++ +SK+    +
Sbjct  303  VVAASNGRLDVYHRKTGSRVQSIVLASHGSGGPLVMANDESGSGELLMVSMASKICFLSQ  362

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
               E+QIKDLLRKK   EA+SLI+EL  EG++TK++ SFVHAQVGFLLLFDLHF EAV+H
Sbjct  363  ASAEEQIKDLLRKKFFKEAISLIEELECEGDMTKEICSFVHAQVGFLLLFDLHFEEAVNH  422

Query  539  FLLSETMQPSELFPFIMREPNRWSL  613
            FL S+TMQPSE+FPFIMR+PNRWSL
Sbjct  423  FLQSDTMQPSEIFPFIMRDPNRWSL  447



>gb|KHN10897.1| Transforming growth factor-beta receptor-associated protein 1 
[Glycine soja]
Length=959

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 142/204 (70%), Gaps = 41/204 (20%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L KEW+V+L++DNVGVIVD  GQPV                   
Sbjct  260  VIFSLPDVSWPPRLKLLHKEWRVLLLVDNVGVIVDPHGQPV-------------------  300

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
                                  +PF  E   +C+VA E +  G+LVA+AT++KV+CYQK+
Sbjct  301  ----------------------LPFGGEGVGRCVVASEEDKGGRLVAVATATKVVCYQKL  338

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
            P  +QIKDLLRKKN   A+SL++EL +EGE++KD+LSFVHAQVGFLLLFDLHF EAVDHF
Sbjct  339  PSVEQIKDLLRKKNYKGAISLVEELESEGEMSKDLLSFVHAQVGFLLLFDLHFKEAVDHF  398

Query  542  LLSETMQPSELFPFIMREPNRWSL  613
            LLSETMQPSE+FPFIMR+PNRWSL
Sbjct  399  LLSETMQPSEVFPFIMRDPNRWSL  422



>ref|XP_004960592.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Setaria italica]
 ref|XP_004960593.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X3 [Setaria italica]
Length=834

 Score =   219 bits (558),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ SG P +K L    +VML++DNVGV+VD  GQPVG SLVF   PD I E+   V
Sbjct  203  IFTLPESSGHPRVKPLSGGDEVMLLVDNVGVVVDRFGQPVGSSLVFNTTPDCIAEVYPYV  262

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRG-KLVALATSSKVICYQKV  361
            +V  N KV++Y R++G  ++ +P         IVA + +  G +LV +AT+ KV CY+KV
Sbjct  263  IVAGNAKVDVYRRRNGVHLETIPVARTGQGVLIVASDDDGIGTELVVIATAYKVFCYRKV  322

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK  LR+KN  EA+SL++E  ++GEI+KDM+SFVHAQ+GFLLLFDL F +AV+HF
Sbjct  323  SSVEQIKASLRRKNYKEAISLLEEFQSDGEISKDMISFVHAQLGFLLLFDLRFEDAVNHF  382

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQPSE+FPFIM +PNRWS
Sbjct  383  LLSETMQPSEIFPFIMPDPNRWS  405



>gb|EEC78350.1| hypothetical protein OsI_18103 [Oryza sativa Indica Group]
Length=827

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ S PP +K L    +VML++DNVGV+VD  G PVG S VF   PD I E+   V
Sbjct  92   IFTLPESSRPPRVKPLSGGDEVMLLVDNVGVVVDRSGHPVGSSFVFNTTPDCIAEVYPYV  151

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGK-LVALATSSKVICYQKV  361
            VV  + KV++Y RK+G  +Q +PF        IVA E    G  +V +AT+ KV CY+KV
Sbjct  152  VVAGDSKVDVYRRKNGAHLQAIPFARPGTGGLIVASEDAGIGSDVVVIATAYKVFCYRKV  211

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK LLR+K+  EA+SL+ E   +GEI+ DM+SFVHAQ+GFLL FDL F +AV+HF
Sbjct  212  SAVEQIKALLRRKSYAEAISLLQEFEADGEISNDMISFVHAQLGFLLFFDLRFEDAVNHF  271

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQP+E+FPFIMR+PNRWS
Sbjct  272  LLSETMQPAEIFPFIMRDPNRWS  294



>ref|XP_004960591.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Setaria italica]
Length=936

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ SG P +K L    +VML++DNVGV+VD  GQPVG SLVF   PD I E+   V
Sbjct  203  IFTLPESSGHPRVKPLSGGDEVMLLVDNVGVVVDRFGQPVGSSLVFNTTPDCIAEVYPYV  262

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRG-KLVALATSSKVICYQKV  361
            +V  N KV++Y R++G  ++ +P         IVA + +  G +LV +AT+ KV CY+KV
Sbjct  263  IVAGNAKVDVYRRRNGVHLETIPVARTGQGVLIVASDDDGIGTELVVIATAYKVFCYRKV  322

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK  LR+KN  EA+SL++E  ++GEI+KDM+SFVHAQ+GFLLLFDL F +AV+HF
Sbjct  323  SSVEQIKASLRRKNYKEAISLLEEFQSDGEISKDMISFVHAQLGFLLLFDLRFEDAVNHF  382

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQPSE+FPFIM +PNRWS
Sbjct  383  LLSETMQPSEIFPFIMPDPNRWS  405



>ref|NP_001054400.1| Os05g0104100 [Oryza sativa Japonica Group]
 gb|AAS88832.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16314.1| Os05g0104100 [Oryza sativa Japonica Group]
 gb|EEE62014.1| hypothetical protein OsJ_16796 [Oryza sativa Japonica Group]
Length=936

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ S PP +K L    +VML++DNVGV+VD  G PVG S VF   PD I E+   V
Sbjct  201  IFTLPESSRPPRVKPLSGGDEVMLLVDNVGVVVDRSGHPVGSSFVFNTTPDCIAEVYPYV  260

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGK-LVALATSSKVICYQKV  361
            VV  + KV++Y RK+G  +Q +PF        IVA E    G  +V +AT+ KV CY+KV
Sbjct  261  VVAGDSKVDVYRRKNGAHLQAIPFARPGTGGLIVASEDAGIGSDVVVIATAYKVFCYRKV  320

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK LLR+K+  EA+SL+ E   +GEI+ DM+SFVHAQ+GFLL FDL F +AV+HF
Sbjct  321  SAVEQIKALLRRKSYAEAISLLQEFEADGEISNDMISFVHAQLGFLLFFDLRFEDAVNHF  380

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQP+E+FPFIMR+PNRWS
Sbjct  381  LLSETMQPAEIFPFIMRDPNRWS  403



>ref|XP_006653942.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Oryza brachyantha]
Length=936

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ S PP +K L    +VML++DNVGV+VD  G P+G S VF   PD I E+   V
Sbjct  201  IFTLPESSRPPRVKPLSGGDEVMLLVDNVGVVVDRSGHPIGSSFVFNTTPDCIAEVFPYV  260

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGK-LVALATSSKVICYQKV  361
            VV  + KV++Y R++G  +Q +PF        IVA E    G  +V +AT+ KV CY+K 
Sbjct  261  VVAGDYKVDVYRRRNGAHLQAIPFARAGTGGLIVASEDAGTGSGVVVVATAYKVFCYRKA  320

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK LLR+K+ GEA+SL+ E   +GEI+ DM+SFVHAQ+GFLL FDL F +AV+HF
Sbjct  321  SAVEQIKALLRRKSYGEAISLLQEFKADGEISNDMISFVHAQLGFLLFFDLRFEDAVNHF  380

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQP+E+FPFIMR+PNRWS
Sbjct  381  LLSETMQPAEIFPFIMRDPNRWS  403



>ref|XP_008648684.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Zea mays]
Length=934

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 148/205 (72%), Gaps = 5/205 (2%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +FSLP+ +G P +K L    +VML++DNVGV+VD  GQPVG SLVF   PD I E+   V
Sbjct  201  IFSLPESAGHPRVKPLSGGDEVMLLVDNVGVVVDRFGQPVGSSLVFSTTPDYIAEVFPYV  260

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRG---KLVALATSSKVICYQ  355
            +V  + KV++Y R++   +Q +P         IVA  G+D G   +LV +AT+ KV CY+
Sbjct  261  IVAGDSKVDVYRRRNAAHLQTIPVARTGQGVLIVA--GDDDGIDTELVVIATTYKVFCYR  318

Query  356  KVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVD  535
            KV   +QIK  LR+KN  EA+SL++E  ++GEI+KDM+SFVHAQ+GFLL FDL F +AV+
Sbjct  319  KVSALEQIKASLRRKNYKEAISLLEEFESDGEISKDMISFVHAQLGFLLFFDLRFEDAVN  378

Query  536  HFLLSETMQPSELFPFIMREPNRWS  610
            HFLLSETMQPSE+FPFIMR+PNRWS
Sbjct  379  HFLLSETMQPSEVFPFIMRDPNRWS  403



>ref|XP_003569134.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Brachypodium distachyon]
Length=945

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            LF+LP+ +G P +K L    + ML++DNVGV++D  GQPVG S VF   PD I E+   V
Sbjct  210  LFTLPESAGSPRIKPLSGGDEAMLLVDNVGVVIDRSGQPVGSSFVFNSRPDCIVEVFPYV  269

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDR--GKLVALATSSKVICYQK  358
            VV    KV++Y RK+G  +Q VP     G+  +     ND   G +V +AT+ KV CY+K
Sbjct  270  VVAGESKVDVYRRKNGAHLQTVPIA-RSGSGVLTVASNNDGSGGDVVVIATAYKVFCYRK  328

Query  359  VPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDH  538
            V   +QIK  LR K+  EA+SL++E  ++GEI+KDM+SFVHAQ+GFLL FDLHF +AV+H
Sbjct  329  VSAVEQIKASLRIKSYAEAISLLEEFESDGEISKDMISFVHAQLGFLLFFDLHFEDAVNH  388

Query  539  FLLSETMQPSELFPFIMREPNRWS  610
            FLLSETMQP+E+FPFIMR PNRWS
Sbjct  389  FLLSETMQPTEIFPFIMRGPNRWS  412



>ref|XP_002439096.1| hypothetical protein SORBIDRAFT_09g000420 [Sorghum bicolor]
 gb|EES17526.1| hypothetical protein SORBIDRAFT_09g000420 [Sorghum bicolor]
Length=934

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 146/203 (72%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +FSLP+ SG P +K L    +VML++DNVGV+VD  GQPVG SLVF   PD I E+   V
Sbjct  201  IFSLPESSGHPRVKPLSGGDEVMLLVDNVGVVVDRFGQPVGSSLVFSTMPDCIAEVFPYV  260

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            +V  + KV++Y R++   +Q +P      G   +V+D+     +LV +AT+ KV CY+KV
Sbjct  261  IVAGDSKVDVYRRRNAAHLQTIPVARTGQGILIVVSDDDGIGTELVVIATTYKVFCYRKV  320

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK  LR+KN  EA+SL++E  ++GEI+K+M+SFV AQ+GFLL FDL F +AV+HF
Sbjct  321  SAVEQIKASLRRKNYKEAISLLEEFESDGEISKEMISFVQAQLGFLLFFDLRFEDAVNHF  380

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQPSE+FPFIMR+PNRWS
Sbjct  381  LLSETMQPSEVFPFIMRDPNRWS  403



>dbj|BAK03364.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=940

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +F+LP+ +G P ++ L    +VML++DNVGV+VD  GQPVG S VF   PD I E+   V
Sbjct  204  IFTLPESAGAPRIRPLSGGQEVMLLVDNVGVVVDRSGQPVGSSFVFNSRPDCIVEVFPYV  263

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VV    KV++Y R++G  +Q +P      G   + +D+    G++V +AT+ KV CY+KV
Sbjct  264  VVAAESKVDVYRRRNGVHLQTIPVARTGTGLLTVASDDDGSGGEVVVVATAYKVFCYRKV  323

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHF  541
               +QIK  LR K+  EAVSL++E  ++GEI+ DM+SFVHAQ GFLL FDL F +AV+HF
Sbjct  324  SAVEQIKASLRIKSYTEAVSLLEEFESDGEISNDMISFVHAQFGFLLFFDLRFEDAVNHF  383

Query  542  LLSETMQPSELFPFIMREPNRWS  610
            LLSETMQP+E+FPFIMR+PNRWS
Sbjct  384  LLSETMQPAEIFPFIMRDPNRWS  406



>gb|EMT31210.1| hypothetical protein F775_11411 [Aegilops tauschii]
Length=714

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = +2

Query  71   MLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCVVVMRNGKVELYHRKSGNCVQRV  250
            ML++DNVGV+VD  GQPVG S VF   PD I E+   VVV    KV++Y R++G  +Q V
Sbjct  1    MLLVDNVGVVVDQSGQPVGSSFVFNSRPDCIVEVFPYVVVAAESKVDVYRRRNGVHLQTV  60

Query  251  PFDDEVGNKCIVADEGNDRG-KLVALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLI  427
            P          VA +G+  G ++V +AT+ KV CY+KV   +QIK LLR K+  EA+SL+
Sbjct  61   PIARRGTGVLTVASDGDGSGGEVVVVATAYKVFCYRKVSAVEQIKALLRIKSYTEAISLL  120

Query  428  DELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRW  607
            +E  ++GEI+ DM+SFVHAQ+GFLL FDL F +AV+HFLLSETMQP+E+FPFIMR+PNRW
Sbjct  121  EEFESDGEISNDMISFVHAQLGFLLFFDLRFEDAVNHFLLSETMQPAEIFPFIMRDPNRW  180

Query  608  S  610
            S
Sbjct  181  S  181



>ref|XP_010534942.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X2 [Tarenaya hassleriana]
Length=943

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++F+LPD+SG PL+K+LCKEWKV+L++DNVGVIVDA GQPVGGSLVFR  PDS+GEL   
Sbjct  246  MIFALPDVSGSPLLKLLCKEWKVLLLVDNVGVIVDANGQPVGGSLVFRRRPDSVGELCID  305

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VV + +GK+E+Y + +G CVQ V F  E   + ++A E +  G +VA+A+ SK+I YQKV
Sbjct  306  VVAVGDGKMEIYQKNTGICVQSVTFGPEGCGQSVLAAEESGNGSIVAVASLSKLIFYQKV  365

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLH-----FAE  526
              E+QIKDLLRKKN  EA+SL++EL  EGEI+K+MLSFVHAQV     + LH       +
Sbjct  366  AYEEQIKDLLRKKNYREAISLVEELDLEGEISKEMLSFVHAQVPRNRYWGLHPPPVPLED  425

Query  527  AVDHFLLS  550
             VD+ L+S
Sbjct  426  VVDNGLMS  433



>gb|EMS66323.1| hypothetical protein TRIUR3_01888 [Triticum urartu]
Length=714

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = +2

Query  71   MLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCVVVMRNGKVELYHRKSGNCVQRV  250
            ML++DNVGV+VD  G PVG S VF   PD I E+   VVV    KV++Y R++G  +Q V
Sbjct  1    MLLVDNVGVVVDRSGHPVGSSFVFNSRPDCIVEVFPYVVVAAESKVDVYRRRNGVHLQTV  60

Query  251  PFDDE-VGNKCIVADEGNDRGKLVALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLI  427
            P      G   +V+D     G++V +AT+ KV CY+KV   +QIK LLR K+  EA+SL+
Sbjct  61   PIARRGTGVLTVVSDGDGSGGEVVVVATAYKVFCYRKVSAVEQIKALLRIKSYTEAISLL  120

Query  428  DELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRW  607
            +E  ++GEI  DM+SFVHAQ+GFLL FDL F +AV+HFLLSETMQP+E+FPFIMR+PNRW
Sbjct  121  EEFESDGEILNDMISFVHAQLGFLLFFDLRFEDAVNHFLLSETMQPAEIFPFIMRDPNRW  180

Query  608  S  610
            S
Sbjct  181  S  181



>ref|XP_001762235.1| predicted protein [Physcomitrella patens]
 gb|EDQ73027.1| predicted protein [Physcomitrella patens]
Length=857

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 131/204 (64%), Gaps = 5/204 (2%)
 Frame = +2

Query  5    LFSLP-DLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            +FSLP DL  PPL+K+  K+ +V+L +D  G++V+AEGQP  GSL F   PD++G+    
Sbjct  120  IFSLPSDLPYPPLLKLFPKDLEVLLAVDKAGIVVNAEGQPTAGSLNFAVVPDAVGQTPPY  179

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKV  361
            VVV++ G  ELYHR +G  +Q +        + +VA+  +D G LV +A+  KV C Q+V
Sbjct  180  VVVVKQGHTELYHRNTGAKIQSLELAGAGVGRFLVAE--DDGGTLVVIASGVKVWCLQQV  237

Query  362  PPEDQIKDLLRKKNVGEAVSLIDELWNEG--EITKDMLSFVHAQVGFLLLFDLHFAEAVD  535
              +DQ++DLL+++   EAV L  E   EG     K+ L+ VHA+ GFLLLFDL F  A+D
Sbjct  238  SLDDQVRDLLKQRQFNEAVGLAQEAVAEGSDSAAKERLAIVHAEAGFLLLFDLQFELAMD  297

Query  536  HFLLSETMQPSELFPFIMREPNRW  607
            HFLLS+ +QP+ELFPF      RW
Sbjct  298  HFLLSDILQPTELFPFFPSFTTRW  321



>ref|XP_002993618.1| hypothetical protein SELMODRAFT_449189 [Selaginella moellendorffii]
 gb|EFJ05310.1| hypothetical protein SELMODRAFT_449189 [Selaginella moellendorffii]
Length=1808

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 11/204 (5%)
 Frame = +2

Query  5     LFSLPDLSGP--PLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGS  178
             LFS P +  P  PL+K   KE  V+L+MD  G++V+ EG PVGGSLVF E PD++G+   
Sbjct  896   LFSFP-VESPWKPLLKPFPKESLVLLVMDIAGIMVNEEGLPVGGSLVFSEIPDAVGQSSP  954

Query  179   CVVVMRNGKVELYHRKSGNCVQRVPFDD-EVGNKCIVADEGNDRGKLVALATSSKVICYQ  355
               +V+  G VELYH ++G+ VQ + +    V   C++ D   D   ++ +A   KV C+ 
Sbjct  955   YALVVNKGVVELYHSQTGSKVQSLAYGSVPVEPPCLITD---DNDGIIVIANGDKVSCFT  1011

Query  356   KVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVD  535
             ++  +DQ+KDLL++K   EAV L     NE E  K  L  VHA+ GFLLL DL F EA+D
Sbjct  1012  RISVDDQLKDLLKQKQYSEAVKLA----NEEEGAKSKLGMVHAEAGFLLLADLRFEEAID  1067

Query  536   HFLLSETMQPSELFPFIMREPNRW  607
             HFL S+ ++P+ELFPF     +RW
Sbjct  1068  HFLRSDIVEPTELFPFFPSLTSRW  1091



>ref|XP_002973436.1| hypothetical protein SELMODRAFT_442094 [Selaginella moellendorffii]
 gb|EFJ25810.1| hypothetical protein SELMODRAFT_442094 [Selaginella moellendorffii]
Length=1754

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 124/204 (61%), Gaps = 11/204 (5%)
 Frame = +2

Query  5     LFSLPDLSGP--PLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGS  178
             LFS P +  P  PL+K   KE  V+L+MD  G++V+ EG PVGGSLVF E PD++G+   
Sbjct  859   LFSFP-VESPWKPLLKPFPKESLVLLVMDIAGIMVNEEGLPVGGSLVFSEIPDAVGQSSP  917

Query  179   CVVVMRNGKVELYHRKSGNCVQRVPFDD-EVGNKCIVADEGNDRGKLVALATSSKVICYQ  355
               +V+  G VELYH ++G+ VQ + +    V    ++ D   D   ++ +A   KV C+ 
Sbjct  918   YALVVNKGVVELYHSQTGSKVQSLAYGSVPVEPPRLITD---DNDGIIVIANGDKVSCFT  974

Query  356   KVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVD  535
             ++  +DQ+KDLL++K   EAV L     NE E  K  L  VHA+ GFLLL DL F EA+D
Sbjct  975   RISVDDQLKDLLKQKQYSEAVKLA----NEEEGAKSKLGMVHAEAGFLLLADLRFEEAID  1030

Query  536   HFLLSETMQPSELFPFIMREPNRW  607
             HFL S+ ++P ELFPF     +RW
Sbjct  1031  HFLRSDIVEPMELFPFFPSLTSRW  1054



>gb|KGN66916.1| hypothetical protein Csa_1G715220 [Cucumis sativus]
Length=276

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  281  IVADEGNDRGKLVALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITK  460
            I A  G +   L  LA    V+CYQK+P ++QIKDLLR+KN  EA+SL ++L   GE++K
Sbjct  95   IFACRGQN-SDLSELAGLVDVMCYQKLPCDEQIKDLLRRKNFKEAISLAEDLECAGEMSK  153

Query  461  DMLSFVHAQVGFLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            +ML FVHAQ+GFLLLFDL F EAV+HFL SETMQPSE+FPF+M++PNRWSL
Sbjct  154  EMLYFVHAQIGFLLLFDLQFEEAVNHFLQSETMQPSEIFPFVMKDPNRWSL  204



>ref|XP_004172009.1| PREDICTED: uncharacterized protein LOC101228448, partial [Cucumis 
sativus]
Length=368

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  314  LVALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVG  493
             +A   + +V+CYQK+P ++QIKDLLR+KN  EA+SL ++L   GE++K+ML FVHAQ+G
Sbjct  203  FIAWLDNHQVMCYQKLPCDEQIKDLLRRKNFKEAISLAEDLECAGEMSKEMLYFVHAQIG  262

Query  494  FLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            FLLLFDL F EAV+HFL SETMQPSE+FPF+M++PNRWSL
Sbjct  263  FLLLFDLQFEEAVNHFLQSETMQPSEIFPFVMKDPNRWSL  302



>ref|XP_008459074.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X2 [Cucumis melo]
Length=714

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  317  VALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGF  496
            ++L  +  V+CYQK+P ++QIKDLLR+KN  EA+SL ++L   GE++KDML FVHAQ+GF
Sbjct  84   LSLLRTVAVMCYQKLPCDEQIKDLLRRKNFKEAISLAEDLECAGEMSKDMLYFVHAQIGF  143

Query  497  LLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            LLLFDL F EAV+HFL SETMQPSE+FPF+M++PNRWSL
Sbjct  144  LLLFDLQFEEAVNHFLQSETMQPSEIFPFVMKDPNRWSL  182



>ref|XP_011090061.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 [Sesamum indicum]
Length=669

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +2

Query  338  KVICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVGFLLLFDLH  517
            ++I Y +   E QIKDLLRKK+  EA++L+DEL NEG +TK+MLSF+HAQVGFLLLFDL 
Sbjct  65   ELISYGEASGE-QIKDLLRKKSFKEAITLVDELANEGAMTKEMLSFIHAQVGFLLLFDLQ  123

Query  518  FAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            F EAVDHFLLSE MQPSELFPFIMR+PNRW+L
Sbjct  124  FKEAVDHFLLSENMQPSELFPFIMRDPNRWTL  155



>ref|XP_004145488.1| PREDICTED: uncharacterized protein LOC101209704 [Cucumis sativus]
Length=1503

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  314  LVALATSSKVICYQKVPPEDQIKDLLRKKNVGEAVSLIDELWNEGEITKDMLSFVHAQVG  493
             +A   + +V+CYQK+P ++QIKDLLR+KN  EA+SL ++L   GE++K+ML FVHAQ+G
Sbjct  132  FIAWLDNHQVMCYQKLPCDEQIKDLLRRKNFKEAISLAEDLECAGEMSKEMLYFVHAQIG  191

Query  494  FLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            FLLLFDL F EAV+HFL SETMQPSE+FPF+M++PNRWSL
Sbjct  192  FLLLFDLQFEEAVNHFLQSETMQPSEIFPFVMKDPNRWSL  231



>gb|KEH18119.1| vacuolar sorting protein 39 domain protein [Medicago truncatula]
Length=893

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            ++FSLPD+S PP +K+L ++W+V+L++DNVG+IVD +GQPVGGSLVFR   DS+GEL   
Sbjct  245  VIFSLPDVSRPPRLKLLYRDWRVLLLVDNVGIIVDEKGQPVGGSLVFRRGLDSVGELSFY  304

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKV  343
            VVV+ +GKVELY++K+G CVQ + F  E    C+VA E +  GKLVA+AT++KV
Sbjct  305  VVVVSDGKVELYNKKNGGCVQVLAFGGEGIGPCVVASEEDKGGKLVAVATATKV  358



>gb|KGN66917.1| hypothetical protein Csa_1G715230 [Cucumis sativus]
Length=422

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+F LP+LS PP +K+L KE KV+L++D VG+ V+A GQP+GGSLVF + P S+ E+ + 
Sbjct  276  LIFKLPELSSPPCLKLLRKECKVLLLVDRVGITVNAYGQPMGGSLVFHDIPKSVAEISTY  335

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKV  343
            VVV  +G+++LYHR +G+C+Q + F+      CIV+DE +  G ++A+A ++KV
Sbjct  336  VVVASSGQLKLYHRNTGSCIQTITFNGNRTEPCIVSDEEDGSGDVIAVAVTNKV  389



>ref|XP_004150633.1| PREDICTED: uncharacterized protein LOC101216195 [Cucumis sativus]
Length=922

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    LLFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSC  181
            L+F LP+LS PP +K+L KE KV+L++D VG+ V+A GQP+GGSLVF + P S+ E+ + 
Sbjct  208  LIFKLPELSSPPCLKLLRKECKVLLLVDRVGITVNAYGQPMGGSLVFHDIPKSVAEISTY  267

Query  182  VVVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKV  343
            VVV  +G+++LYHR +G+C+Q + F+      CIV+DE +  G ++A+A ++KV
Sbjct  268  VVVASSGQLKLYHRNTGSCIQTITFNGNRTEPCIVSDEEDGSGDVIAVAVTNKV  321



>gb|KHN12252.1| Transforming growth factor-beta receptor-associated protein 1 
[Glycine soja]
Length=591

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  452  ITKDMLSFVHAQVGFLLLFDLHFAEAVDHFLLSETMQPSELFPFIMREPNRWSL  613
            ++KD+LSFVHAQVGFLLLFDLHF EAVDHFLLSETMQPSE+FPFIMR+PNRWSL
Sbjct  1    MSKDLLSFVHAQVGFLLLFDLHFKEAVDHFLLSETMQPSEVFPFIMRDPNRWSL  54



>gb|AFW75088.1| hypothetical protein ZEAMMB73_441101 [Zea mays]
Length=315

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +2

Query  5    LFSLPDLSGPPLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCV  184
            +FSLP+ +G P +K L    +VML++DNVGV+VD  GQPVG SLVF   PD I E+   V
Sbjct  201  IFSLPESAGHPRVKPLSGGDEVMLLVDNVGVVVDRFGQPVGSSLVFSTTPDYIAEVFPYV  260

Query  185  VVMRNGKVELYHRKSGNCVQRVPFDDEVGNKCIVA--DEGNDRGKLVALATSSKV  343
            +V  + KV++Y R++   +Q +P         IVA  D+G D  +LV +AT+ KV
Sbjct  261  IVAGDSKVDVYRRRNAAHLQTIPVARTGQGVLIVAGDDDGIDT-ELVVIATTYKV  314



>ref|XP_004345885.1| CNH domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21341.1| CNH domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=931

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 90/184 (49%), Gaps = 7/184 (4%)
 Frame = +2

Query  35   PLMKILCKEWKVMLMMDNVGVIVDAEGQPVGGSLVFREAPDSIGELGSCVVVMRNGKVEL  214
            P++K  C++  ++L  DN G +V+  G P+   + +   P ++G     VV ++N  +E+
Sbjct  213  PIIKP-CRDL-LLLSADNFGFLVNQVGTPLATQIEWDTPPLAVGYRYPFVVGVQNTSIEV  270

Query  215  YHRKSGNCVQRVPFDDEVGNKCIVADEGNDRGKLVALATSSKVICYQKVPPEDQIKDLLR  394
            ++  +   VQ +P    V  K  +    +D G+ + +A    + C    P E+Q+K LL+
Sbjct  271  HNVYNQGLVQTIPLPSHVTRKLTLV---SDNGRHLIVAGGGTIYCLVPTPVEEQVKQLLQ  327

Query  395  KKNVGEAVSLIDE-LWNEGEITKDMLSFVHAQVGFLLLFDLHFAEAVDHFLLSETMQPSE  571
            +  V EA  L+ E L ++ E     LS    + G +   +L F EA   F  S+ M P E
Sbjct  328  ELRVQEAADLLAESLKDDREGKAAKLSAFRQEAGMVYFVNLKFKEAFAQFDKSD-MDPRE  386

Query  572  LFPF  583
            L  F
Sbjct  387  LISF  390



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660