BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003C09 655 bp,

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609402.1|  PREDICTED: BI1-like protein                        231   3e-72   Nicotiana tomentosiformis
ref|XP_009769831.1|  PREDICTED: BI1-like protein                        231   3e-72   Nicotiana sylvestris
ref|XP_006339425.1|  PREDICTED: BI1-like protein-like                   231   3e-72   Solanum tuberosum [potatoes]
ref|XP_004229465.1|  PREDICTED: BI1-like protein                        229   2e-71   Solanum lycopersicum
gb|EYU43851.1|  hypothetical protein MIMGU_mgv1a011019mg                214   6e-65   Erythranthe guttata [common monkey flower]
ref|XP_002279368.2|  PREDICTED: BI1-like protein                        207   3e-63   Vitis vinifera
ref|XP_006419766.1|  hypothetical protein CICLE_v10005717mg             207   9e-63   Citrus clementina
ref|XP_006489229.1|  PREDICTED: BI1-like protein-like                   207   9e-63   Citrus sinensis [Valencia orange]
emb|CDO98965.1|  unnamed protein product                                201   8e-61   Coffea canephora [robusta coffee]
ref|XP_008223040.1|  PREDICTED: BI1-like protein                        201   2e-60   Prunus mume [ume]
ref|XP_010024447.1|  PREDICTED: BI1-like protein                        198   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010105697.1|  hypothetical protein L484_011309                   198   2e-59   Morus notabilis
gb|KHG22240.1|  hypothetical protein F383_06527                         198   2e-59   Gossypium arboreum [tree cotton]
ref|XP_007223728.1|  hypothetical protein PRUPE_ppa010433mg             198   2e-59   Prunus persica
ref|XP_007035358.1|  Bax inhibitor-1 family protein isoform 2           197   5e-59   Theobroma cacao [chocolate]
ref|XP_008390802.1|  PREDICTED: BI1-like protein                        197   6e-59   Malus domestica [apple tree]
ref|XP_009352144.1|  PREDICTED: BI1-like protein                        196   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_011090832.1|  PREDICTED: BI1-like protein                        196   2e-58   Sesamum indicum [beniseed]
ref|XP_009339935.1|  PREDICTED: BI1-like protein                        195   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_010693836.1|  PREDICTED: BI1-like protein                        194   4e-58   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010279039.1|  PREDICTED: BI1-like protein                        194   5e-58   Nelumbo nucifera [Indian lotus]
gb|KHG20306.1|  hypothetical protein F383_02282                         194   6e-58   Gossypium arboreum [tree cotton]
ref|XP_008340894.1|  PREDICTED: BI1-like protein                        194   1e-57   Malus domestica [apple tree]
ref|XP_009624081.1|  PREDICTED: BI1-like protein                        193   1e-57   Nicotiana tomentosiformis
ref|XP_007035357.1|  Bax inhibitor-1 family protein isoform 1           192   4e-57   Theobroma cacao [chocolate]
ref|XP_004144961.1|  PREDICTED: BI1-like protein-like                   192   5e-57   
ref|XP_009785292.1|  PREDICTED: BI1-like protein                        191   8e-57   Nicotiana sylvestris
ref|XP_004297019.1|  PREDICTED: BI1-like protein                        191   9e-57   Fragaria vesca subsp. vesca
gb|KJB74487.1|  hypothetical protein B456_011G181100                    190   4e-56   Gossypium raimondii
gb|EPS68151.1|  hypothetical protein M569_06622                         189   5e-56   Genlisea aurea
ref|XP_010524498.1|  PREDICTED: BI1-like protein                        188   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_009419853.1|  PREDICTED: BI1-like protein                        187   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312729.1|  hypothetical protein POPTR_0008s20370g             187   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009414206.1|  PREDICTED: BI1-like protein                        187   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP40073.1|  hypothetical protein JCGZ_02071                         186   7e-55   Jatropha curcas
ref|XP_002516809.1|  Transmembrane BAX inhibitor motif-containing...    185   9e-55   
ref|XP_011006595.1|  PREDICTED: BI1-like protein                        186   1e-54   Populus euphratica
gb|KJB34591.1|  hypothetical protein B456_006G074200                    196   1e-54   Gossypium raimondii
ref|XP_008809232.1|  PREDICTED: BI1-like protein                        185   2e-54   Phoenix dactylifera
emb|CDX90589.1|  BnaA03g41920D                                          185   2e-54   Brassica napus [oilseed rape]
emb|CDY09066.1|  BnaC08g10200D                                          185   3e-54   Brassica napus [oilseed rape]
ref|XP_002314428.1|  hypothetical protein POPTR_0010s02990g             185   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011006069.1|  PREDICTED: BI1-like protein                        184   5e-54   Populus euphratica
ref|XP_008776713.1|  PREDICTED: BI1-like protein                        184   7e-54   Phoenix dactylifera
gb|KHG16370.1|  hypothetical protein F383_22614                         182   2e-53   Gossypium arboreum [tree cotton]
ref|XP_002870236.1|  hypothetical protein ARALYDRAFT_493344             182   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_006850841.1|  hypothetical protein AMTR_s00025p00133870          181   5e-53   Amborella trichopoda
ref|XP_003546118.1|  PREDICTED: BI1-like protein-like                   181   5e-53   Glycine max [soybeans]
ref|NP_001237753.1|  uncharacterized protein LOC100499906               181   5e-53   Glycine max [soybeans]
gb|KHN37547.1|  BI1-like protein                                        181   6e-53   Glycine soja [wild soybean]
ref|XP_009107842.1|  PREDICTED: BI1-like protein                        182   6e-53   Brassica rapa
emb|CDY09761.1|  BnaC07g33000D                                          181   7e-53   Brassica napus [oilseed rape]
gb|AAL07001.1|  AT4g15470/dl3775w                                       181   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567466.1|  Bax inhibitor-1 like protein                          181   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548892.1|  PREDICTED: BI1-like protein                        181   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_009136696.1|  PREDICTED: BI1-like protein                        181   1e-52   Brassica rapa
emb|CDY22739.1|  BnaA08g05690D                                          181   1e-52   Brassica napus [oilseed rape]
ref|XP_010551036.1|  PREDICTED: BI1-like protein                        181   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_010905739.1|  PREDICTED: BI1-like protein                        180   2e-52   Elaeis guineensis
gb|AFK46458.1|  unknown                                                 180   3e-52   Medicago truncatula
ref|XP_006284243.1|  hypothetical protein CARUB_v10005406mg             181   3e-52   Capsella rubella
ref|XP_010938798.1|  PREDICTED: BI1-like protein                        179   3e-52   Elaeis guineensis
ref|XP_010440304.1|  PREDICTED: BI1-like protein                        179   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010434979.1|  PREDICTED: BI1-like protein                        179   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006414507.1|  hypothetical protein EUTSA_v10026042mg             179   4e-52   Eutrema salsugineum
ref|XP_007147817.1|  hypothetical protein PHAVU_006G157400g             179   7e-52   Phaseolus vulgaris [French bean]
gb|KFK22627.1|  hypothetical protein AALP_AAs50448U000500               179   8e-52   Arabis alpina [alpine rockcress]
gb|ACU19337.1|  unknown                                                 178   1e-51   Glycine max [soybeans]
ref|XP_010434338.1|  PREDICTED: BI1-like protein                        177   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004486099.1|  PREDICTED: BI1-like protein-like                   177   4e-51   Cicer arietinum [garbanzo]
gb|KJB28559.1|  hypothetical protein B456_005G055600                    177   4e-51   Gossypium raimondii
ref|XP_003594082.1|  Transmembrane BAX inhibitor motif-containing...    172   5e-49   
ref|XP_006353796.1|  PREDICTED: BI1-like protein-like                   169   4e-48   Solanum tuberosum [potatoes]
gb|KJB74488.1|  hypothetical protein B456_011G181100                    166   4e-47   Gossypium raimondii
ref|XP_009402474.1|  PREDICTED: BI1-like protein                        161   4e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568491.1|  PREDICTED: BI1-like protein                        161   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_004243681.1|  PREDICTED: BI1-like protein                        159   2e-44   Solanum lycopersicum
ref|XP_006654376.1|  PREDICTED: BI1-like protein-like                   159   4e-44   Oryza brachyantha
ref|NP_001055493.1|  Os05g0402300                                       159   4e-44   
ref|NP_001149877.1|  transmembrane BAX inhibitor motif-containing...    156   6e-43   Zea mays [maize]
ref|XP_004962144.1|  PREDICTED: BI1-like protein-like                   155   8e-43   Setaria italica
gb|EMS67433.1|  hypothetical protein TRIUR3_20458                       155   1e-42   Triticum urartu
ref|NP_001149641.1|  transmembrane BAX inhibitor motif-containing...    152   1e-41   
gb|ACG33127.1|  transmembrane BAX inhibitor motif-containing prot...    152   2e-41   Zea mays [maize]
gb|ABK25077.1|  unknown                                                 144   2e-38   Picea sitchensis
ref|XP_002975127.1|  hypothetical protein SELMODRAFT_150230             143   2e-38   Selaginella moellendorffii
ref|XP_001768622.1|  predicted protein                                  141   2e-37   Physcomitrella patens
ref|XP_001757037.1|  predicted protein                                  139   1e-36   Physcomitrella patens
gb|AFW77940.1|  hypothetical protein ZEAMMB73_292541                    135   2e-35   Zea mays [maize]
ref|XP_002968030.1|  hypothetical protein SELMODRAFT_88443              135   3e-35   Selaginella moellendorffii
ref|XP_002992613.1|  hypothetical protein SELMODRAFT_430816             135   3e-35   Selaginella moellendorffii
emb|CAI53895.2|  putative receptor associated protein                   134   1e-34   Capsicum chinense [Scotch bonnet]
ref|XP_006349714.1|  PREDICTED: BI1-like protein-like                   133   2e-34   
ref|XP_010326401.1|  PREDICTED: BI1-like protein                        133   3e-34   Solanum lycopersicum
gb|AIT42146.1|  Bax inhibitor-like protein                              133   3e-34   Solanum tuberosum [potatoes]
ref|XP_008786054.1|  PREDICTED: BI1-like protein                        132   3e-34   Phoenix dactylifera
ref|XP_004290629.1|  PREDICTED: BI1-like protein                        132   5e-34   Fragaria vesca subsp. vesca
ref|XP_001768467.1|  predicted protein                                  132   7e-34   Physcomitrella patens
ref|XP_009618293.1|  PREDICTED: BI1-like protein                        131   9e-34   Nicotiana tomentosiformis
ref|XP_010923520.1|  PREDICTED: BI1-like protein                        131   1e-33   
ref|XP_009789970.1|  PREDICTED: BI1-like protein                        131   1e-33   Nicotiana sylvestris
gb|KFK35489.1|  hypothetical protein AALP_AA5G291100                    131   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006303615.1|  hypothetical protein CARUB_v10011301mg             130   2e-33   Capsella rubella
ref|XP_006352761.1|  PREDICTED: BI1-like protein-like                   130   4e-33   Solanum tuberosum [potatoes]
ref|XP_004242346.2|  PREDICTED: BI1-like protein                        130   5e-33   Solanum lycopersicum
ref|XP_010457316.1|  PREDICTED: BI1-like protein                        129   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010481523.1|  PREDICTED: BI1-like protein                        129   7e-33   Camelina sativa [gold-of-pleasure]
emb|CDX89914.1|  BnaA10g01680D                                          129   8e-33   Brassica napus [oilseed rape]
ref|XP_009119572.1|  PREDICTED: BI1-like protein                        129   9e-33   Brassica rapa
ref|XP_002889434.1|  glutamate binding protein                          129   9e-33   Arabidopsis lyrata subsp. lyrata
ref|NP_171806.1|  protein lifeguard 4                                   129   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007200360.1|  hypothetical protein PRUPE_ppa010573mg             129   1e-32   Prunus persica
ref|XP_006402289.1|  hypothetical protein EUTSA_v10006212mg             128   1e-32   Eutrema salsugineum
ref|XP_010474912.1|  PREDICTED: BI1-like protein                        128   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009398556.1|  PREDICTED: BI1-like protein                        128   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010474910.1|  PREDICTED: BI1-like protein                        128   2e-32   Camelina sativa [gold-of-pleasure]
gb|KCW60898.1|  hypothetical protein EUGRSUZ_H03636                     129   2e-32   Eucalyptus grandis [rose gum]
emb|CDY18147.1|  BnaC05g01700D                                          128   3e-32   Brassica napus [oilseed rape]
ref|XP_006418268.1|  hypothetical protein EUTSA_v10008600mg             127   3e-32   Eutrema salsugineum
ref|XP_010256169.1|  PREDICTED: BI1-like protein                        127   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002463744.1|  hypothetical protein SORBIDRAFT_01g005260          126   7e-32   Sorghum bicolor [broomcorn]
gb|KFK42668.1|  hypothetical protein AALP_AA1G024300                    126   8e-32   Arabis alpina [alpine rockcress]
ref|XP_008235367.1|  PREDICTED: BI1-like protein                        126   1e-31   Prunus mume [ume]
ref|XP_004981439.1|  PREDICTED: BI1-like protein-like                   126   1e-31   Setaria italica
ref|XP_010545100.1|  PREDICTED: BI1-like protein                        126   1e-31   Tarenaya hassleriana [spider flower]
gb|ACG32419.1|  transmembrane BAX inhibitor motif-containing prot...    125   1e-31   Zea mays [maize]
gb|KDP21410.1|  hypothetical protein JCGZ_21881                         125   2e-31   Jatropha curcas
ref|XP_009804930.1|  PREDICTED: BI1-like protein                        125   2e-31   Nicotiana sylvestris
ref|XP_011082582.1|  PREDICTED: BI1-like protein                        125   2e-31   Sesamum indicum [beniseed]
emb|CDP03667.1|  unnamed protein product                                125   2e-31   Coffea canephora [robusta coffee]
ref|XP_010259137.1|  PREDICTED: BI1-like protein                        125   3e-31   Nelumbo nucifera [Indian lotus]
ref|NP_001149171.1|  transmembrane BAX inhibitor motif-containing...    125   3e-31   Zea mays [maize]
ref|XP_010038064.1|  PREDICTED: BI1-like protein                        124   5e-31   Eucalyptus grandis [rose gum]
ref|XP_003632329.1|  PREDICTED: BI1-like protein                        124   5e-31   Vitis vinifera
ref|XP_010679114.1|  PREDICTED: BI1-like protein                        124   5e-31   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010070336.1|  PREDICTED: BI1-like protein                        124   5e-31   Eucalyptus grandis [rose gum]
ref|XP_010556773.1|  PREDICTED: BI1-like protein                        124   6e-31   Tarenaya hassleriana [spider flower]
emb|CDX93913.1|  BnaC04g20720D                                          124   7e-31   Brassica napus [oilseed rape]
gb|KJB34592.1|  hypothetical protein B456_006G074200                    129   7e-31   Gossypium raimondii
ref|XP_003553470.1|  PREDICTED: BI1-like protein-like isoform X1        124   8e-31   Glycine max [soybeans]
emb|CDY53716.1|  BnaAnng12570D                                          123   9e-31   Brassica napus [oilseed rape]
gb|EYU46520.1|  hypothetical protein MIMGU_mgv11b010581mg               123   1e-30   Erythranthe guttata [common monkey flower]
ref|NP_192178.1|  BAX inhibitor-1 motif-containing protein              123   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495172.1|  PREDICTED: BI1-like protein-like                   123   1e-30   Cicer arietinum [garbanzo]
ref|NP_001149807.1|  transmembrane BAX inhibitor motif-containing...    123   1e-30   Zea mays [maize]
ref|XP_009144548.1|  PREDICTED: BI1-like protein                        123   1e-30   Brassica rapa
emb|CDX91308.1|  BnaC02g27190D                                          123   2e-30   Brassica napus [oilseed rape]
emb|CDX97282.1|  BnaA02g20730D                                          123   2e-30   Brassica napus [oilseed rape]
gb|EMS49504.1|  hypothetical protein TRIUR3_04678                       122   2e-30   Triticum urartu
ref|XP_010092433.1|  hypothetical protein L484_009115                   123   2e-30   Morus notabilis
ref|XP_006396483.1|  hypothetical protein EUTSA_v10028915mg             122   2e-30   Eutrema salsugineum
gb|EYU40897.1|  hypothetical protein MIMGU_mgv1a012728mg                122   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_006292690.1|  hypothetical protein CARUB_v10018936mg             122   3e-30   Capsella rubella
ref|XP_006443997.1|  hypothetical protein CICLE_v10021936mg             122   3e-30   Citrus clementina
ref|XP_002283304.2|  PREDICTED: BI1-like protein                        122   4e-30   Vitis vinifera
gb|KJB22579.1|  hypothetical protein B456_004G056000                    122   4e-30   Gossypium raimondii
ref|XP_002307607.1|  hypothetical protein POPTR_0005s23570g             122   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003557479.1|  PREDICTED: BI1-like protein                        121   6e-30   Brachypodium distachyon [annual false brome]
gb|EPS72667.1|  hypothetical protein M569_02091                         121   6e-30   Genlisea aurea
ref|XP_009601840.1|  PREDICTED: BI1-like protein isoform X1             121   7e-30   Nicotiana tomentosiformis
emb|CDM85340.1|  unnamed protein product                                121   9e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010695291.1|  PREDICTED: BI1-like protein                        120   1e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002874901.1|  glutamate binding protein                          121   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_002524726.1|  Transmembrane BAX inhibitor motif-containing...    120   1e-29   Ricinus communis
ref|XP_009138661.1|  PREDICTED: BI1-like protein                        120   1e-29   Brassica rapa
ref|XP_002312548.2|  hypothetical protein POPTR_0008s15690g             119   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002878509.1|  glutamate binding protein                          120   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_011032646.1|  PREDICTED: BI1-like protein                        120   1e-29   Populus euphratica
ref|NP_191890.1|  BRZ-INSENSITIVE-LONG HYPOCOTYLS 4                     120   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422556.1|  PREDICTED: BI1-like protein                        120   2e-29   Camelina sativa [gold-of-pleasure]
gb|KDO74482.1|  hypothetical protein CISIN_1g026616mg                   120   2e-29   Citrus sinensis [Valencia orange]
ref|XP_002300819.1|  hypothetical protein POPTR_0002s04980g             120   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010512744.1|  PREDICTED: BI1-like protein                        120   2e-29   Camelina sativa [gold-of-pleasure]
gb|AFK43813.1|  unknown                                                 119   2e-29   Medicago truncatula
ref|XP_007050515.1|  Bax inhibitor-1 family protein                     120   2e-29   Theobroma cacao [chocolate]
gb|KHG09280.1|  hypothetical protein F383_07618                         120   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010026938.1|  PREDICTED: BI1-like protein                        120   2e-29   Eucalyptus grandis [rose gum]
ref|XP_006288281.1|  hypothetical protein CARUB_v10001524mg             121   3e-29   Capsella rubella
ref|XP_011079906.1|  PREDICTED: BI1-like protein                        120   3e-29   Sesamum indicum [beniseed]
ref|XP_007144660.1|  hypothetical protein PHAVU_007G174500g             119   3e-29   Phaseolus vulgaris [French bean]
ref|XP_006420012.1|  hypothetical protein CICLE_v10006442mg             119   3e-29   Citrus clementina
ref|XP_003590585.1|  BI1-like protein                                   119   3e-29   Medicago truncatula
gb|KFK30873.1|  hypothetical protein AALP_AA6G036900                    119   4e-29   Arabis alpina [alpine rockcress]
ref|XP_004145423.1|  PREDICTED: BI1-like protein-like                   119   4e-29   Cucumis sativus [cucumbers]
emb|CBI28738.3|  unnamed protein product                                119   4e-29   Vitis vinifera
ref|XP_010932816.1|  PREDICTED: BI1-like protein                        119   4e-29   Elaeis guineensis
ref|XP_003559738.1|  PREDICTED: BI1-like protein                        119   4e-29   Brachypodium distachyon [annual false brome]
ref|XP_010455996.1|  PREDICTED: BI1-like protein                        119   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010430038.1|  PREDICTED: BI1-like protein                        119   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002466473.1|  hypothetical protein SORBIDRAFT_01g008350          119   5e-29   Sorghum bicolor [broomcorn]
ref|NP_001059026.1|  Os07g0177300                                       119   5e-29   
ref|XP_009367582.1|  PREDICTED: BI1-like protein                        119   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_011026112.1|  PREDICTED: BI1-like protein isoform X1             119   5e-29   Populus euphratica
ref|XP_011027040.1|  PREDICTED: BI1-like protein                        119   6e-29   Populus euphratica
ref|XP_009402334.1|  PREDICTED: BI1-like protein                        119   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH23825.1|  inhibitor of apoptosis-promoting Bax1 protein           118   7e-29   Medicago truncatula
ref|XP_008665403.1|  PREDICTED: BI1-like protein                        119   7e-29   Zea mays [maize]
ref|XP_011399245.1|  BI1-like protein                                   119   7e-29   Auxenochlorella protothecoides
ref|XP_008789734.1|  PREDICTED: BI1-like protein                        118   9e-29   Phoenix dactylifera
gb|EMS50944.1|  hypothetical protein TRIUR3_13925                       119   9e-29   Triticum urartu
ref|XP_008386439.1|  PREDICTED: BI1-like protein                        118   9e-29   Malus domestica [apple tree]
ref|XP_008449318.1|  PREDICTED: BI1-like protein                        118   1e-28   Cucumis melo [Oriental melon]
ref|XP_002966079.1|  hypothetical protein SELMODRAFT_84281              117   1e-28   Selaginella moellendorffii
ref|XP_002971406.1|  hypothetical protein SELMODRAFT_95705              117   1e-28   Selaginella moellendorffii
ref|XP_006657498.1|  PREDICTED: BI1-like protein-like                   118   1e-28   Oryza brachyantha
gb|ABK27003.1|  unknown                                                 118   1e-28   Picea sitchensis
ref|NP_001237340.1|  uncharacterized protein LOC100527528               117   2e-28   Glycine max [soybeans]
gb|EMT04947.1|  hypothetical protein F775_08799                         117   2e-28   Aegilops tauschii
ref|XP_003518904.1|  PREDICTED: BI1-like protein-like                   117   2e-28   Glycine max [soybeans]
ref|XP_008775649.1|  PREDICTED: BI1-like protein                        117   2e-28   Phoenix dactylifera
gb|EMT04950.1|  hypothetical protein F775_18737                         117   3e-28   Aegilops tauschii
gb|EMT30807.1|  hypothetical protein F775_10013                         117   3e-28   Aegilops tauschii
ref|XP_006650573.1|  PREDICTED: BI1-like protein-like                   116   4e-28   Oryza brachyantha
ref|XP_006650725.1|  PREDICTED: BI1-like protein-like                   116   6e-28   Oryza brachyantha
ref|XP_010096442.1|  hypothetical protein L484_002350                   116   6e-28   Morus notabilis
emb|CDM85336.1|  unnamed protein product                                116   7e-28   Triticum aestivum [Canadian hard winter wheat]
gb|EMS57375.1|  hypothetical protein TRIUR3_34180                       116   7e-28   Triticum urartu
gb|KHG20710.1|  hypothetical protein F383_10571                         115   8e-28   Gossypium arboreum [tree cotton]
ref|XP_004955618.1|  PREDICTED: BI1-like protein-like                   116   9e-28   Setaria italica
gb|KJB23000.1|  hypothetical protein B456_004G077400                    115   1e-27   Gossypium raimondii
gb|ACU19259.1|  unknown                                                 115   1e-27   Glycine max [soybeans]
ref|XP_010024226.1|  PREDICTED: BI1-like protein                        115   1e-27   Eucalyptus grandis [rose gum]
gb|EPS70625.1|  hypothetical protein M569_04132                         115   1e-27   Genlisea aurea
emb|CDM85345.1|  unnamed protein product                                115   2e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004493722.1|  PREDICTED: BI1-like protein-like                   114   2e-27   Cicer arietinum [garbanzo]
ref|XP_007162464.1|  hypothetical protein PHAVU_001G154500g             114   4e-27   Phaseolus vulgaris [French bean]
ref|NP_001130584.1|  uncharacterized protein LOC100191683               114   4e-27   Zea mays [maize]
ref|XP_009410985.1|  PREDICTED: BI1-like protein                        114   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG33000.1|  transmembrane BAX inhibitor motif-containing prot...    114   5e-27   Zea mays [maize]
ref|NP_001051551.1|  Os03g0795800                                       114   5e-27   
ref|XP_003557492.1|  PREDICTED: BI1-like protein                        114   6e-27   Brachypodium distachyon [annual false brome]
emb|CBI26304.3|  unnamed protein product                                113   6e-27   Vitis vinifera
emb|CDM86339.1|  unnamed protein product                                113   7e-27   Triticum aestivum [Canadian hard winter wheat]
gb|KJB23003.1|  hypothetical protein B456_004G077400                    113   8e-27   Gossypium raimondii
dbj|BAK00103.1|  predicted protein                                      113   1e-26   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002461535.1|  hypothetical protein SORBIDRAFT_02g004350          113   1e-26   Sorghum bicolor [broomcorn]
ref|XP_008355439.1|  PREDICTED: BI1-like protein                        112   1e-26   Malus domestica [apple tree]
ref|NP_193209.2|  Bax inhibitor-1 family protein                        112   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16790.1|  unknown                                                 112   2e-26   Picea sitchensis
ref|XP_002870289.1|  hypothetical protein ARALYDRAFT_355323             112   2e-26   Arabidopsis lyrata subsp. lyrata
ref|NP_001151352.1|  transmembrane BAX inhibitor motif-containing...    112   2e-26   Zea mays [maize]
gb|AFW67649.1|  transmembrane BAX inhibitor motif protein-contain...    112   2e-26   Zea mays [maize]
ref|XP_004981803.1|  PREDICTED: BI1-like protein-like                   112   3e-26   Setaria italica
gb|KJB23001.1|  hypothetical protein B456_004G077400                    110   3e-26   Gossypium raimondii
gb|KDD74103.1|  inhibitor of apoptosis-promoting Bax1                   111   4e-26   Helicosporidium sp. ATCC 50920
gb|KDO74902.1|  hypothetical protein CISIN_1g0265232mg                  108   4e-26   Citrus sinensis [Valencia orange]
ref|XP_010923521.1|  PREDICTED: BI1-like protein                        111   4e-26   Elaeis guineensis
gb|KJB23002.1|  hypothetical protein B456_004G077400                    110   4e-26   Gossypium raimondii
tpg|DAA59750.1|  TPA: hypothetical protein ZEAMMB73_617181              109   6e-26   Zea mays [maize]
ref|XP_008786053.1|  PREDICTED: BI1-like protein                        110   1e-25   Phoenix dactylifera
ref|XP_009419748.1|  PREDICTED: BI1-like protein                        110   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009370780.1|  PREDICTED: BI1-like protein                        109   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_006286105.1|  hypothetical protein CARUB_v10007653mg             108   7e-25   Capsella rubella
ref|XP_011079979.1|  PREDICTED: BI1-like protein                        108   7e-25   Sesamum indicum [beniseed]
gb|KFK22589.1|  hypothetical protein AALP_AAs43532U000100               108   7e-25   Arabis alpina [alpine rockcress]
ref|XP_009413900.1|  PREDICTED: BI1-like protein                        108   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008368927.1|  PREDICTED: BI1-like protein                        108   9e-25   
emb|CAN81203.1|  hypothetical protein VITISV_035442                     107   9e-25   Vitis vinifera
ref|XP_009413899.1|  PREDICTED: BI1-like protein                        107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003561356.1|  PREDICTED: BI1-like protein isoform X2             107   2e-24   Brachypodium distachyon [annual false brome]
ref|NP_001051246.2|  Os03g0745600                                       107   2e-24   
ref|XP_004309714.1|  PREDICTED: BI1-like protein                        107   2e-24   Fragaria vesca subsp. vesca
ref|XP_010450003.1|  PREDICTED: BI1-like protein                        106   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_005849730.1|  hypothetical protein CHLNCDRAFT_59619              106   3e-24   Chlorella variabilis
ref|XP_010440403.1|  PREDICTED: BI1-like protein                        106   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002463745.1|  hypothetical protein SORBIDRAFT_01g005270          106   4e-24   Sorghum bicolor [broomcorn]
ref|XP_007142929.1|  hypothetical protein PHAVU_007G029100g             105   7e-24   Phaseolus vulgaris [French bean]
gb|AAK71568.1|AC087852_28  putative receptor-associated protein         104   9e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010497467.1|  PREDICTED: BI1-like protein                        102   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004145382.1|  PREDICTED: BI1-like protein-like                   103   2e-23   
ref|XP_010435077.1|  PREDICTED: BI1-like protein                        103   3e-23   Camelina sativa [gold-of-pleasure]
ref|NP_001136515.1|  uncharacterized protein LOC100216630               103   3e-23   Zea mays [maize]
gb|EAY92177.1|  hypothetical protein OsI_13891                          102   4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_008449342.1|  PREDICTED: BI1-like protein                        103   4e-23   Cucumis melo [Oriental melon]
ref|XP_010932815.1|  PREDICTED: BI1-like protein                        103   5e-23   Elaeis guineensis
ref|NP_001051550.1|  Os03g0795600                                       103   5e-23   
ref|XP_006414652.1|  hypothetical protein EUTSA_v10026089mg             103   6e-23   Eutrema salsugineum
gb|EAY92172.1|  hypothetical protein OsI_13886                          102   6e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_005647458.1|  UPF0005-domain-containing protein                  102   7e-23   Coccomyxa subellipsoidea C-169
gb|ACJ68113.1|  hypothetical protein                                    102   8e-23   
ref|XP_009148344.1|  PREDICTED: BI1-like protein                        102   9e-23   
ref|XP_010228294.1|  PREDICTED: BI1-like protein isoform X1             103   1e-22   
ref|XP_006838960.1|  hypothetical protein AMTR_s00002p00271010          101   2e-22   
ref|XP_003592636.1|  Transmembrane BAX inhibitor motif-containing...    101   2e-22   
ref|XP_004497074.1|  PREDICTED: BI1-like protein-like                   101   2e-22   
ref|XP_009417103.1|  PREDICTED: BI1-like protein                        101   3e-22   
ref|XP_007226041.1|  hypothetical protein PRUPE_ppa010563mg             100   4e-22   
ref|XP_003535722.1|  PREDICTED: BI1-like protein-like                   100   4e-22   
gb|KJB25942.1|  hypothetical protein B456_004G217400                    100   4e-22   
emb|CDY16255.1|  BnaC01g22900D                                          100   6e-22   
ref|XP_004981440.1|  PREDICTED: BI1-like protein-like                 99.8    9e-22   
ref|XP_008224251.1|  PREDICTED: BI1-like protein                      99.4    1e-21   
gb|AFK47143.1|  unknown                                               96.7    3e-21   
ref|XP_006363485.1|  PREDICTED: BI1-like protein-like                 98.6    3e-21   
ref|XP_009343941.1|  PREDICTED: BI1-like protein                      97.1    7e-21   
emb|CDO99103.1|  unnamed protein product                              96.7    1e-20   
ref|XP_008390943.1|  PREDICTED: BI1-like protein                      96.3    1e-20   
ref|XP_008367186.1|  PREDICTED: BI1-like protein                      95.9    2e-20   
dbj|BAK05072.1|  predicted protein                                    95.1    4e-20   
ref|XP_002524728.1|  Transmembrane BAX inhibitor motif-containing...  94.7    6e-20   
ref|XP_003555237.1|  PREDICTED: BI1-like protein-like                 94.4    7e-20   
emb|CAB10325.1|  hypothetical protein                                 96.3    3e-19   
gb|EMT02672.1|  hypothetical protein F775_19037                       92.8    3e-19   
ref|XP_008807245.1|  PREDICTED: BI1-like protein isoform X2           92.0    6e-19   
ref|XP_010326728.1|  PREDICTED: BI1-like protein                      91.7    7e-19   
ref|XP_002307606.2|  hypothetical protein POPTR_0005s23560g           91.7    8e-19   
gb|EYU30338.1|  hypothetical protein MIMGU_mgv1a019280mg              91.3    8e-19   
ref|XP_009601841.1|  PREDICTED: BI1-like protein isoform X2           91.3    8e-19   
ref|XP_006650724.1|  PREDICTED: BI1-like protein-like                 90.9    1e-18   
ref|XP_011032647.1|  PREDICTED: BI1-like protein                      90.9    1e-18   
gb|KHN11404.1|  BI1-like protein                                      90.5    2e-18   
gb|EYU46519.1|  hypothetical protein MIMGU_mgv1a012770mg              90.1    3e-18   
ref|XP_003559313.1|  PREDICTED: BI1-like protein                      89.7    4e-18   
ref|XP_004297970.1|  PREDICTED: BI1-like protein                      88.6    8e-18   
emb|CDM85337.1|  unnamed protein product                              88.2    1e-17   
gb|KEH23822.1|  inhibitor of apoptosis-promoting Bax1 protein         87.4    2e-17   
ref|XP_009631099.1|  PREDICTED: BI1-like protein                      87.4    2e-17   
ref|XP_004979563.1|  PREDICTED: BI1-like protein-like                 87.0    4e-17   
ref|XP_008807244.1|  PREDICTED: BI1-like protein isoform X1           86.3    6e-17   
gb|KHN02553.1|  BI1-like protein                                      85.9    7e-17   
gb|AFW65316.1|  hypothetical protein ZEAMMB73_585427                  85.9    8e-17   
gb|AFW65317.1|  hypothetical protein ZEAMMB73_585427                  85.5    1e-16   
ref|XP_003575924.1|  PREDICTED: BI1-like protein isoform X1           85.1    2e-16   
ref|XP_009796306.1|  PREDICTED: BI1-like protein                      84.3    3e-16   
gb|KEH23817.1|  inhibitor of apoptosis-promoting Bax1 protein         84.0    4e-16   
gb|EMT04948.1|  hypothetical protein F775_23516                       83.6    5e-16   
gb|KEH23815.1|  inhibitor of apoptosis-promoting Bax1 protein         82.4    1e-15   
gb|EYU23690.1|  hypothetical protein MIMGU_mgv1a012711mg              81.6    2e-15   
ref|XP_002451016.1|  hypothetical protein SORBIDRAFT_05g022690        81.3    3e-15   
gb|EMS49503.1|  hypothetical protein TRIUR3_04677                     79.7    6e-15   
ref|XP_002524727.1|  Transmembrane BAX inhibitor motif-containing...  79.7    9e-15   
ref|XP_008390989.1|  PREDICTED: BI1-like protein                      79.3    1e-14   
dbj|BAC83444.1|  putative z-protein                                   79.7    1e-14   
gb|EEC81607.1|  hypothetical protein OsI_25099                        79.3    1e-14   
ref|NP_001059025.2|  Os07g0177200                                     79.3    1e-14   
gb|KDO38627.1|  hypothetical protein CISIN_1g043748mg                 76.3    3e-14   
ref|XP_011458590.1|  PREDICTED: BI1-like protein                      76.6    1e-13   
ref|XP_011307519.1|  PREDICTED: protein lifeguard 4-like              73.2    2e-12   
gb|EMT05505.1|  hypothetical protein F775_18457                       72.4    2e-12   
ref|XP_011026113.1|  PREDICTED: BI1-like protein isoform X2           72.4    2e-12   
ref|XP_006663554.1|  PREDICTED: BI1-like protein-like                 71.2    1e-11   
tpg|DAA51896.1|  TPA: hypothetical protein ZEAMMB73_897912            69.3    1e-11   
tpg|DAA59749.1|  TPA: hypothetical protein ZEAMMB73_617181            69.7    2e-11   
ref|XP_011159251.1|  PREDICTED: protein lifeguard 4-like              69.3    4e-11   
ref|XP_006657497.1|  PREDICTED: BI1-like protein-like                 68.6    4e-11   
gb|EEC68424.1|  hypothetical protein OsI_36602                        68.9    6e-11   
ref|NP_001068154.1|  Os11g0581900                                     68.9    6e-11   
ref|XP_001757696.1|  predicted protein                                67.8    8e-11   
ref|XP_010791836.1|  PREDICTED: protein lifeguard 4                   66.6    3e-10   
gb|EMS68250.1|  hypothetical protein TRIUR3_19365                     66.6    6e-10   
ref|XP_011059322.1|  PREDICTED: protein lifeguard 4-like              65.9    6e-10   
ref|XP_005989484.1|  PREDICTED: protein lifeguard 4                   65.9    7e-10   
ref|XP_005709020.1|  transmembrane BAX inhibitor motif containing...  65.9    8e-10   
ref|XP_003455683.2|  PREDICTED: protein lifeguard 4-like              65.9    8e-10   
ref|XP_010897266.1|  PREDICTED: protein lifeguard 4                   64.7    2e-09   
ref|XP_007259801.1|  PREDICTED: protein lifeguard 4-like              64.3    2e-09   
ref|NP_998303.2|  protein lifeguard 4 isoform 1                       64.3    2e-09   
ref|NP_570396.1|  CMLV006                                             63.9    3e-09   
ref|XP_007848574.1|  glutamate binding protein                        64.3    4e-09   
ref|XP_011254402.1|  PREDICTED: protein lifeguard 4-like              63.5    4e-09   
ref|NP_001089282.1|  transmembrane BAX inhibitor motif containing 4   63.5    5e-09   
ref|XP_004573137.1|  PREDICTED: protein lifeguard 4-like              63.9    5e-09   
ref|XP_011150726.1|  PREDICTED: protein lifeguard 4-like isoform X3   63.2    6e-09   
ref|XP_011150725.1|  PREDICTED: protein lifeguard 4-like isoform X2   63.5    7e-09   
ref|XP_011150724.1|  PREDICTED: protein lifeguard 4-like isoform X1   63.5    7e-09   
gb|EMT02671.1|  hypothetical protein F775_31127                       63.2    1e-08   
gb|AAG37461.1|  CMP6L                                                 62.0    1e-08   
ref|XP_011329701.1|  PREDICTED: protein lifeguard 4-like              62.0    2e-08   
ref|XP_005295606.1|  PREDICTED: protein lifeguard 4                   62.0    2e-08   
ref|XP_006130256.1|  PREDICTED: protein lifeguard 4                   61.6    2e-08   
ref|NP_954547.1|  protein lifeguard 4                                 61.6    2e-08   
gb|ACO09924.1|  Transmembrane BAX inhibitor motif-containing prot...  61.6    2e-08   
ref|XP_005933883.1|  PREDICTED: protein lifeguard 4-like              61.6    2e-08   
ref|XP_006799805.1|  PREDICTED: protein lifeguard 4-like              61.2    2e-08   
ref|XP_005519389.1|  PREDICTED: protein lifeguard 4                   61.2    3e-08   
gb|ADZ30183.1|  TNF-alpha-receptor-like protein                       60.8    3e-08   
dbj|BAM18153.1|  N-methyl-D-aspartate receptor-associated protein     61.2    4e-08   
ref|XP_004700531.1|  PREDICTED: protein lifeguard 4                   60.8    4e-08   
ref|XP_003590586.1|  BI1-like protein                                 59.7    4e-08   
ref|XP_003385460.1|  PREDICTED: protein lifeguard 4-like              60.5    5e-08   
gb|ADZ29755.1|  NMDA receptor-like protein                            60.5    5e-08   
ref|XP_010083044.1|  PREDICTED: LOW QUALITY PROTEIN: protein life...  60.5    9e-08   
emb|CDX98559.1|  BnaC05g38160D                                        57.8    1e-07   
gb|EWM23688.1|  transmembrane bax inhibitor motif-containing prot...  60.5    1e-07   
ref|XP_003798583.1|  PREDICTED: protein lifeguard 4 isoform 2         58.2    2e-07   
gb|KFW83144.1|  Protein lifeguard 4                                   59.3    2e-07   
ref|XP_008924810.1|  PREDICTED: protein lifeguard 4                   59.3    2e-07   
ref|XP_002130837.1|  PREDICTED: protein lifeguard 4-like              58.9    2e-07   
emb|CDY49039.1|  BnaA01g22850D                                        58.2    2e-07   
ref|XP_001235093.1|  PREDICTED: protein lifeguard 4                   58.9    2e-07   
emb|CAD90752.1|  T1R protein                                          58.5    2e-07   
ref|NP_080893.1|  protein lifeguard 4                                 58.9    2e-07   
gb|ADZ29327.1|  NMDA receptor-like protein                            58.5    3e-07   
ref|XP_008314213.1|  PREDICTED: protein lifeguard 4                   58.5    3e-07   
ref|NP_001279731.1|  transmembrane BAX inhibitor motif containing 4   58.5    3e-07   
gb|AAW21699.1|  Golgi anti-apoptotic protein                          58.2    3e-07   
sp|Q49P94.1|GAAP_VACCL  RecName: Full=Golgi anti-apoptotic protei...  58.2    3e-07   
gb|AAV98625.1|  Golgi anti-apoptotic protein                          58.2    4e-07   
ref|XP_006259337.1|  PREDICTED: protein lifeguard 4                   58.2    4e-07   
ref|XP_003798582.1|  PREDICTED: protein lifeguard 4 isoform 1         58.2    4e-07   
gb|ACO15172.1|  Transmembrane BAX inhibitor motif-containing prot...  58.2    4e-07   
gb|EMP28487.1|  Transmembrane BAX inhibitor motif-containing prot...  57.4    4e-07   
ref|XP_007864171.1|  UPF0005-domain-containing protein                58.5    4e-07   
emb|CBJ28269.1|  Homologue of a Golgi anti-apoptotic protein iden...  58.5    5e-07   
ref|XP_006022537.1|  PREDICTED: protein lifeguard 4                   58.2    5e-07   
gb|ERE92110.1|  transmembrane BAX inhibitor motif-containing prot...  56.6    5e-07   
gb|KFQ95554.1|  Protein lifeguard 4                                   57.8    5e-07   
ref|XP_009461489.1|  PREDICTED: protein lifeguard 4                   57.8    6e-07   
gb|AFK47976.1|  unknown                                               55.1    6e-07   
ref|XP_010753211.1|  PREDICTED: protein lifeguard 4                   56.6    6e-07   
ref|XP_010411952.1|  PREDICTED: protein lifeguard 4                   57.4    6e-07   
ref|NP_001187457.1|  transmembrane bax inhibitor motif-containing...  57.4    7e-07   
gb|ADZ30397.1|  NMDA receptor-like protein                            57.4    7e-07   
gb|KEH23818.1|  inhibitor of apoptosis-promoting Bax1 protein         55.1    7e-07   
ref|XP_007067592.1|  PREDICTED: protein lifeguard 4                   57.0    8e-07   
ref|XP_003224670.1|  PREDICTED: protein lifeguard 4                   57.4    8e-07   
ref|XP_007421419.1|  PREDICTED: protein lifeguard 4                   57.0    9e-07   
ref|XP_008066860.1|  PREDICTED: protein lifeguard 4-like              57.0    9e-07   
ref|XP_004675981.1|  PREDICTED: protein lifeguard 4                   57.0    9e-07   
gb|ADZ24213.1|  NMDA receptor-like protein                            57.0    9e-07   
gb|KCW58779.1|  hypothetical protein EUGRSUZ_H014131                  55.5    1e-06   
ref|XP_007082282.1|  PREDICTED: protein lifeguard 4                   57.0    1e-06   
gb|KIK27569.1|  hypothetical protein PISMIDRAFT_674439                57.4    1e-06   
ref|XP_005141851.1|  PREDICTED: protein lifeguard 4-like              57.0    1e-06   
gb|KFQ56216.1|  Protein lifeguard 4                                   57.0    1e-06   
ref|XP_002162929.2|  PREDICTED: protein lifeguard 4-like              55.5    1e-06   
ref|XP_005480627.1|  PREDICTED: protein lifeguard 4                   57.0    1e-06   
ref|XP_009093312.1|  PREDICTED: protein lifeguard 4                   57.0    1e-06   
ref|XP_003497176.1|  PREDICTED: protein lifeguard 4                   57.0    1e-06   
ref|XP_001986333.1|  GH21301                                          57.4    1e-06   
ref|NP_001232150.1|  putative transmembrane BAX inhibitor motif c...  56.6    1e-06   
ref|XP_003989054.1|  PREDICTED: protein lifeguard 4                   56.6    1e-06   
ref|XP_010706128.1|  PREDICTED: protein lifeguard 4 isoform X1        56.6    1e-06   
ref|XP_001605147.1|  PREDICTED: protein lifeguard 4-like              57.0    1e-06   
ref|XP_010560256.1|  PREDICTED: protein lifeguard 4                   57.4    1e-06   
ref|XP_010185696.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|XP_004923036.1|  PREDICTED: protein lifeguard 4-like              56.6    2e-06   
ref|XP_011073458.1|  PREDICTED: BI1-like protein                      55.1    2e-06   
ref|XP_002924755.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
ref|XP_011418870.1|  PREDICTED: protein lifeguard 4-like isoform X1   56.2    2e-06   
ref|XP_001986335.1|  GH21302                                          56.6    2e-06   
gb|KFQ30283.1|  Protein lifeguard 4                                   56.2    2e-06   
gb|KIJ18531.1|  hypothetical protein PAXINDRAFT_167135                56.6    2e-06   
ref|XP_011418871.1|  PREDICTED: protein lifeguard 4-like isoform X2   56.2    2e-06   
gb|EHJ65865.1|  hypothetical protein KGM_10827                        56.2    2e-06   
ref|XP_005026809.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|XP_006973410.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|XP_010134037.1|  PREDICTED: protein lifeguard 4                   55.5    3e-06   
ref|NP_001004879.1|  transmembrane BAX inhibitor motif containing 4   55.8    3e-06   
ref|XP_005763132.1|  hypothetical protein EMIHUDRAFT_358129           56.2    3e-06   
ref|XP_007381152.1|  UPF0005-domain-containing protein                56.2    3e-06   
gb|KFP72715.1|  Protein lifeguard 4                                   55.5    3e-06   
ref|XP_006886128.1|  PREDICTED: protein lifeguard 4 isoform X2        55.5    3e-06   
ref|XP_009080879.1|  PREDICTED: protein lifeguard 4                   55.1    3e-06   
ref|XP_003327732.1|  hypothetical protein PGTG_09266                  55.8    4e-06   
gb|ACO10701.1|  Transmembrane BAX inhibitor motif-containing prot...  55.5    4e-06   
ref|XP_005910418.1|  PREDICTED: protein lifeguard 4 isoform X3        54.3    4e-06   
ref|XP_010612014.1|  PREDICTED: protein lifeguard 4                   55.5    4e-06   
ref|XP_009045767.1|  hypothetical protein LOTGIDRAFT_137312           55.5    4e-06   
ref|XP_006923773.1|  PREDICTED: protein lifeguard 4                   55.5    4e-06   
emb|CDY28900.1|  BnaC06g26880D                                        52.4    4e-06   
ref|XP_005761881.1|  hypothetical protein EMIHUDRAFT_350606           55.5    5e-06   
emb|CCG81377.1|  Bax Inhibitor family protein                         55.5    5e-06   
gb|KGL79168.1|  Protein lifeguard 4                                   54.7    5e-06   
gb|KFV96484.1|  Protein lifeguard 4                                   55.1    5e-06   
ref|XP_010300609.1|  PREDICTED: protein lifeguard 4                   54.7    5e-06   
ref|XP_010118322.1|  PREDICTED: protein lifeguard 4                   54.7    5e-06   
ref|XP_001510640.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
ref|XP_005039476.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
ref|XP_004797405.1|  PREDICTED: protein lifeguard 4                   55.5    5e-06   
ref|XP_009584963.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
ref|XP_005910417.1|  PREDICTED: protein lifeguard 4 isoform X2        54.3    6e-06   
ref|XP_010215686.1|  PREDICTED: protein lifeguard 4                   54.7    6e-06   
ref|XP_004650122.1|  PREDICTED: protein lifeguard 4                   55.1    6e-06   
ref|XP_003405231.1|  PREDICTED: protein lifeguard 4 isoform X1        55.1    6e-06   
ref|XP_004381598.1|  PREDICTED: protein lifeguard 4                   54.7    6e-06   
ref|XP_005081574.1|  PREDICTED: protein lifeguard 4                   54.7    6e-06   
ref|XP_009670069.1|  PREDICTED: protein lifeguard 4                   54.3    7e-06   
gb|EKC24718.1|  Transmembrane BAX inhibitor motif-containing prot...  55.1    7e-06   
ref|XP_011372108.1|  PREDICTED: protein lifeguard 4                   54.7    8e-06   
ref|NP_509543.2|  Protein TMBI-4                                      55.1    8e-06   
ref|XP_004752536.1|  PREDICTED: protein lifeguard 4                   54.7    8e-06   
emb|CBY18912.1|  unnamed protein product                              54.3    9e-06   
ref|XP_008827332.1|  PREDICTED: protein lifeguard 4                   54.3    1e-05   
gb|KIO09380.1|  hypothetical protein M404DRAFT_996201                 54.7    1e-05   
ref|XP_010839876.1|  PREDICTED: protein lifeguard 4                   54.3    1e-05   
ref|XP_009996070.1|  PREDICTED: protein lifeguard 4                   54.3    1e-05   
gb|KFU89672.1|  Protein lifeguard 4                                   53.9    1e-05   
emb|CDY20208.1|  BnaC09g30310D                                        53.1    1e-05   
gb|KIJ49475.1|  hypothetical protein M422DRAFT_27841                  54.3    1e-05   
gb|KDQ27563.1|  hypothetical protein PLEOSDRAFT_1089381               54.3    1e-05   
ref|XP_009929929.1|  PREDICTED: protein lifeguard 4                   54.3    1e-05   
ref|XP_005962412.1|  PREDICTED: protein lifeguard 4 isoform X1        53.9    1e-05   
ref|XP_001177352.1|  PREDICTED: protein lifeguard 4-like              53.9    1e-05   
ref|NP_001014914.1|  protein lifeguard 4                              53.5    2e-05   
ref|XP_004632254.1|  PREDICTED: protein lifeguard 4                   53.5    2e-05   
ref|XP_005242182.1|  PREDICTED: uncharacterized protein LOC101920265  54.7    2e-05   
ref|XP_007516917.1|  PREDICTED: protein lifeguard 4                   53.5    2e-05   
ref|XP_001865933.1|  fas apoptotic inhibitory molecule 2              53.9    2e-05   
ref|XP_009561645.1|  PREDICTED: protein lifeguard 4                   53.5    2e-05   



>ref|XP_009609402.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=246

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  D G+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTT+V+ V
Sbjct  1    MYGFTSLSTENDVGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTVVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLYAP+N++L+G+S LLL L+FLPF+LLWPLHVYQQ+HPLNF+FLGLFTASLS  V VS
Sbjct  61   TVLYAPINDLLRGNSGLLLVLIFLPFVLLWPLHVYQQKHPLNFVFLGLFTASLSLTVGVS  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEALILTSAVV ALTGYTFWA++KGKDF++LGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGKIVLEALILTSAVVSALTGYTFWASRKGKDFSYLGPILFTSLFVLILTGFMQMF  180

Query  609  FPL  617
            FPL
Sbjct  181  FPL  183



>ref|XP_009769831.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=246

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  D G+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTT+V+ V
Sbjct  1    MYGFTSLSTENDVGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTVVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLYAP+N++L+G+S LLL L+FLPF+LLWPLHVYQQ+HPLNF+FLGLFTASLS  V VS
Sbjct  61   TVLYAPINDLLRGNSGLLLVLIFLPFVLLWPLHVYQQKHPLNFVFLGLFTASLSLTVGVS  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEALILTSAVV ALTGYTFWA++KGKDF++LGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGKIVLEALILTSAVVSALTGYTFWASRKGKDFSYLGPILFTSLFVLILTGFMQMF  180

Query  609  FPL  617
            FPL
Sbjct  181  FPL  183



>ref|XP_006339425.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=246

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  DGG+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTTLV+ V
Sbjct  1    MYGFTSLSTESDGGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTLVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N++L+GS  LLL LVFLPF+LLWPLH+YQQ+HPLNFIFLGLFTASLS  V V+
Sbjct  61   TVLYTPINDLLRGSPGLLLLLVFLPFVLLWPLHIYQQKHPLNFIFLGLFTASLSLTVGVT  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEAL+LTSAVV ALTGYTFWA+KKGKDF+FLGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGRIVLEALLLTSAVVSALTGYTFWASKKGKDFSFLGPILFTSLFVLILTGFMQMF  180

Query  609  FPL  617
            FPL
Sbjct  181  FPL  183



>ref|XP_004229465.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=246

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  + +  DGG+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTTLV+ V
Sbjct  1    MYGFTSLRTESDGGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTLVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N++L+GS  LLLFL+FLPF+LLWPLH+YQQ+HPLNFIFLGLFTASLS  V V+
Sbjct  61   TVLYTPINDLLRGSPGLLLFLIFLPFVLLWPLHIYQQKHPLNFIFLGLFTASLSLTVGVT  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEAL+LTSAVV ALTGYTFWA+KKGKDF+FLGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGRIVLEALLLTSAVVSALTGYTFWASKKGKDFSFLGPILFTSLFVLILTGFMQMF  180

Query  609  FPL  617
            FPL
Sbjct  181  FPL  183



>gb|EYU43851.1| hypothetical protein MIMGU_mgv1a011019mg [Erythranthe guttata]
Length=294

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 175/223 (78%), Gaps = 25/223 (11%)
 Frame = +3

Query  24   HISRERERDLRAK---------------------AKMYGFERVSSSYDGGMKG---DIEE  131
            ++ RERER++  +                      KMYG+  VSS     MKG   DIE 
Sbjct  10   NLGREREREISTEISRERKSQRRTRPNRRRNQRSEKMYGYAGVSSDGPAAMKGGEFDIES  69

Query  132  G-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSAlllf  308
            G  LYPGIG+GENQLRWGFI+KVYGI++AQIL+TT+V+   VLYAP+N++L+G+S LLLF
Sbjct  70   GDMLYPGIGHGENQLRWGFIQKVYGILAAQILMTTVVSAAVVLYAPINDLLRGNSVLLLF  129

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            L+F PF+LLWPLHVYQQ HPLNFIFLGLFTASLS  V VSCANT+GAIVLEALILTSAVV
Sbjct  130  LIFTPFILLWPLHVYQQTHPLNFIFLGLFTASLSLTVGVSCANTEGAIVLEALILTSAVV  189

Query  489  LALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ALTGYTFWA+KKGKDF+FLGP+LFTSLFIL+LTGFIQ+FFPL
Sbjct  190  SALTGYTFWASKKGKDFSFLGPVLFTSLFILVLTGFIQVFFPL  232



>ref|XP_002279368.2| PREDICTED: BI1-like protein [Vitis vinifera]
 emb|CBI26161.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  VSS      KGD+EEGTLYPG+ YGEN+LRWGFIRKVYGI++AQILLTTLV+  
Sbjct  1    MYGFTSVSS------KGDLEEGTLYPGLSYGENELRWGFIRKVYGILAAQILLTTLVSSF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY+PLN +L+G+S LLLFL+FLPF+LLWPLHVYQQRHPLN IFLGLFT S+S  V VS
Sbjct  55   TVLYSPLNLLLRGNSGLLLFLIFLPFILLWPLHVYQQRHPLNLIFLGLFTVSMSLTVGVS  114

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CA TDG IVLEALILTSAVV +LTGYTFWA+KKGKDF++LGPILF+SL ILILTGFIQ F
Sbjct  115  CAKTDGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPILFSSLIILILTGFIQTF  174

Query  609  FPL  617
            FPL
Sbjct  175  FPL  177



>ref|XP_006419766.1| hypothetical protein CICLE_v10005717mg [Citrus clementina]
 gb|ESR33006.1| hypothetical protein CICLE_v10005717mg [Citrus clementina]
Length=249

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 3/186 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYETVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SLS PV
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLPV  120

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
            AVSCANTDG IVLEALILTSAVV +LTGYTFWA+KKGKDF+FLGPILFTSL ILILT F+
Sbjct  121  AVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFM  180

Query  600  QMFFPL  617
            QMFFPL
Sbjct  181  QMFFPL  186



>ref|XP_006489229.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
Length=249

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 3/186 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYETVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SLS PV
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLPV  120

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
            AVSCANTDG IVLEALILTSAVV +LTGYTFWA+KKGKDF+FLGPILFTSL ILILT F+
Sbjct  121  AVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFM  180

Query  600  QMFFPL  617
            QMFFPL
Sbjct  181  QMFFPL  186



>emb|CDO98965.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G L YPGIGYGENQLRWGFIRKVYGI++AQI+LTTLV+ + VLY P+N++L+G+S 
Sbjct  16   DLEAGDLLYPGIGYGENQLRWGFIRKVYGILAAQIVLTTLVSALIVLYDPINQLLRGNSI  75

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFL FLPF+LLWPLHVYQQ+HPLN +FLGLFTASLS  V VSCANTDG IVLEALILT
Sbjct  76   LLLFLCFLPFVLLWPLHVYQQKHPLNLVFLGLFTASLSLTVGVSCANTDGRIVLEALILT  135

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV+ LTGYTFWAAKKGKDF+FLGPILFTSL +L+LT F+QMFFPL
Sbjct  136  SAVVVGLTGYTFWAAKKGKDFSFLGPILFTSLVVLLLTSFLQMFFPL  182



>ref|XP_008223040.1| PREDICTED: BI1-like protein [Prunus mume]
Length=250

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++   G++ DIE G TLYPG+  GENQLRWGFIRKVYGI++AQ++LTTL++
Sbjct  3    KMHGYTEVGTNSVKGVEVDIESGETLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLIS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT  LS  V+
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLCLSVTVS  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEAL+LTSAVV +LT YTFWA+KKGKDF+FLGP+LFT L +L++TGF+Q
Sbjct  123  VAVANTDGAIVLEALVLTSAVVASLTAYTFWASKKGKDFSFLGPVLFTGLIVLLVTGFMQ  182

Query  603  MFFPL  617
            MFFPL
Sbjct  183  MFFPL  187



>ref|XP_010024447.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
Length=244

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 159/186 (85%), Gaps = 8/186 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+ RV     G ++ D+E G   TLYPG+ YGENQLRWGFIRKVYGI++AQI+LTT+V
Sbjct  1    MDGYARV-----GKLEKDLELGEGETLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTVV  55

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++L+G+S LLLFL+FLP +LLWPLH+YQQ+HPLNFIFLGLFT SLS  V
Sbjct  56   SSVTVLYAPVNDLLRGNSGLLLFLMFLPLVLLWPLHIYQQKHPLNFIFLGLFTLSLSLTV  115

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             VSCANT+G IVLEALILTS+VV ALTGYTFWA+KKGKDF++LGPILFT L +L++T F+
Sbjct  116  GVSCANTEGRIVLEALILTSSVVCALTGYTFWASKKGKDFSYLGPILFTGLIVLLMTSFM  175

Query  600  QMFFPL  617
            QM FPL
Sbjct  176  QMMFPL  181



>ref|XP_010105697.1| hypothetical protein L484_011309 [Morus notabilis]
 gb|EXC05728.1| hypothetical protein L484_011309 [Morus notabilis]
Length=244

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            MYG+  ++S  +   + D+E G  LYPG+  GENQLRWGFIRKVYGI++AQI+LTT+V+ 
Sbjct  1    MYGYSGLNSKSE---EVDLESGEILYPGLSAGENQLRWGFIRKVYGILTAQIVLTTVVSA  57

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
            VTVLYAP+N++L+GS  LLLFL  LP +LLWPLHVYQQ+HPLNFIFLGLFT +LSF V V
Sbjct  58   VTVLYAPVNDLLRGSPGLLLFLAILPLILLWPLHVYQQKHPLNFIFLGLFTVTLSFTVGV  117

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            SCANTDG IVLEALILTSAVV++LTGYTFWA+KKGKDF+FLGPILFT L IL+LTGFIQ 
Sbjct  118  SCANTDGRIVLEALILTSAVVVSLTGYTFWASKKGKDFSFLGPILFTGLIILVLTGFIQA  177

Query  606  FFPL  617
            FFPL
Sbjct  178  FFPL  181



>gb|KHG22240.1| hypothetical protein F383_06527 [Gossypium arboreum]
Length=248

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 154/185 (83%), Gaps = 2/185 (1%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MY +ERVSS S     K D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MYRYERVSSTSVSKADKVDLESGDTLYPGLSYGENQLRWGFIRKVYGIVAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKGKDF+FLGPILFTSL ILIL+G IQ
Sbjct  121  VSCANTDGRIVLEALILTACVVASLTGYTFWASKKGKDFSFLGPILFTSLIILILSGLIQ  180

Query  603  MFFPL  617
            MFFPL
Sbjct  181  MFFPL  185



>ref|XP_007223728.1| hypothetical protein PRUPE_ppa010433mg [Prunus persica]
 gb|EMJ24927.1| hypothetical protein PRUPE_ppa010433mg [Prunus persica]
Length=250

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++   G++ DIE G TLYPG+  GENQLRWGFIRKVYGI++AQ++LTTL++
Sbjct  3    KMHGYTEVGTNSVKGVEVDIESGETLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLIS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT  LS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLCLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            V+  NTDGAIVLEAL+LTSAVV +LT YTFWA+KKGKDF+FLGP+LFT L +L++TGF+Q
Sbjct  123  VAVGNTDGAIVLEALVLTSAVVASLTAYTFWASKKGKDFSFLGPVLFTGLIVLLVTGFMQ  182

Query  603  MFFPL  617
            MFFPL
Sbjct  183  MFFPL  187



>ref|XP_007035358.1| Bax inhibitor-1 family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY06284.1| Bax inhibitor-1 family protein isoform 2, partial [Theobroma 
cacao]
Length=261

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 165/203 (81%), Gaps = 7/203 (3%)
 Frame = +3

Query  24   HISRERERDLRAKAK-MYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFI  188
            H +R++E++   + K M G+ERV+S   G  K    D+E G TLYPGI YGENQLRWGFI
Sbjct  26   HFTRKQEKEQGNREKTMNGYERVNS--KGASKAEQIDLESGETLYPGISYGENQLRWGFI  83

Query  189  RKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHP  368
            RKVYGI++AQ++LTT+V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP
Sbjct  84   RKVYGILAAQLVLTTVVSAFVVLSAPVNELLRGNSGLLLFLCLIPFILLWPLHVYHQKHP  143

Query  369  LNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFL  548
            +N I LGLFT SLS  V VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKGKDF++L
Sbjct  144  VNLIVLGLFTVSLSLTVGVSCANTDGRIVLEALILTAGVVTSLTGYTFWASKKGKDFSYL  203

Query  549  GPilftslfililtgfiQMFFPL  617
            GPILFTSL ILILTG IQMFFPL
Sbjct  204  GPILFTSLIILILTGLIQMFFPL  226



>ref|XP_008390802.1| PREDICTED: BI1-like protein [Malus domestica]
Length=250

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++    ++ DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTTLV+
Sbjct  3    KMHGYTEVGTNSGKAVEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLVS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KGKDF+FLGP+LFT L +L+LTGF+Q
Sbjct  123  VAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFMQ  182

Query  603  MFFPL  617
            MFFPL
Sbjct  183  MFFPL  187



>ref|XP_009352144.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=250

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++     + DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTTLV+
Sbjct  3    KMHGYTEVGTNSGKAAEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLVS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KGKDF+FLGP+LFT L IL+LTGF+Q
Sbjct  123  VAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLVILLLTGFMQ  182

Query  603  MFFPL  617
            MFFPL
Sbjct  183  MFFPL  187



>ref|XP_011090832.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=250

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 161/190 (85%), Gaps = 9/190 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGG---MKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            M+ +  VSS   GG   MKG   DIE G  LYPGIG+GENQLRWGFIRKVYGI+SAQIL+
Sbjct  1    MFNYTSVSSG--GGAAEMKGGEFDIESGDMLYPGIGHGENQLRWGFIRKVYGILSAQILV  58

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TT V+ VTVLYAP+N++L+ S  LLLFLVF PF+LLWPLHVYQQ+HPLNF+FLGLFT SL
Sbjct  59   TTAVSAVTVLYAPVNDLLRSSPGLLLFLVFTPFILLWPLHVYQQKHPLNFVFLGLFTVSL  118

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfilil  587
            S  V ++CANT+G IVLEALILTSAVV ALTGYTFWAAKKGKDF+FLGPILFTSLFIL+L
Sbjct  119  SLTVGMTCANTEGRIVLEALILTSAVVSALTGYTFWAAKKGKDFSFLGPILFTSLFILVL  178

Query  588  tgfiQMFFPL  617
            T FIQ+F PL
Sbjct  179  TSFIQVFCPL  188



>ref|XP_009339935.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=252

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-GMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            KM+G+  V ++  G  ++ DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTT++
Sbjct  4    KMHGYTEVGTNSGGKAVEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTMI  63

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V
Sbjct  64   SFVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTV  123

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KGKDF+FLGP+LFT L +L+LTGF+
Sbjct  124  GVAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFM  183

Query  600  QMFFPL  617
            QMFFPL
Sbjct  184  QMFFPL  189



>ref|XP_010693836.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=238

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  111  MKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            +KGDIEEGTLYPG+GYGE QLRWGFIRKVYGI+SAQ++LTTLV+ +TVLY+P+NE L+G+
Sbjct  7    VKGDIEEGTLYPGLGYGETQLRWGFIRKVYGILSAQLILTTLVSLLTVLYSPINETLRGN  66

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            SALLLF  F+PF+LLWPL+ YQQ+HP N IFLGLFT  LS  V V+CANTDG IV++AL+
Sbjct  67   SALLLFFAFMPFILLWPLYHYQQKHPQNLIFLGLFTLCLSLTVGVACANTDGKIVIQALV  126

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            LT+AVV +LT YTFWAAKKGKDF+FLGP+LF SL  +I  G +Q+FFP
Sbjct  127  LTAAVVCSLTAYTFWAAKKGKDFSFLGPVLFASLVGIIFAGLLQVFFP  174



>ref|XP_010279039.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=242

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 157/185 (85%), Gaps = 9/185 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDI--EEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYGF  +S       KGD+  E GTLYPG+ YGEN+LRWGFIRKVYGI+SAQ++LTT+V+
Sbjct  1    MYGFTSLS-------KGDLDLESGTLYPGLSYGENELRWGFIRKVYGILSAQVVLTTIVS  53

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
              TVLY+P+NE+L+ SS LLLFL FLP +L+WPL+VYQQ+HPLN +FLGLFTASLS  V 
Sbjct  54   SATVLYSPINELLRSSSGLLLFLTFLPLILMWPLYVYQQKHPLNLVFLGLFTASLSITVG  113

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            V CANT+G IVLEALILTSAVV ALTGYTFWA+KKGKDF+FLGPILF SL +L+LTGFIQ
Sbjct  114  VVCANTEGRIVLEALILTSAVVCALTGYTFWASKKGKDFSFLGPILFASLLVLVLTGFIQ  173

Query  603  MFFPL  617
            MFFPL
Sbjct  174  MFFPL  178



>gb|KHG20306.1| hypothetical protein F383_02282 [Gossypium arboreum]
Length=248

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 158/185 (85%), Gaps = 2/185 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M+G++RV+ SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MFGYDRVNHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS  V 
Sbjct  61   AFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+AVV +LTGYTFWA+KKGKDF++LGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDGRIVLEALILTAAVVASLTGYTFWASKKGKDFSYLGPILFTSLIILILTGLIQ  180

Query  603  MFFPL  617
            MFFPL
Sbjct  181  MFFPL  185



>ref|XP_008340894.1| PREDICTED: BI1-like protein [Malus domestica]
Length=252

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-GMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            KM+G+  V ++  G   + DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTT +
Sbjct  4    KMHGYTEVGTNSGGKAAEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTXI  63

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V
Sbjct  64   SFVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTV  123

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KGKDF+FLGP+LFT L +L+LTGF+
Sbjct  124  GVAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFM  183

Query  600  QMFFPL  617
            QMFFPL
Sbjct  184  QMFFPL  189



>ref|XP_009624081.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=240

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  DGGMKGDIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + G+KGDIE G L YPGIG GEN+LRWGFIRKVY I++AQILLTT+V+ VT LY P+N++
Sbjct  8    NDGVKGDIEGGNLLYPGIGNGENELRWGFIRKVYYILAAQILLTTVVSAVTALYTPINQL  67

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            L+G+  LL+ L+FLP +LLWPL+++QQ+HPLNF+FLGLFT SLSF V VSCANTDG IVL
Sbjct  68   LRGNIVLLILLIFLPLILLWPLYIFQQKHPLNFVFLGLFTVSLSFGVGVSCANTDGRIVL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EALILTSAVVL+LTGYTFWA++KG+DF+FLGP LF SL +L+L GFIQ+FFPL
Sbjct  128  EALILTSAVVLSLTGYTFWASRKGQDFSFLGPFLFASLSVLVLVGFIQIFFPL  180



>ref|XP_007035357.1| Bax inhibitor-1 family protein isoform 1 [Theobroma cacao]
 gb|EOY06283.1| Bax inhibitor-1 family protein isoform 1 [Theobroma cacao]
Length=248

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 155/187 (83%), Gaps = 6/187 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            M G+ERV+S   G  K    D+E G TLYPGI YGENQLRWGFIRKVYGI++AQ++LTT+
Sbjct  1    MNGYERVNSK--GASKAEQIDLESGETLYPGISYGENQLRWGFIRKVYGILAAQLVLTTV  58

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  
Sbjct  59   VSAFVVLSAPVNELLRGNSGLLLFLCLIPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLT  118

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKGKDF++LGPILFTSL ILILTG 
Sbjct  119  VGVSCANTDGRIVLEALILTAGVVTSLTGYTFWASKKGKDFSYLGPILFTSLIILILTGL  178

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  179  IQMFFPL  185



>ref|XP_004144961.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004153426.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004168808.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_008458536.1| PREDICTED: BI1-like protein [Cucumis melo]
 gb|KGN46165.1| hypothetical protein Csa_6G061760 [Cucumis sativus]
Length=244

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            M+G+  VS+    G + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQI+LTT+V+ 
Sbjct  1    MFGYTGVSNK---GGEVDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQIVLTTIVSS  57

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
            VTVLY+P+N++L+G+S LLLFL FLP +LLWP+++Y+Q+HPLN +FLG+FTA+LS  V V
Sbjct  58   VTVLYSPINDLLRGNSGLLLFLCFLPLILLWPMYIYRQKHPLNLVFLGIFTATLSLTVGV  117

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            SCANTDG IVLEALILTSAVV +LTGYTFWA+KKGKDF++LGP LFT+L IL+LT FIQ 
Sbjct  118  SCANTDGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPFLFTALMILLLTSFIQA  177

Query  606  FFPL  617
            FFPL
Sbjct  178  FFPL  181



>ref|XP_009785292.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=240

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  DGGMKGDIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + G+KGDIE G L YPGIG GEN+LRWGFIRKVY I++AQILLTT+V+ VT LY P+N++
Sbjct  8    NDGVKGDIEGGNLLYPGIGNGENELRWGFIRKVYYILAAQILLTTVVSAVTALYTPINQL  67

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            L G+  LL+ L+FLP +LLWPL+++QQ+HPLNF+FLGLFT SLSF V V+CANTDG IVL
Sbjct  68   LSGNIVLLILLIFLPLILLWPLYIFQQKHPLNFVFLGLFTVSLSFGVGVTCANTDGRIVL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EALILTSAVVL+LTGYTFWA++KG+DF+FLGP LF SL +L+L GF+Q+FFPL
Sbjct  128  EALILTSAVVLSLTGYTFWASRKGQDFSFLGPFLFASLSVLVLVGFLQIFFPL  180



>ref|XP_004297019.1| PREDICTED: BI1-like protein [Fragaria vesca subsp. vesca]
Length=249

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = +3

Query  78   FERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtv  254
            +  VS++     + DIE G  LYPGI  GENQLRWGFIRKVYGI+SAQ+LLTT ++ VTV
Sbjct  6    YAEVSTTAGKLEEVDIESGELLYPGISKGENQLRWGFIRKVYGILSAQLLLTTAISFVTV  65

Query  255  lYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            LY P+N++LKGS  LLLF  FLP +LLWPLHVYQQRHPLNFIFLGLFT SLS  V V+ A
Sbjct  66   LYTPVNDLLKGSPGLLLFFAFLPLVLLWPLHVYQQRHPLNFIFLGLFTLSLSVTVGVAVA  125

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            NTDGAIVLEALILTS VV +LT YTFWA+KKGKDF+FLGP+LFT L +L+LT F+QMFFP
Sbjct  126  NTDGAIVLEALILTSGVVASLTAYTFWASKKGKDFSFLGPVLFTGLMVLLLTSFMQMFFP  185

Query  615  L  617
            L
Sbjct  186  L  186



>gb|KJB74487.1| hypothetical protein B456_011G181100 [Gossypium raimondii]
Length=248

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M  +ERVSS S     K D+E G TLY G+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MSRYERVSSTSASKADKVDLESGDTLYRGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKGKDF+FLGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDGRIVLEALILTAGVVASLTGYTFWASKKGKDFSFLGPILFTSLIILILTGLIQ  180

Query  603  MFFPL  617
            MFFPL
Sbjct  181  MFFPL  185



>gb|EPS68151.1| hypothetical protein M569_06622, partial [Genlisea aurea]
Length=250

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            KM  +  V S     MK    D+E G +LYPGIG GEN+LRWGFIRKVYGI++AQIL+TT
Sbjct  1    KMQAYTAVGSVEADEMKKVEIDLESGESLYPGIGRGENRLRWGFIRKVYGILAAQILITT  60

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
             V+ VTVLYAP+N++L+GS  L++FL+F PF+L+WPL++Y+Q+HPLN +FLGLFT SLS 
Sbjct  61   AVSAVTVLYAPVNDLLRGSPGLMMFLIFTPFILMWPLYIYRQKHPLNLVFLGLFTTSLSL  120

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtg  593
             V VSCANT+G IVLEALILTSAVV  LTGYTFWAAKKGKDF+FLGPILFTSL IL+LTG
Sbjct  121  TVGVSCANTEGYIVLEALILTSAVVSGLTGYTFWAAKKGKDFSFLGPILFTSLSILLLTG  180

Query  594  fiQMFFPL  617
            FIQ+FFPL
Sbjct  181  FIQVFFPL  188



>ref|XP_010524498.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=255

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = +3

Query  66   KMYGFERVS--SSYDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            K YG+  V+  SS+  G   D+E    E TLYPG+ +GENQLRWGFIRKVYGI+SAQ+LL
Sbjct  3    KPYGYASVNAGSSFSVGKDVDLEMGGGEATLYPGLSFGENQLRWGFIRKVYGILSAQLLL  62

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TT+++ V VL  P+ E+L GS  LLLFL  +PF+L+WPLH+Y Q+HP+N I LGLFT SL
Sbjct  63   TTVISAVVVLNPPVTELLTGSPGLLLFLCIVPFVLIWPLHIYHQKHPVNLILLGLFTVSL  122

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfilil  587
            SF V VSCANTDG IVLEALILT AVV +LT YTFWAAKKGKDF+FLGPILFTSL IL++
Sbjct  123  SFTVGVSCANTDGRIVLEALILTLAVVSSLTAYTFWAAKKGKDFSFLGPILFTSLIILVV  182

Query  588  tgfiQMFFPL  617
            TGFIQMFFPL
Sbjct  183  TGFIQMFFPL  192



>ref|XP_009419853.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=246

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ERV      G  GDIE GTLYPG+  G+N+LRWGF+RKVYGI++AQ+LLTT V+  
Sbjct  1    MHGYERVEKGAAPG--GDIEAGTLYPGLSRGDNELRWGFVRKVYGILAAQVLLTTAVSAA  58

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N  L  S  L L L FLP  LL PL+ YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  59   TVLYRPVNAALASSPGLALCLAFLPLFLLCPLYYYQQKHPLNFLFLGLFTVCLSLSVGVA  118

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVVL+LTGYTFWA++KGKDF++LGPI+F+ L +L L+ FIQ+F
Sbjct  119  CANTQGRIVLEALILTSAVVLSLTGYTFWASRKGKDFSYLGPIVFSGLMVLFLSTFIQIF  178

Query  609  FPL  617
            FPL
Sbjct  179  FPL  181



>ref|XP_002312729.1| hypothetical protein POPTR_0008s20370g [Populus trichocarpa]
 gb|EEE90096.1| hypothetical protein POPTR_0008s20370g [Populus trichocarpa]
Length=252

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 151/189 (80%), Gaps = 4/189 (2%)
 Frame = +3

Query  60   KAKMYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
             A+M+G+  VS+  D G + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LT
Sbjct  2    SAEMFGYSSVSNK-DAGKEVDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLILT  60

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            T+VA  TVLY P+ ++L+GS   ++ L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS
Sbjct  61   TIVAAATVLYTPITDLLRGSFGFVMLLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLS  120

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
              V  SCAN +G IVLEALILTSAVV +LTGYTFWA+KKGKDF+FLGPILFT+L ILILT
Sbjct  121  LLVGASCANIEGKIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTALIILILT  180

Query  591  gfiQMFFPL  617
             FIQ+FFPL
Sbjct  181  SFIQVFFPL  189



>ref|XP_009414206.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=246

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG++RV      G+  DIE GTLYPG+  GEN LRWGFIRKVYGI++ Q+LLTT V+  
Sbjct  1    MYGYDRVEKGVAPGL--DIEAGTLYPGLSLGENDLRWGFIRKVYGILAVQVLLTTAVSAA  58

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TV Y P+N  L  S  L L L  LP  LL+PL+ YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  59   TVFYRPVNAALASSPGLALVLALLPLFLLFPLYHYQQKHPLNFLFLGLFTVCLSLSVGVA  118

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVVL+LTGYTFWA++KGKDF++LGPILF++L +L+LT FIQ+F
Sbjct  119  CANTQGRIVLEALILTSAVVLSLTGYTFWASRKGKDFSYLGPILFSALTVLLLTTFIQIF  178

Query  609  FPL  617
            FPL
Sbjct  179  FPL  181



>gb|KDP40073.1| hypothetical protein JCGZ_02071 [Jatropha curcas]
Length=246

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 147/186 (79%), Gaps = 6/186 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+GF  +S+      + D+E G   TLYPG+G GENQLRWG IRKVYGI++ Q++LTT+V
Sbjct  1    MHGFTSLSTK---DKEVDLEAGNGETLYPGLGLGENQLRWGLIRKVYGILAVQLILTTIV  57

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            +  TVLY P+N +L  S  LLL L  +PF+LLWPLHVY Q+HP+N I LGLFT SLSF V
Sbjct  58   SATTVLYTPINNLLAESPGLLLLLCIVPFVLLWPLHVYHQKHPVNLIILGLFTVSLSFLV  117

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             VSCANTDG IVLEALILTSAVV +LT YTFWAAKKGKDF+FLGPILFT L ILILT FI
Sbjct  118  GVSCANTDGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTGLIILILTSFI  177

Query  600  QMFFPL  617
            QMFFPL
Sbjct  178  QMFFPL  183



>ref|XP_002516809.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
 gb|EEF45423.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
Length=210

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYGF  +SS      + D+E G   TLYPG+G GENQLRWG IRKVYGI+SAQ+LLTT+V
Sbjct  1    MYGFTSLSSKEK---EVDLEAGNGETLYPGLGVGENQLRWGLIRKVYGILSAQLLLTTIV  57

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            +  TVLY P N +L  S  LLL L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  58   SAATVLYTPFNTLLGDSPGLLLLLCIVPFVLLWPLHVYHQKHPVNLIVLGLFTVSLSLLV  117

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             VSCA TDG IVLEALILTSAVV +LT YTFWAAKKG+DF+FLGPILFTSL ILILT FI
Sbjct  118  GVSCAQTDGKIVLEALILTSAVVCSLTAYTFWAAKKGQDFSFLGPILFTSLIILILTSFI  177

Query  600  QMFFPL  617
            QMFFPL
Sbjct  178  QMFFPL  183



>ref|XP_011006595.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=248

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYG+  VS+  DG  + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LTT+V
Sbjct  1    MYGYASVSNK-DGAKEIDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLVLTTIV  59

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VT+LY P+ ++LKGS   +LFL   PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  60   SAVTILYTPMTDLLKGSFGFVLFLSIAPFILLWPLHVYHQKHPVNLIILGLFTVSLSLLV  119

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
              SCAN +G IVLEALILTSAVV +LT YTFWAAKKGKDF+FLGPILFTSL ILILT FI
Sbjct  120  GASCANIEGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTSLIILILTSFI  179

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  180  QVFFPL  185



>gb|KJB34591.1| hypothetical protein B456_006G074200 [Gossypium raimondii]
Length=831

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   KAKMYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            + KM+ ++RVS SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT
Sbjct  581  REKMFAYDRVSHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTT  640

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS 
Sbjct  641  VVSAFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSL  700

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtg  593
             V VSCANTDG IVLEALILT+AVV +LTGYTFWA+KKGKDF++LGPILFT L ILILTG
Sbjct  701  TVGVSCANTDGRIVLEALILTAAVVASLTGYTFWASKKGKDFSYLGPILFTGLIILILTG  760

Query  594  fiQMFFPL  617
             IQMFFPL
Sbjct  761  LIQMFFPL  768



>ref|XP_008809232.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG+  V    +    GD+E G+LYPG+  GEN LRWGF+RKVYGI++AQ+LLTT+V+  
Sbjct  1    MYGYTSV----EKAAGGDLEAGSLYPGLSRGENDLRWGFVRKVYGILAAQLLLTTVVSAA  56

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL A +NE+L GSS L L L  LP  L++PL++YQQ+HPLNFIFLGLFT  LS  V V+
Sbjct  57   TVLNASINELLTGSSGLALGLALLPLFLMFPLYLYQQKHPLNFIFLGLFTLCLSLSVGVA  116

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA+KKGKDF++LGPILF SL +L+LT FIQ+F
Sbjct  117  CANTQGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPILFASLLVLLLTSFIQIF  176

Query  609  FPL  617
            FPL
Sbjct  177  FPL  179



>emb|CDX90589.1| BnaA03g41920D [Brassica napus]
Length=255

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 149/190 (78%), Gaps = 6/190 (3%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            K YG+  VS S D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LL
Sbjct  3    KPYGYASVSMSGDRAAGKDIDLEMGTGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLL  62

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TTL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SL
Sbjct  63   TTLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISL  122

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfilil  587
            SF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++
Sbjct  123  SFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVV  182

Query  588  tgfiQMFFPL  617
            T F+QMFFPL
Sbjct  183  TSFMQMFFPL  192



>emb|CDY09066.1| BnaC08g10200D [Brassica napus]
Length=256

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 150/191 (79%), Gaps = 7/191 (4%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-----GMKGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS S  G     G   D+E  E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSMSMSGVDRSAGKDIDLEMGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+NE+L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNELLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPL  617
            +T F+QMFFPL
Sbjct  183  VTSFMQMFFPL  193



>ref|XP_002314428.1| hypothetical protein POPTR_0010s02990g [Populus trichocarpa]
 gb|ABK94990.1| unknown [Populus trichocarpa]
 gb|EEF00599.1| hypothetical protein POPTR_0010s02990g [Populus trichocarpa]
Length=248

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 4/186 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYG+  VS+  DG  + D+E G   +LYPG+  GENQLRWG IRKVYGI++AQ++LTT+V
Sbjct  1    MYGYASVSNK-DGAKEIDLEAGNRESLYPGLSLGENQLRWGLIRKVYGILAAQLVLTTIV  59

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VT+LY P+ ++LKGS   +LFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  60   SAVTILYTPMTDLLKGSFGFVLFLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLLV  119

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
              SCAN +G IVLEALILTSAVV +LT YTFWAAKKGKDF+FLGPILFTSL ILILT FI
Sbjct  120  GASCANIEGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTSLIILILTSFI  179

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  180  QVFFPL  185



>ref|XP_011006069.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=252

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 150/189 (79%), Gaps = 4/189 (2%)
 Frame = +3

Query  60   KAKMYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
             A+M+ +  VS+  D G + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LT
Sbjct  2    SAEMFRYSSVSNK-DAGKEVDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLVLT  60

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            T+VA  TVLY P+ ++L+GS   ++ L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS
Sbjct  61   TIVAAATVLYTPITDLLRGSFGFVMLLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLS  120

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
              V  SCAN +G IVLEALILTSAVV +LTGYTFWA+KKGKDF+FLGPILFT+L ILILT
Sbjct  121  LLVGASCANIEGKIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTALIILILT  180

Query  591  gfiQMFFPL  617
             FIQ+FFPL
Sbjct  181  SFIQVFFPL  189



>ref|XP_008776713.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=247

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +MYG+  V  +      GD+E GTLYPGI  GE++LRWGF+RKVYGI++AQ++LTT+V+ 
Sbjct  3    EMYGYASVEKA----AGGDLEAGTLYPGISRGESELRWGFVRKVYGILAAQLVLTTVVSA  58

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
             TVL A +N +L GSS L L    LP  L++PL+ YQQ+HPLNFIFLGLFT  LS  V V
Sbjct  59   ATVLNASINNLLTGSSGLALGFAILPLFLMFPLYHYQQKHPLNFIFLGLFTVCLSLSVGV  118

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            +CANT G IVLEAL+LTSAVVL+LTGYTFWA+KKGKDF++LGPILF  L +L+LT FIQ+
Sbjct  119  ACANTQGRIVLEALVLTSAVVLSLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQI  178

Query  606  FFPL  617
            FFPL
Sbjct  179  FFPL  182



>gb|KHG16370.1| hypothetical protein F383_22614 [Gossypium arboreum]
Length=248

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 2/185 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYG+E +S +      + D+E G TLYPG+GYGEN+LRWGFIRKVYGI++ Q+LLTT+V+
Sbjct  1    MYGYESLSRTDARKAEQIDLESGETLYPGLGYGENELRWGFIRKVYGILAVQLLLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V    + ++L+G+S LLLF   +P +L+WPLHVY Q+HPLNFI LG FT  LS  V 
Sbjct  61   AFVVSSPSIIDLLRGNSGLLLFFCLVPLILVWPLHVYHQKHPLNFIILGAFTVFLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+AVV +LTGYTFWA+K GKDFN+LGPILFTSL IL+LT  IQ
Sbjct  121  VSCANTDGRIVLEALILTAAVVTSLTGYTFWASKNGKDFNYLGPILFTSLVILVLTSLIQ  180

Query  603  MFFPL  617
            MFFPL
Sbjct  181  MFFPL  185



>ref|XP_002870236.1| hypothetical protein ARALYDRAFT_493344 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46495.1| hypothetical protein ARALYDRAFT_493344 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N+VL GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDVLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  187  IQMFFPL  193



>ref|XP_006850841.1| hypothetical protein AMTR_s00025p00133870 [Amborella trichopoda]
 gb|ERN12422.1| hypothetical protein AMTR_s00025p00133870 [Amborella trichopoda]
Length=241

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  114  KGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            KGD+E GTLYPG+GYGEN+LRWGFIRKVYGI++ QI+LTT+VA + VL+ P++ +L+ S 
Sbjct  9    KGDLEAGTLYPGLGYGENELRWGFIRKVYGILATQIVLTTVVAAIVVLHPPISHLLQNSP  68

Query  294  AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALIL  473
             L + L  LP +L+ PL+ Y Q+HP+N I LGLFT  LS  V V+CANT+G IVLEALIL
Sbjct  69   GLAIGLAILPLILMCPLYYYHQKHPVNLILLGLFTVFLSLSVGVACANTEGTIVLEALIL  128

Query  474  TSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            TSAVV +LTGYTFWA+KKGKDF+FLGPILF  L ILILTGFIQ+FFPL
Sbjct  129  TSAVVCSLTGYTFWASKKGKDFSFLGPILFAGLMILILTGFIQIFFPL  176



>ref|XP_003546118.1| PREDICTED: BI1-like protein-like [Glycine max]
 gb|KHN33086.1| BI1-like protein [Glycine soja]
Length=246

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LTGY FWA+KKGKDF+FLGP+LFTSLF LILTG +QMFFPL
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPVLFTSLFTLILTGMMQMFFPL  183



>ref|NP_001237753.1| uncharacterized protein LOC100499906 [Glycine max]
 gb|ACU14127.1| unknown [Glycine max]
Length=246

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  + V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTIGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LTGY FWA+KKGKDF+FLGPILFTSL  LILTG +QMFFPL
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPILFTSLITLILTGMMQMFFPL  183



>gb|KHN37547.1| BI1-like protein [Glycine soja]
Length=246

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  + V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTIGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LTGY FWA+KKGKDF+FLGPILFTSL  LILTG +QMFFPL
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPILFTSLITLILTGMMQMFFPL  183



>ref|XP_009107842.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=254

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            K YG+  VS S      G   D+E  E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  3    KPYGYASVSMSGVDRSAGKDIDLEMGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  62

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N++L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  63   TLISAVVVLNPPVNDLLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  122

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T
Sbjct  123  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  182

Query  591  gfiQMFFPL  617
             F+QMFFPL
Sbjct  183  SFMQMFFPL  191



>emb|CDY09761.1| BnaC07g33000D [Brassica napus]
Length=256

 Score =   181 bits (460),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 149/191 (78%), Gaps = 7/191 (4%)
 Frame = +3

Query  66   KMYGFERVS-SSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  V  SS D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVGMSSVDRAAGKDIDLEMGGGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLSLFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPL  617
            +T F+QMFFPL
Sbjct  183  VTSFMQMFFPL  193



>gb|AAL07001.1| AT4g15470/dl3775w [Arabidopsis thaliana]
Length=226

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  187  IQMFFPL  193



>ref|NP_567466.1| Bax inhibitor-1 like protein [Arabidopsis thaliana]
 sp|Q94A20.1|BI1L_ARATH RecName: Full=BI1-like protein [Arabidopsis thaliana]
 gb|AAK91458.1| AT4g15470/dl3775w [Arabidopsis thaliana]
 gb|AAM19872.1| AT4g15470/dl3775w [Arabidopsis thaliana]
 gb|AEE83607.1| Bax inhibitor-1 like protein [Arabidopsis thaliana]
Length=256

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  187  IQMFFPL  193



>ref|XP_010548892.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=252

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            K YG+  VS+   GG   D+E    E TLYPG+  GENQLRWGFIRKVYGI+S Q+LLTT
Sbjct  3    KPYGYASVSTG-AGGKDVDLEMGGGEATLYPGLSDGENQLRWGFIRKVYGILSGQLLLTT  61

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +++   VL   + ++L GSS +LLFL  +PF+L+WPLH+Y Q+HPLN I LGLFT SLSF
Sbjct  62   VISASVVLNPSVTDLLTGSSGILLFLCIVPFVLIWPLHIYHQKHPLNLILLGLFTVSLSF  121

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtg  593
             V V+CANTDG IVLEALILT  VV +LT YTFWAAKKGKDF+FLGPILFTSL ILI+TG
Sbjct  122  TVGVTCANTDGRIVLEALILTLTVVASLTAYTFWAAKKGKDFSFLGPILFTSLIILIVTG  181

Query  594  fiQMFFPL  617
            FIQMFFPL
Sbjct  182  FIQMFFPL  189



>ref|XP_009136696.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=256

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 148/189 (78%), Gaps = 7/189 (4%)
 Frame = +3

Query  72   YGFERVS-SSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            YG+  VS S  D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  5    YGYASVSRSGVDRAAGKDIDLEMGTGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  64

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  65   TLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  124

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T
Sbjct  125  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  184

Query  591  gfiQMFFPL  617
             F+QMFFPL
Sbjct  185  SFMQMFFPL  193



>emb|CDY22739.1| BnaA08g05690D [Brassica napus]
Length=272

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            K YG+  VS S      G   D+E G  TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  3    KPYGYASVSMSGVDRSAGKDIDLEMGGATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  62

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N++L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  63   TLISAVVVLNPPVNDLLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  122

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T
Sbjct  123  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  182

Query  591  gfiQMFFPL  617
             F+QMFFPL
Sbjct  183  SFMQMFFPL  191



>ref|XP_010551036.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=260

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 144/192 (75%), Gaps = 8/192 (4%)
 Frame = +3

Query  66   KMYGFERVSSS----YDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQI  221
            K YG+  VSSS    + G    D E    E TLYPG+ Y ENQLRWGFIRKVYGI+SAQ+
Sbjct  3    KPYGYASVSSSSGVPFVGDKDADPEMGGGEATLYPGLSYSENQLRWGFIRKVYGILSAQL  62

Query  222  llttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTA  401
            LLTT+++   VL  PL ++L GS   LL L  +P +L+WPL+++ Q HP+N IFLGLFT 
Sbjct  63   LLTTVISAAVVLNPPLTDLLTGSYGFLLLLCIVPIVLIWPLYIFHQTHPVNLIFLGLFTV  122

Query  402  SLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfil  581
            SLSF V V CANTDG IVLEALILT AVV +LT YTFWAAKKGKDF+FLGP L+TSL IL
Sbjct  123  SLSFCVGVCCANTDGRIVLEALILTLAVVASLTAYTFWAAKKGKDFSFLGPFLYTSLVIL  182

Query  582  iltgfiQMFFPL  617
            I+ GFIQ+FFPL
Sbjct  183  IVVGFIQLFFPL  194



>ref|XP_010905739.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=244

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG+  V  +      GD+E GTLYPG+  GEN+LRWGF+RKVYGI++AQ+LLTT+V+G 
Sbjct  1    MYGYASVEKA----AGGDLEAGTLYPGLSRGENELRWGFVRKVYGILAAQLLLTTVVSGA  56

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL A +N++L G+S L L L  LP  L++PL++YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  57   TVLNASINKLLTGNSGLALGLALLPLFLMFPLYLYQQKHPLNFLFLGLFTLCLSLSVGVA  116

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA+KKGKDF++LGPILF  L +L+LT FIQ+ 
Sbjct  117  CANTQGRIVLEALILTSAVVASLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQIL  176

Query  609  FPL  617
            FPL
Sbjct  177  FPL  179



>gb|AFK46458.1| unknown [Medicago truncatula]
 gb|AES64333.2| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=257

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  GENQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGENQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LGLFT S+SF V V+CANTDG IVLEAL+LT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGLFTLSISFTVGVTCANTDGKIVLEALVLT  147

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LT Y FWA+KKGKDF++LGP+LFT LF L+LTG +QMFFPL
Sbjct  148  SAVVSSLTAYAFWASKKGKDFSYLGPLLFTCLFTLVLTGMMQMFFPL  194



>ref|XP_006284243.1| hypothetical protein CARUB_v10005406mg, partial [Capsella rubella]
 gb|EOA17141.1| hypothetical protein CARUB_v10005406mg, partial [Capsella rubella]
Length=288

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 150/193 (78%), Gaps = 6/193 (3%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQ  218
            A  K YG+  VS S     + DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ
Sbjct  33   AMEKPYGYASVSMSGIDRDRKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQ  92

Query  219  IllttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFT  398
            +LLTTL++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT
Sbjct  93   LLLTTLISAVVVLNPPVNDLLTGSPGILLFLCIIPFILIWPLHIYHQKHPVNLILLALFT  152

Query  399  ASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfi  578
             SLSF V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL I
Sbjct  153  VSLSFTVGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLII  212

Query  579  liltgfiQMFFPL  617
            L++T FIQMFFPL
Sbjct  213  LVVTSFIQMFFPL  225



>ref|XP_010938798.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=247

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +MYG+  V  +      GD+E GTLYPG+  GE++LRWGF+RKVYGI++AQ+LLTT+V+ 
Sbjct  3    EMYGYASVEKA----AAGDLEAGTLYPGLSRGESELRWGFVRKVYGILAAQLLLTTVVSA  58

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
             TVL A +N +L  SS L L L  +P  L++PL+ YQQ+HPLNFIFLGLFT  LS  V V
Sbjct  59   ATVLNASINNLLTESSGLALGLAIVPLFLMFPLYHYQQKHPLNFIFLGLFTVCLSLSVGV  118

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            +CANT G IVLEALILTS VVL+LTGYTFWA+KKGKDF++LGPILF  L +L+LT FIQ+
Sbjct  119  ACANTQGRIVLEALILTSTVVLSLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQI  178

Query  606  FFPL  617
            FFPL
Sbjct  179  FFPL  182



>ref|XP_010440304.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILLVTSF  185

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  186  IQMFFPL  192



>ref|XP_010434979.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  185

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  186  IQMFFPL  192



>ref|XP_006414507.1| hypothetical protein EUTSA_v10026042mg [Eutrema salsugineum]
 gb|ESQ55960.1| hypothetical protein EUTSA_v10026042mg [Eutrema salsugineum]
Length=256

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 149/191 (78%), Gaps = 7/191 (4%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS S     GG   D+E    E TLYPG+ +GENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSMSGIDRAGGKDIDLEMGVGEATLYPGLSFGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N+VL  S  LLLFL  +PF+L+WPLH+Y Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDVLTASPGLLLFLCIVPFVLIWPLHIYHQKHPINLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL ILI
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILI  182

Query  585  ltgfiQMFFPL  617
            +T FIQMFFPL
Sbjct  183  VTSFIQMFFPL  193



>ref|XP_007147817.1| hypothetical protein PHAVU_006G157400g [Phaseolus vulgaris]
 gb|ESW19811.1| hypothetical protein PHAVU_006G157400g [Phaseolus vulgaris]
Length=246

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+ +TV Y+P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSLGENQLRWGFIRKVYGILSAQIVLTTLVSLITVFYSPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL LVFLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLVLVFLPFIFLIPLLRYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LT Y FWA+KKGKDF+FLGPILFTSLF L LTG +QMFFPL
Sbjct  137  SAVVSSLTAYAFWASKKGKDFSFLGPILFTSLFTLFLTGMMQMFFPL  183



>gb|KFK22627.1| hypothetical protein AALP_AAs50448U000500 [Arabis alpina]
Length=256

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 150/191 (79%), Gaps = 7/191 (4%)
 Frame = +3

Query  66   KMYGFERVSS-SYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS     G +K +I+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSGVDRAGDVKKEIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N++L GS  +LLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDLLTGSPGILLFLCIVPFVLIWPLHVYHQKHPVNLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfili  584
            LSF V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGKIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPL  617
            +T FIQMFFPL
Sbjct  183  VTSFIQMFFPL  193



>gb|ACU19337.1| unknown [Glycine max]
Length=246

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+   V Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTAVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LTGY FWA+KKGK F+FLGP+LFTSLF LILTG +QMFFPL
Sbjct  137  SAVVSSLTGYAFWASKKGKGFSFLGPVLFTSLFTLILTGMMQMFFPL  183



>ref|XP_010434338.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 2/187 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRW FIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWSFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKGKDF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILLVTSF  185

Query  597  iQMFFPL  617
            IQMFFPL
Sbjct  186  IQMFFPL  192



>ref|XP_004486099.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=257

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  G+NQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGDNQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LG FT S+S  V V+CANTDG IVLEALILT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGCFTLSISLTVGVTCANTDGKIVLEALILT  147

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            SAVV +LTGY FWA+KKGKDF++LGP+LFT LF L+LTG +QMFFPL
Sbjct  148  SAVVSSLTGYAFWASKKGKDFSYLGPLLFTCLFTLVLTGMMQMFFPL  194



>gb|KJB28559.1| hypothetical protein B456_005G055600 [Gossypium raimondii]
Length=248

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 145/185 (78%), Gaps = 2/185 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYG+E +S +      + D+E G TLYPG+ YGEN+LRWGFIRKVYGI++ Q+LLTT+V+
Sbjct  1    MYGYESLSRTDARKAEQIDLESGETLYPGLSYGENELRWGFIRKVYGILAVQLLLTTMVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V    + ++L+G+S LLLFL  +P +L+WPLHVY Q+HPLNFI LG FT  LS  + 
Sbjct  61   AFVVSSPSIIDLLRGNSGLLLFLCLIPLILVWPLHVYHQKHPLNFIILGAFTVFLSLTIG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTD  IVLEALILT+AVV +LTGYTFWA+K GKDFN+LGPILFTSL IL+LT  IQ
Sbjct  121  VSCANTDERIVLEALILTAAVVTSLTGYTFWASKNGKDFNYLGPILFTSLVILVLTSLIQ  180

Query  603  MFFPL  617
            MFFPL
Sbjct  181  MFFPL  185



>ref|XP_003594082.1| Transmembrane BAX inhibitor motif-containing protein [Medicago 
truncatula]
Length=274

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  GENQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGENQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LGLFT S+SF V V+CANTDG IVLEAL+LT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGLFTLSISFTVGVTCANTDGKIVLEALVLT  147

Query  477  SAVVLALTGYTFWAAKKGKDFNFLGP  554
            SAVV +LT Y FWA+KKGKDF++LGP
Sbjct  148  SAVVSSLTAYAFWASKKGKDFSYLGP  173



>ref|XP_006353796.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=242

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  105  GGMKGD-IEEGT-----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
             G+KGD +EEG+     LYPGIG  EN LRWGFIRKVY I+++QILLTT+V+ VTVLY P
Sbjct  2    SGVKGDDVEEGSTTSSLLYPGIGNEENDLRWGFIRKVYYILASQILLTTIVSAVTVLYLP  61

Query  267  LNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            +N +L G + LL+ L+    LLL   + Y+Q+HPLNF+FLGL+T +LS  + ++CA  DG
Sbjct  62   VNNILHGKTILLILLILPLLLLLPL-YFYRQKHPLNFVFLGLYTVTLSVSIGIACATIDG  120

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             IVLEALILTSAVVL+LTGYTFWA+K+G+DF+FLGPILF SL +L LTG +Q+FFPL
Sbjct  121  KIVLEALILTSAVVLSLTGYTFWASKRGQDFSFLGPILFASLIVLFLTGLLQLFFPL  177



>gb|KJB74488.1| hypothetical protein B456_011G181100 [Gossypium raimondii]
Length=236

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (77%), Gaps = 14/185 (8%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M  +ERVSS S     K D+E G TLY G+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MSRYERVSSTSASKADKVDLESGDTLYRGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            VSCANTDG            VV +LTGYTFWA+KKGKDF+FLGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDG------------VVASLTGYTFWASKKGKDFSFLGPILFTSLIILILTGLIQ  168

Query  603  MFFPL  617
            MFFPL
Sbjct  169  MFFPL  173



>ref|XP_009402474.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=248

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 138/183 (75%), Gaps = 6/183 (3%)
 Frame = +3

Query  75   GFERVSSSYDGGMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            G+ RV    + G +GD+E G   L+PG+  GE++LRWGF+RKVYGI++ QILLTT V+  
Sbjct  5    GYTRV----EKGEEGDLEAGWGPLHPGLSRGESELRWGFVRKVYGILATQILLTTAVSAA  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL+  +N  L  S  L + L  LP +LL PL+ Y+Q+HPLNF+FLGLFT  LS  + V+
Sbjct  61   TVLHPSVNAALAASPGLAVVLAILPLVLLCPLYHYRQKHPLNFMFLGLFTVCLSLSIGVA  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA++KGKDF+++GP +F+ L IL++T  IQ+F
Sbjct  121  CANTQGRIVLEALILTSAVVASLTGYTFWASRKGKDFSYVGPFVFSGLIILLVTSLIQIF  180

Query  609  FPL  617
            FPL
Sbjct  181  FPL  183



>ref|XP_003568491.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=293

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 131/168 (78%), Gaps = 3/168 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPGI  GEN LRWGFIRKVYGI+ AQ+LLTT+V+ VTVL+  LN  L  S
Sbjct  62   DLEAGNGEMLYPGISRGENALRWGFIRKVYGILCAQLLLTTIVSAVTVLHPTLNATLSSS  121

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ RHP NF+FLGLFT  LSF + V+CANT+G IVLEAL+
Sbjct  122  PVLALVLAVLPFVLMIPLYHYQHRHPHNFVFLGLFTLCLSFSIGVACANTEGTIVLEALV  181

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            LTSAVV +LT YTFWA+KKGK+F +LGP LF++L IL++T FIQ+FFP
Sbjct  182  LTSAVVASLTAYTFWASKKGKEFGYLGPFLFSALTILVVTSFIQIFFP  229



>ref|XP_004243681.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=243

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = +3

Query  105  GGMKG-DIEEGT------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
             G+KG D+EEG+      LYPGI   EN LRW FIRKVY I+++QILLTT+V+  TVLY 
Sbjct  2    SGVKGNDVEEGSTTTSLLLYPGIRNDENDLRWDFIRKVYYILASQILLTTIVSAGTVLYL  61

Query  264  PLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
            P+N +L G + LL+ L+    LLL   + Y+Q+HPLNF+FLG++T +LS  + ++CA  +
Sbjct  62   PVNNILHGKTILLILLILPLLLLLPL-YFYRQKHPLNFVFLGIYTITLSISIGIACATIN  120

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            G IVLEALILTSAVVL+LTGYTFWA+K+G+DF+FLGPILF SL +LILTGF+Q+FFPL
Sbjct  121  GKIVLEALILTSAVVLSLTGYTFWASKRGQDFSFLGPILFASLNVLILTGFLQLFFPL  178



>ref|XP_006654376.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=258

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G   TLYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  25   DLEAGNGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSSS  84

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF++LGLFT  LSF + V+CANT G IVLEALI
Sbjct  85   PTLALVLAVLPFVLMVPLYHYQHKHPHNFVYLGLFTLCLSFSIGVACANTQGKIVLEALI  144

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LTSAVV +LT YTFWA+KKGK+F +LGPILF++L +LI+  F+Q+FFPL
Sbjct  145  LTSAVVASLTAYTFWASKKGKEFGYLGPILFSALILLIVISFVQVFFPL  193



>ref|NP_001055493.1| Os05g0402300 [Oryza sativa Japonica Group]
 gb|AAT85152.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT85204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17407.1| Os05g0402300 [Oryza sativa Japonica Group]
 dbj|BAG91740.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79197.1| hypothetical protein OsI_19905 [Oryza sativa Indica Group]
 gb|EEE63667.1| hypothetical protein OsJ_18485 [Oryza sativa Japonica Group]
Length=264

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSSS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF++LGLFT  LSF + V+CANT G IVLEALI
Sbjct  91   PTLALVLAVLPFVLMVPLYHYQHKHPHNFVYLGLFTLCLSFSIGVACANTQGKIVLEALI  150

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LTSAVV +LT YTFWA+KKGK+F +LGPILF++L +L++  FIQ+FFPL
Sbjct  151  LTSAVVASLTAYTFWASKKGKEFGYLGPILFSALVLLVVISFIQVFFPL  199



>ref|NP_001149877.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG37071.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG37899.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACN29032.1| unknown [Zea mays]
 gb|AFW77939.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=264

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LT+ VV++LT Y FWA+KKGK+F +LGPIL ++L IL+LT F+Q+FFPL
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPL  199



>ref|XP_004962144.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=264

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            + L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   AGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LT+ VV +LT Y FWA+KKGK+F +LGPIL ++L IL+LT F+Q+FFPL
Sbjct  151  LTAGVVASLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQIFFPL  199



>gb|EMS67433.1| hypothetical protein TRIUR3_20458 [Triticum urartu]
 gb|EMT15777.1| hypothetical protein F775_27898 [Aegilops tauschii]
Length=266

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 7/172 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G   TLYPGI  GEN LRWGFIRKVYGI+ AQ++LTT+V+ +TV +  LN  L  S
Sbjct  31   DLEAGNGETLYPGISRGENALRWGFIRKVYGILCAQLVLTTVVSAITVFHPTLNATLSNS  90

Query  291  SAlllflvfl----pflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
              L L L  L       ++ PL++YQ RHP N   LGLFT  LSF + V+CANT+G IVL
Sbjct  91   PVLALVLAVLPFIRYDAVMIPLYIYQHRHPHNLAILGLFTLCLSFSIGVACANTEGTIVL  150

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            +AL+LTSAVV++LT YTFWAAKKGK+F++LGP LF++L IL++  F Q+FFP
Sbjct  151  QALVLTSAVVVSLTAYTFWAAKKGKEFSYLGPFLFSALTILVVISFTQIFFP  202



>ref|NP_001149641.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG36210.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=264

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 130/169 (77%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP N +FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNSVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LT+ VV++LT Y FWA+KKGK+F +LGPIL ++L IL+LT F+Q+FFPL
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPL  199



>gb|ACG33127.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=264

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 130/169 (77%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTWETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP N +FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNSVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LT+ VV++LT Y FWA+KKGK+F +LGPIL ++L IL+LT F+Q+FFPL
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPL  199



>gb|ABK25077.1| unknown [Picea sitchensis]
Length=245

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 127/181 (70%), Gaps = 7/181 (4%)
 Frame = +3

Query  75   GFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtv  254
            G E V   + GG       G LYPG+   +N++R GF++KVY I+S Q+LLT +VA   V
Sbjct  10   GVEDVEMGHGGG-------GVLYPGLSLQDNEMRLGFLKKVYSILSMQLLLTVIVAATVV  62

Query  255  lYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            LY P    L  +  LLL +  LP +L+ PL+ Y Q+HP+N   LGLFT  LS  V +SCA
Sbjct  63   LYTPATLFLVKTPGLLLGISILPLILMCPLYAYHQKHPVNLALLGLFTVVLSLTVGISCA  122

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
             T G IVLEALILT+AVV +LTGYTFWAAKKGKDF+FLGPILF+SL ++IL GFIQ+FFP
Sbjct  123  YTKGIIVLEALILTAAVVFSLTGYTFWAAKKGKDFSFLGPILFSSLLVIILFGFIQVFFP  182

Query  615  L  617
            L
Sbjct  183  L  183



>ref|XP_002975127.1| hypothetical protein SELMODRAFT_150230 [Selaginella moellendorffii]
 ref|XP_002977530.1| hypothetical protein SELMODRAFT_151868 [Selaginella moellendorffii]
 gb|EFJ21534.1| hypothetical protein SELMODRAFT_151868 [Selaginella moellendorffii]
 gb|EFJ23912.1| hypothetical protein SELMODRAFT_150230 [Selaginella moellendorffii]
Length=238

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +3

Query  105  GGMKG---DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            GG +G   DIE G LYPG+   ++ LRWGFIRKVYGI++ QI+LT +VA V V   P+  
Sbjct  3    GGKQGYDYDIESGGLYPGLSADDSTLRWGFIRKVYGILTTQIVLTAIVASVVVFSRPVAM  62

Query  276  VLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
                +  L +FL FLP +LL  +H Y+Q HP+N I LG+FT  LS PV +SCA T G IV
Sbjct  63   FFVTTPGLPIFLAFLPLILLCVIHPYRQSHPINLILLGIFTVCLSLPVGISCAFTRGDIV  122

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LEALILT+A+   LT YT+WAAK+G+DF+FLGP LF ++ ILIL G IQ FFP+
Sbjct  123  LEALILTAAIGFGLTAYTYWAAKRGQDFSFLGPFLFVAVIILILWGLIQSFFPI  176



>ref|XP_001768622.1| predicted protein [Physcomitrella patens]
 gb|EDQ66560.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = +3

Query  93   SSYDGGMKGD----IEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            + + GG+K D    +E G      LYPGI   EN LRWGFIRKVYGI+S QILLTT+VAG
Sbjct  2    AEFQGGLKADKFDDLEAGFGGSSMLYPGISADENTLRWGFIRKVYGILSVQILLTTIVAG  61

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
              V +  L    + +  L+LFL F+P +++ PL+ Y Q HPLN I LGLFT ++S  V +
Sbjct  62   SVVYFEGLKTFFQQTPGLVLFLAFVPLIVMCPLYAYHQSHPLNLILLGLFTVTMSLSVGI  121

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            S +     IVLEA +LT+ VV+ALTGYT+WAAKKG DFNFLGP+LFTSL +L+  G IQ 
Sbjct  122  SSSMAPAPIVLEAFVLTTIVVVALTGYTYWAAKKGMDFNFLGPVLFTSLVVLVFFGLIQA  181

Query  606  FFPL  617
            FFPL
Sbjct  182  FFPL  185



>ref|XP_001757037.1| predicted protein [Physcomitrella patens]
 gb|EDQ78268.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +3

Query  120  DIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            D+E G      LYPGI   EN+LRWGFIRKVYGI+S Q+LLTT+++   V   P+ E   
Sbjct  14   DLEVGYGSTPALYPGISADENELRWGFIRKVYGILSVQVLLTTVISAFVVSTPPVVEFFL  73

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  +LL   F P +L+ PL+ Y Q+HP+N + LGLFTA++S  V +S A T G IVLEA
Sbjct  74   SNIWVLLLTSFAPLILMCPLYYYHQQHPVNLVLLGLFTATISLTVGISSALTKGYIVLEA  133

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            L+LT+AVVL+LT YT WA++KG DF+FLGPILF SL IL+L G IQ FFPL
Sbjct  134  LLLTAAVVLSLTAYTHWASRKGHDFSFLGPILFASLVILVLFGLIQAFFPL  184



>gb|AFW77940.1| hypothetical protein ZEAMMB73_292541 [Zea mays]
Length=242

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKG  530
            LT+ VV++LT Y FWA+KKG
Sbjct  151  LTAGVVVSLTAYAFWASKKG  170



>ref|XP_002968030.1| hypothetical protein SELMODRAFT_88443 [Selaginella moellendorffii]
 gb|EFJ31377.1| hypothetical protein SELMODRAFT_88443 [Selaginella moellendorffii]
Length=252

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  105  GGMKGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GG   DIE      G LYPGI Y +N LRWGFIRKVYGI+S QI+LT LVA V V   P+
Sbjct  12   GGGYADIETGYEPSGALYPGIDYSDNVLRWGFIRKVYGILSTQIVLTALVAAVIVFSQPV  71

Query  270  NEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
             +    ++ LL+ L  LP +LL PL+ YQ  HPLN + L LFT  LS  V  SCA   G 
Sbjct  72   ADFFAHNTLLLVLLALLPLILLCPLYNYQHHHPLNLVLLSLFTVFLSLSVGTSCAFIRGD  131

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LEALILT+ V LALT YTFWA K+G DF+FL P LF SL +++L G IQ+FFPL
Sbjct  132  VLLEALILTATVALALTAYTFWAVKQGHDFSFLRPYLFVSLVVVVLWGIIQIFFPL  187



>ref|XP_002992613.1| hypothetical protein SELMODRAFT_430816 [Selaginella moellendorffii]
 gb|EFJ06315.1| hypothetical protein SELMODRAFT_430816 [Selaginella moellendorffii]
Length=252

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  105  GGMKGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GG   DIE      G LYPGI Y +N LRWGFIRKVYGI+S QI+LT LVA V V   P+
Sbjct  12   GGGYADIETGYEPSGALYPGIDYSDNVLRWGFIRKVYGILSTQIVLTALVAAVIVFSQPV  71

Query  270  NEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
             +    ++ LL+ L  LP +LL PL+ YQ  HPLN + L LFT  LS  V  SCA   G 
Sbjct  72   ADFFAHNTLLLVLLALLPLILLCPLYNYQHHHPLNLVLLSLFTVFLSLSVGTSCAFIRGD  131

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LEALILT+ V LALT YTFWA K+G DF+FL P LF SL +L+L G IQ+FFPL
Sbjct  132  VLLEALILTATVALALTAYTFWAVKQGHDFSFLRPYLFVSLVVLVLWGIIQIFFPL  187



>emb|CAI53895.2| putative receptor associated protein [Capsicum chinense]
Length=242

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 122/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW F RKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KYDVEAGTAPLYPEM-LESPELRWSFTRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   + + LV  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F V ++CA T G ++L
Sbjct  67   TSAGIGVYIVLVITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L   IQ+FFPL
Sbjct  127  EAVILTTAVVISLTAYTFWAAKRGQDFNFLGPFLFGALVVLLLFSLIQIFFPL  179



>ref|XP_006349714.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=242

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPL  179



>ref|XP_010326401.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
 ref|XP_004253381.2| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=242

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPL  179



>gb|AIT42146.1| Bax inhibitor-like protein [Solanum tuberosum]
Length=242

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPL  179



>ref|XP_008786054.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 123/175 (70%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +     +LRW FIRK+Y I++AQ+ LT  VA V V   P++   
Sbjct  8    GKDGDVEAGPRLLYPMM-LESPELRWAFIRKIYVILTAQMALTVAVASVVVAVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S+A   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFT S+SF V ++CA T G +
Sbjct  67   VSSAAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTVSISFAVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LEA ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQMFFPL
Sbjct  127  ILEAAILTAVVVVSLTLYTFWAARRGHDFNFLGPFLFAAVLVLLVFALIQMFFPL  181



>ref|XP_004290629.1| PREDICTED: BI1-like protein [Fragaria vesca subsp. vesca]
Length=239

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 121/173 (70%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD+E G+  LYP +     +LRW FIRK+Y II+ Q+L T  VA V V Y P+      
Sbjct  5    KGDVESGSAPLYPMM-LESPELRWSFIRKIYSIIAVQLLATIAVAAVVVSYHPIANFFVS  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+NFI LG+FT SL+F V ++CA T G ++L
Sbjct  64   TGAGLALYIVLIITPFIVLCPLYYYYQRHPVNFILLGIFTISLAFVVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E+ ILT+ VV+ALT YTFWAA++G+DFNFLGP L  +L +LI+ G IQ+FFPL
Sbjct  124  ESAILTAVVVIALTLYTFWAARRGQDFNFLGPFLSGALLVLIVFGLIQIFFPL  176



>ref|XP_001768467.1| predicted protein [Physcomitrella patens]
 gb|EDQ66829.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 122/184 (66%), Gaps = 6/184 (3%)
 Frame = +3

Query  84   RVSSSYDG-GMKGDIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +  S Y G G   D+E G      LYPGI   EN+LRWG IRKVY I+S Q+LLT  V+ 
Sbjct  3    KCDSEYAGYGTSPDLEVGYGARPALYPGIYADENELRWGLIRKVYNILSIQVLLTAAVSA  62

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
              V              +L F    P +L+ PL+ Y+Q+HP+N + LGLFTA++S  V +
Sbjct  63   FVVFTPAALSFFAVHPWILFFASITPLILMCPLYYYRQQHPVNLVLLGLFTATISLSVGI  122

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQM  605
            SCA T+G IVLEAL+LT+ VVLALT YT +AA+KG DF+FLGPILFT+L I++L G IQ+
Sbjct  123  SCALTNGYIVLEALLLTAGVVLALTAYTLYAARKGHDFSFLGPILFTTLTIILLFGLIQV  182

Query  606  FFPL  617
            FFPL
Sbjct  183  FFPL  186



>ref|XP_009618293.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=242

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KDDVEAGTRPLYPAM-LEAPELRWSFIRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TSAGLGLYIVLIITPFITLCPLYYYHQKHPVNYLLLGIFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAA++G+DFNFLGP LF +L +L++  FIQ+ FPL
Sbjct  127  EAVILTTAVVISLTLYTFWAARRGQDFNFLGPFLFGALIVLLVFAFIQILFPL  179



>ref|XP_010923520.1| PREDICTED: BI1-like protein [Elaeis guineensis]
 gb|AEZ00913.1| putative transmembrane BAX inhibitor motif-containing protein 
[Elaeis guineensis]
Length=244

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +      LRW FIRK+Y I++AQ+ LT  VA V V   P++   
Sbjct  8    GKDGDLEAGPRLLYPMM-LESPDLRWAFIRKIYVILTAQMALTVAVASVVVTVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S A   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFTAS+SF V ++CA T G +
Sbjct  67   VSSGAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTASISFAVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LEA ILT+AVV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQM FPL
Sbjct  127  ILEAAILTTAVVVSLTLYTFWAARRGHDFNFLGPFLFAAVLVLLVFAVIQMLFPL  181



>ref|XP_009789970.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=242

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KDDVEAGTRPLYPAM-LEAPELRWSFIRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TSAGLGLYIVLIITPFITLCPLYYYHQKHPVNYLLLGVFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+AVV++LT YTFWAA++G+DFNFLGP LF +L +L++  FIQ+ FPL
Sbjct  127  EAVILTTAVVISLTLYTFWAARRGQDFNFLGPFLFGALIVLLVFAFIQILFPL  179



>gb|KFK35489.1| hypothetical protein AALP_AA5G291100 [Arabis alpina]
Length=242

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V Y P++     
Sbjct  8    KHDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVAYHPISVFFTT  66

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +S   AL + L+  P +++ PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TSLGFALYILLILTPLIVMCPLYYYHQKHPVNYLLLGIFTVSLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  127  EAVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  179



>ref|XP_006303615.1| hypothetical protein CARUB_v10011301mg [Capsella rubella]
 gb|EOA36513.1| hypothetical protein CARUB_v10011301mg [Capsella rubella]
Length=247

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E      E TLYP +     QLRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGAGGGESTLYPTM-LESPQLRWGFIRKVYSIIAFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                ++A   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTTAGLVLWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>ref|XP_006352761.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=245

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 8/174 (5%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRWGFIRKVY I+S Q+L+T  VA V V   P+     
Sbjct  12   KDDVEAGERPLYPAML--ENPQLRWGFIRKVYSILSFQLLITIGVAAVVVTVHPIAHFFV  69

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+ LWPL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++
Sbjct  70   STGAGLALYILLIISPFITLWPLYYYHQKHPVNFLLLGLFTVTLAFAVGLTCAFTSGKVI  129

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE++ILT+AVVL+LT YTFWAA++G DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  130  LESVILTTAVVLSLTVYTFWAARRGHDFNFLGPFLFGALMVLMLFAFIQLLFPL  183



>ref|XP_004242346.2| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=252

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 8/174 (5%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRWGFIRKVY I+S Q+L+T  V  V V   P+     
Sbjct  19   KDDVEGGARPLYPAML--ENPQLRWGFIRKVYSILSLQLLITIAVGAVVVTVHPIAHFFV  76

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+ L PL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++
Sbjct  77   STGAGLALYILLIIAPFITLSPLYYYHQKHPVNFLLLGLFTVTLAFAVGLTCAFTSGKVI  136

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE++ILT+AVVL+LT YTFWAA++G DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  137  LESVILTAAVVLSLTIYTFWAARRGHDFNFLGPFLFGALMVLMLFAFIQLLFPL  190



>ref|XP_010457316.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>ref|XP_010481523.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGAGGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>emb|CDX89914.1| BnaA10g01680D [Brassica napus]
Length=245

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+     
Sbjct  10   KDDVESGGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAVFFS  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G ++
Sbjct  69   TTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGVFTVALAFAVGLSCAFTSGKVI  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPL
Sbjct  129  LESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPL  182



>ref|XP_009119572.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=245

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+     
Sbjct  10   KDDVESGGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAVFFS  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G ++
Sbjct  69   TTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGVFTVALAFAVGLSCAFTSGKVI  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPL
Sbjct  129  LESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPL  182



>ref|XP_002889434.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65693.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=246

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 9/176 (5%)
 Frame = +3

Query  114  KGDIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     +LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVETGGGGERSLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVAATVVFVRPIAVF  68

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G 
Sbjct  69   FATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGK  128

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  VILEAAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  184



>ref|NP_171806.1| protein lifeguard 4 [Arabidopsis thaliana]
 ref|NP_001184896.1| protein lifeguard 4 [Arabidopsis thaliana]
 gb|AAD25802.1|AC006550_10 Belongs to the PF|01027 Uncharacterized protein family UPF0005 
with 7 transmembrane domains [Arabidopsis thaliana]
 gb|AAR24681.1| At1g03070 [Arabidopsis thaliana]
 dbj|BAD43212.1| putative glutamate/aspartate-binding peptide [Arabidopsis thaliana]
 gb|AEE27524.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4-like protein [Arabidopsis thaliana]
 gb|AEE27525.1| transmembrane BAX inhibitor motif-containing protein [Arabidopsis 
thaliana]
Length=247

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      +LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGREGGERSLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVASTVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVVLSLTVYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>ref|XP_007200360.1| hypothetical protein PRUPE_ppa010573mg [Prunus persica]
 gb|EMJ01559.1| hypothetical protein PRUPE_ppa010573mg [Prunus persica]
Length=244

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 119/175 (68%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRW FIRK+Y II+ Q+L+T  VA   V Y P+    
Sbjct  8    KTDVEAGVGPSPLYPMM-LESPELRWSFIRKIYSIIAIQLLVTIAVAATVVSYRPVAHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+ LPF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  67   VSTSAGLALYIVLIILPFIVLCPLYYYHQKHPVNYLLLGVFTISLAFIVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE++ILT+ VVL LT YTFWAAK+G DFNFLGP L  ++ +LI+   IQ+FFPL
Sbjct  127  ILESVILTAVVVLGLTLYTFWAAKRGHDFNFLGPFLSGAILVLIVFALIQVFFPL  181



>ref|XP_006402289.1| hypothetical protein EUTSA_v10006212mg [Eutrema salsugineum]
 gb|ESQ43742.1| hypothetical protein EUTSA_v10006212mg [Eutrema salsugineum]
Length=240

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 119/171 (70%), Gaps = 5/171 (3%)
 Frame = +3

Query  120  DIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V + P++     + 
Sbjct  7    DLESAQTPLYPKMTTEPPELRWSFIRKVYSIISIQLLVTIAVAATVVKFPPISVFFTTTG  66

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + ++F P +++ PL+ Y Q+HP+N+I LG+FT SL+F V ++CA T G ++LE+
Sbjct  67   AGFALYILVIFTPLIVMCPLYYYHQKHPVNYILLGIFTVSLAFAVGLTCAFTSGKVILES  126

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  127  VILTSVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  177



>ref|XP_010474912.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ V+L+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVLLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>ref|XP_009398556.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=244

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 6/172 (3%)
 Frame = +3

Query  117  GDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            GD+E GT  LYP +     +LRW FIRKVY II+ Q+ LT  VA V +   P++  L  S
Sbjct  11   GDLESGTQPLYPMMS-ESPELRWAFIRKVYSIIAVQLALTAAVAAVVIAVPPISHFLVSS  69

Query  291  SAlllflvflp---flllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +A L     L     ++L PL+ Y QRHP+N + LGLFT S SF V +SCA TDG ++LE
Sbjct  70   TAGLAVYFLLIFLPLIVLCPLYYYHQRHPVNLLLLGLFTVSFSFAVGMSCAFTDGKVILE  129

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            A ILT+ VV++LT YTFWA+++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  130  AAILTAVVVVSLTLYTFWASRRGHDFNFLGPFLFAAILVLLVFSLIQILFPL  181



>ref|XP_010474910.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +++F + ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVAMAFAIGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPL  185



>gb|KCW60898.1| hypothetical protein EUGRSUZ_H03636, partial [Eucalyptus grandis]
Length=310

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  345  HVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAK  524
            H+YQQ+HPLNFIFLGLFT SLS  V VSCANT+G IVLEALILTS+VV ALTGYTFWA+K
Sbjct  157  HIYQQKHPLNFIFLGLFTLSLSLTVGVSCANTEGRIVLEALILTSSVVCALTGYTFWASK  216

Query  525  KGKDFNFLGPilftslfililtgfiQMFFPL  617
            KGKDF++LGPILFT L +L++T F+QM FPL
Sbjct  217  KGKDFSYLGPILFTGLIVLLMTSFMQMMFPL  247



>emb|CDY18147.1| BnaC05g01700D [Brassica napus]
Length=248

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+  
Sbjct  10   KDDVESGGNSGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G
Sbjct  69   FFSTTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGIFTVALAFAVGLSCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPL
Sbjct  129  KVILESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMIFALIQIFFPL  185



>ref|XP_006418268.1| hypothetical protein EUTSA_v10008600mg [Eutrema salsugineum]
 gb|ESQ36621.1| hypothetical protein EUTSA_v10008600mg [Eutrema salsugineum]
Length=246

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+    
Sbjct  10   KDDVESGGGESPLYPTM-MESPELRWGFIRKVYSIIAFQLLATIAVAATVVTVRPIAVFF  68

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G +
Sbjct  69   ATTSAGLALWILLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKV  128

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPL
Sbjct  129  ILESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPL  183



>ref|XP_010256169.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=243

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 120/175 (69%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  GMKGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G+  LYP +     +LRW FIRKVY I++ Q+LLT  VA V V   P+    
Sbjct  7    GKAGDVEAGSRQLYPMM-LESPELRWAFIRKVYSILTIQLLLTIAVAAVVVSVHPIATFF  65

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S    AL + ++ LPF++L PL+ Y QRHP+N + LGLFT SL+F V ++CA T G I
Sbjct  66   VSSGPGFALYIVIIILPFIVLCPLYYYYQRHPVNLLLLGLFTVSLAFAVGLTCAFTSGKI  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE+ ILT+AVVL+LT YTFWAAK+G DFNFLGP LF SL  L++  FIQ+ FPL
Sbjct  126  ILESAILTAAVVLSLTLYTFWAAKRGHDFNFLGPFLFGSLLALMVFAFIQILFPL  180



>ref|XP_002463744.1| hypothetical protein SORBIDRAFT_01g005260 [Sorghum bicolor]
 gb|EER90742.1| hypothetical protein SORBIDRAFT_01g005260 [Sorghum bicolor]
Length=243

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 118/186 (63%), Gaps = 9/186 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+GF +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+G 
Sbjct  1    MFGFRKADPDLEAG-----GASLLYPGMT-ESPELRWAFVRKIYVILAVQLAMTAAVSGF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIILPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVLMVFSLI  174

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  175  QIFFPL  180



>gb|KFK42668.1| hypothetical protein AALP_AA1G024300 [Arabis alpina]
Length=247

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = +3

Query  114  KGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E     E TLYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVESSGGGERTLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVAATVVTVRPIAVF  68

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + L+  PF+++ PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G 
Sbjct  69   FSTTSAGLALWIVLIITPFVVMCPLYYYHQKHPVNYLLLGIFTVTLAFGVGLSCAFTSGK  128

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +LI+  FIQ+ FPL
Sbjct  129  VILESAILTTVVVLSLTVYTFWAAKKGYDFNFLGPFLFGALIVLIVFAFIQILFPL  184



>ref|XP_008235367.1| PREDICTED: BI1-like protein [Prunus mume]
Length=244

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRW FIRK+Y II+ Q+L+T  VA   V Y P+    
Sbjct  8    KTDVEAGGGPSPLYPMM-LESPELRWSFIRKIYSIIAIQLLVTIAVAAAVVSYRPVAHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+ LPF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  67   VSTSAGLALYIVLIILPFIVLCPLYYYHQKHPVNYLLLGVFTISLAFIVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE++ILT+ VVL LT YTFWAAK+G DFNFLGP L  ++ ILI+   IQ+FFPL
Sbjct  127  ILESVILTAVVVLGLTLYTFWAAKRGHDFNFLGPFLSGAILILIVFALIQVFFPL  181



>ref|XP_004981439.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=242

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPG+    + LRW F+RK+Y I+S Q+ +T LV+   V    ++     S
Sbjct  9    DLEAGGSELLYPGMTESPD-LRWAFVRKIYVILSVQLAMTALVSAFVVKVPAISLFFVSS  67

Query  291  SAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V ++CA T G ++LE
Sbjct  68   NAGIALYIFLLILPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAVGMTCAFTSGKVILE  127

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            A ILT+ VV++LT YTFWAAK+G DFNFLGP LF +L +L++   +Q+FFPL
Sbjct  128  AAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAALMVLMVFSLVQIFFPL  179



>ref|XP_010545100.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=242

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY IIS Q+L T  VA V V   P++     
Sbjct  8    KHDLESGPRPLYPMM-LESPELRWSFIRKVYSIISIQLLATIAVASVVVTVHPISTFFTT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F P ++L PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYVLLIFTPLIVLCPLYYYHQKHPVNYLLLSVFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VVL+LTGYTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  ESVILTTVVVLSLTGYTFWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPL  179



>gb|ACG32419.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=243

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 9/186 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYAILTVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIVLPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV +LT YTFWAAK+G DFNFLGP L  ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVNSLTAYTFWAAKRGHDFNFLGPFLIAAIMVLMVFSLI  174

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  175  QIFFPL  180



>gb|KDP21410.1| hypothetical protein JCGZ_21881 [Jatropha curcas]
Length=242

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY II  Q+L T  VA V V Y P+      
Sbjct  8    KSDVEAGARPLYPMM-LESPQLRWAFIRKVYSIICFQLLATIAVAAVVVSYHPIAHFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+ +PF++L PL+ Y Q+HP+N+  LG+FT  LSF V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIIMPFIVLCPLYYYHQKHPVNYFLLGIFTICLSFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VVL+LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  127  ESVILTTVVVLSLTLYTFWAARRGHDFNFLGPFLFGAIIVLMVFAFIQILFPL  179



>ref|XP_009804930.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=245

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRWGFIRKVY I+S Q+LLT  VA V V   P+      
Sbjct  11   KDDVEGGARPLYPTM-LESPELRWGFIRKVYSILSLQLLLTIAVASVVVTVHPIAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT +L+F V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVALAFAVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT++VVL+LT YTFWAAK+G DFNFLGP LF +L +L+L  FIQ  FPL
Sbjct  130  ESVILTTSVVLSLTVYTFWAAKRGHDFNFLGPFLFGALIVLMLFAFIQFLFPL  182



>ref|XP_011082582.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=242

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y IIS Q+LLT  VA + V   P++     
Sbjct  8    KYDVESGRQPLYPMM-LESPELRWSFIRKIYTIISIQLLLTVAVAALVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF++L PL+ Y QRHPLN+  LGLFT SL+F V ++C+ T G ++L
Sbjct  67   TSAGLALYILLIITPFIVLCPLYYYYQRHPLNYFLLGLFTVSLAFAVGLTCSYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA +LT+ VV++LT YTFWAAK+G+DFNFLGP LF ++ +L+    IQ+FFPL
Sbjct  127  EAALLTAVVVVSLTLYTFWAAKRGQDFNFLGPFLFGAVVVLMFFSIIQIFFPL  179



>emb|CDP03667.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 121/173 (70%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y II+AQ++LT  VA V V Y P+      
Sbjct  8    KDDLESGARPLYPMM-LESPELRWAFIRKIYSIITAQLVLTVAVAAVVVTYHPIARFFTT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLTLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT AVV++LT YTFWAAK+G DFNFLGP LF ++ +L+L   IQ+ FPL
Sbjct  127  ESVILTGAVVISLTLYTFWAAKRGHDFNFLGPFLFGAVVVLMLFAIIQILFPL  179



>ref|XP_010259137.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=243

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 122/173 (71%), Gaps = 8/173 (5%)
 Frame = +3

Query  117  GDIEEG--TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            GDIE G   LYP +   EN QLRWGFIRKVY I++ Q LLT +V+ V V   P+      
Sbjct  10   GDIEAGGQQLYPKML--ENPQLRWGFIRKVYCILAVQFLLTVVVSAVIVFVRPIAVFFVT  67

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+ LPF+LL PL+ Y Q+HP+N I LGLFT ++SF V ++CA T G I+L
Sbjct  68   TAAGFALYIVLIILPFILLCPLYYYHQKHPVNLILLGLFTVAISFSVGLTCAFTKGKIIL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA ILT+ VV++LT YTFWAAKKG DF+FLGP LF +L +L + GFIQM FPL
Sbjct  128  EAAILTAVVVVSLTIYTFWAAKKGHDFSFLGPFLFAALLVLTIFGFIQMLFPL  180



>ref|NP_001149171.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG34452.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACR38716.1| unknown [Zea mays]
 gb|AFW67367.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=243

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 9/186 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYVILTVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIVLPFIVLCPLHYYHQKHPINLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV +LT YTFWAAK+G DFNFLGP L  ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVNSLTAYTFWAAKRGHDFNFLGPFLIAAIMVLMVFSLI  174

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  175  QIFFPL  180



>ref|XP_010038064.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW49862.1| hypothetical protein EUGRSUZ_K03330 [Eucalyptus grandis]
Length=241

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            + D+E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P++     
Sbjct  7    RKDVESGARPLYPMM-LESPELRWAFIRKIYSIVALQLLATIAVGAVVVSVHPISRFFVS  65

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF++L PL+ Y QRHP+N++ LG+FT +L+F + ++CA T G ++L
Sbjct  66   TTAGLALYIVLIITPFIVLCPLYYYHQRHPVNYLLLGIFTVTLAFAIGLTCAFTSGKVIL  125

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV++LT YTFWAA++G+DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  126  EAVILTAVVVVSLTLYTFWAARRGQDFNFLGPFLFGAVIVLMVFAMIQILFPL  178



>ref|XP_003632329.1| PREDICTED: BI1-like protein [Vitis vinifera]
Length=242

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 122/174 (70%), Gaps = 8/174 (5%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRW FIRK+Y I++ Q+LLT  VA V V   P+     
Sbjct  8    KSDVEAGARPLYPMML--ENPQLRWAFIRKIYSIVAVQLLLTIAVAAVVVTVHPIAYFFV  65

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+F+PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++
Sbjct  66   STGAGLALYIVLIFVPFIVLCPLYYYHQRHPVNYLLLGVFTVSLAFVVGLTCAFTSGKVI  125

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  126  LESVILTTVVVVSLTLYTFWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPL  179



>ref|XP_010679114.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 104/154 (68%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G+    LYP +     +LRW FIRKVY II+ Q++ T +V  + V Y P+    
Sbjct  13   KHDVESGSHSQQLYP-VMLESPELRWSFIRKVYSIIAIQLIATIIVGAIVVSYHPIAHFF  71

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S+   A  + L+  P ++L PL+ Y Q HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  72   TSSTGGFACYIILIITPLIVLCPLYYYHQSHPVNYVLLGIFTISLAFSVGLTCAFTSGKV  131

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            +LE++ILT+AVV++LT YTFWAAK+G DFNFLGP
Sbjct  132  ILESVILTAAVVVSLTLYTFWAAKRGHDFNFLGP  165



>ref|XP_010070336.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW59012.1| hypothetical protein EUGRSUZ_H01638 [Eucalyptus grandis]
Length=242

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK-  284
            K D E G   LYP +     QLRW FIRKVY I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGDRPLYPAM-LESPQLRWAFIRKVYSIVAFQLLATIAVGAVVVYVHPIAHFFTS  66

Query  285  --GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
              G  AL + L+ +PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G I+L
Sbjct  67   TPGGLALYIVLIIVPFIVLCPLYYYHQRHPVNYLLLGIFTISLAFVVGLTCAFTSGKIIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+AVV++LT YTFWAA++G DFNFLGP LF ++F L++  FIQ+ FPL
Sbjct  127  ESVILTTAVVVSLTLYTFWAARRGHDFNFLGPFLFGAIFALMIFAFIQLLFPL  179



>ref|XP_010556773.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=245

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = +3

Query  114  KGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     + RWGFIRKVY II+ Q+L T  VA   V   P+     
Sbjct  10   KNDVEFGVARPLYPTM-LESPEFRWGFIRKVYSIIAFQLLATIAVAATVVSVRPIALFFA  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+++ PL+ Y Q+HP+N+  LG+FT +L+F V ++CA T G I+
Sbjct  69   TTGAGLALYIVLIITPFIVMCPLYYYHQKHPVNYFLLGIFTLALAFAVGLTCAFTSGKII  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE++ILT+AVVLALT YTFWA+KKG DFNFLGP LF S+ +LI+   +Q+ FPL
Sbjct  129  LESVILTTAVVLALTFYTFWASKKGYDFNFLGPFLFASVIVLIVFALVQVLFPL  182



>emb|CDX93913.1| BnaC04g20720D [Brassica napus]
Length=239

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + ++F P +++ PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILVIFTPLIVMCPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>gb|KJB34592.1| hypothetical protein B456_006G074200 [Gossypium raimondii]
Length=711

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 106/131 (81%), Gaps = 2/131 (2%)
 Frame = +3

Query  60   KAKMYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            + KM+ ++RVS SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT
Sbjct  581  REKMFAYDRVSHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTT  640

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS 
Sbjct  641  VVSAFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSL  700

Query  414  PVAVSCANTDG  446
             V VSCANTDG
Sbjct  701  TVGVSCANTDG  711



>ref|XP_003553470.1| PREDICTED: BI1-like protein-like isoform X1 [Glycine max]
 ref|XP_006604458.1| PREDICTED: BI1-like protein-like isoform X2 [Glycine max]
Length=243

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 14/181 (8%)
 Frame = +3

Query  111  MKGDIEEG--------TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
            MK D+E G         LYP +   EN QLRW FIRKVY I++ Q+LLT  VA V V   
Sbjct  3    MKRDVESGGDGNANPRPLYPAML--ENPQLRWAFIRKVYTILTIQLLLTIAVASVVVFVR  60

Query  264  PLNEVL---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            P+        G  AL + L+  P + + PL+ Y Q+HPLN+I L +FT +L+F V ++CA
Sbjct  61   PIALFFVSSPGGLALYIVLLIAPLITVCPLYYYHQKHPLNYILLFIFTVTLAFAVGLTCA  120

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
             T G I+LE++ILT+ VV++LT YTFWAAK+G DFNFLGP LF +L +L+L  FIQ+ FP
Sbjct  121  FTSGRIILESVILTTIVVVSLTLYTFWAAKRGHDFNFLGPFLFGALLVLMLFAFIQLLFP  180

Query  615  L  617
            L
Sbjct  181  L  181



>emb|CDY53716.1| BnaAnng12570D [Brassica napus]
Length=239

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  P +++WPL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIVTPLIVMWPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>gb|EYU46520.1| hypothetical protein MIMGU_mgv11b010581mg [Erythranthe guttata]
Length=243

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G K D+E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P++   
Sbjct  7    GGKYDVESGGRPLYPMM-LESPELRWSFIRKIYTIVAIQLLCTIAVGAVVVTIHPISLFF  65

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A   L + L+  PF++L PL+ Y QRHP N++ LG+FT SL+F V ++CA T G +
Sbjct  66   TTTGAGLALYIILIITPFIVLCPLYYYYQRHPWNYLLLGIFTLSLAFSVGLTCAFTSGKV  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE++ILT+AVV++LT YTFWAAK+G DFNFLGP LF +L +L+L   IQ+FFPL
Sbjct  126  ILESVILTAAVVISLTLYTFWAAKRGHDFNFLGPFLFGALMVLMLFAIIQIFFPL  180



>ref|NP_192178.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana]
 gb|AAC78271.1| putative glutamate-/aspartate-binding peptide [Arabidopsis thaliana]
 emb|CAB77754.1| putative glutamate-/aspartate-binding peptide [Arabidopsis thaliana]
 gb|AAU44503.1| hypothetical protein AT4G02690 [Arabidopsis thaliana]
 gb|AAX23886.1| hypothetical protein At4g02690 [Arabidopsis thaliana]
 gb|AEE82214.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana]
Length=248

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 118/178 (66%), Gaps = 12/178 (7%)
 Frame = +3

Query  114  KGDIEEGT------LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            K D+E G       LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+ 
Sbjct  10   KDDVETGVSSRRPLLYPAMH--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIA  67

Query  273  EVLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
                 +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+
Sbjct  68   LFFATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTN  127

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            G ++LE++ILTS VVL+LT YTFWAA+KG DFNFLGP LF +L +LI    IQ+ FPL
Sbjct  128  GKVILESVILTSVVVLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFALIQILFPL  185



>ref|XP_004495172.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=244

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 120/175 (69%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G+    LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++   
Sbjct  8    KTDLESGSRTRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVHPISTFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A   L + LVF+PF+ L PL+ Y QRHP+N++ LG+FT SLSF V +SCA T   +
Sbjct  67   ATTGAGLALYIVLVFVPFITLCPLYYYYQRHPVNYLLLGVFTLSLSFVVGLSCAFTSEKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LEA+ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++ G IQ+FFPL
Sbjct  127  ILEAVILTAVVVIALTLYTFWAARRGYDFNFLGPFLFGAVLVLMVFGLIQVFFPL  181



>ref|NP_001149807.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG36861.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACR37792.1| unknown [Zea mays]
 tpg|DAA51897.1| TPA: Transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=243

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 116/186 (62%), Gaps = 9/186 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYVILAVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PL  Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGVALYIFLIILPFLVLCPLRYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVLMVFSLI  174

Query  600  QMFFPL  617
            Q+FFPL
Sbjct  175  QIFFPL  180



>ref|XP_009144548.1| PREDICTED: BI1-like protein, partial [Brassica rapa]
Length=243

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  5    KDDLEAGGGSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  63

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  64   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  123

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  124  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPL  180



>emb|CDX91308.1| BnaC02g27190D [Brassica napus]
Length=248

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  10   KDDLEAGGSSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  69   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPL  185



>emb|CDX97282.1| BnaA02g20730D [Brassica napus]
Length=248

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  10   KDDLEAGGGSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  69   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  129  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPL  185



>gb|EMS49504.1| hypothetical protein TRIUR3_04678 [Triticum urartu]
Length=221

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +3

Query  162  ENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpfll  332
            + +LRW FIRK+Y I+S Q+ +T  VAG  V    ++E    S+A   L +FL+ LP ++
Sbjct  4    DVELRWAFIRKIYVILSVQLAMTAAVAGFVVKVPAVSEFFVSSNAGLGLYIFLLVLPLVV  63

Query  333  lwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTF  512
            L PL  Y Q+HP+N I LG+FT S+SF V ++CA T G I+LEA ILT+ VV++LT YTF
Sbjct  64   LCPLRYYHQKHPVNLILLGIFTVSISFAVGMTCAFTSGKIILEAAILTAVVVISLTAYTF  123

Query  513  WAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            WAAK+G DFNFLGP LF +L +L++   IQ+FFPL
Sbjct  124  WAAKRGHDFNFLGPFLFGALMVLMVFSLIQIFFPL  158



>ref|XP_010092433.1| hypothetical protein L484_009115 [Morus notabilis]
 gb|EXB51151.1| hypothetical protein L484_009115 [Morus notabilis]
Length=247

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 112/185 (61%), Gaps = 15/185 (8%)
 Frame = +3

Query  105  GGMKGDIEEG-----------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            GG KGD+E G            LYP +     QLRW FIRKVY IIS Q+LLT  VA   
Sbjct  2    GGSKGDVESGYNVRHGNNNMDQLYPTM-LESPQLRWAFIRKVYVIISMQLLLTVAVAVAV  60

Query  252  vlYAPLNEVL---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            + Y P+ +      G     + ++   FLL+  L+   +RHP+NF+ L LFT +++F V 
Sbjct  61   IFYRPIPDFFVKTTGGLIAYIAIIIFTFLLMIALYFLHKRHPVNFLLLTLFTIAIAFSVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            +SCA T G ++LEA IL S VV++LT YTFWA K+G DF FLGP LF SL +L++   IQ
Sbjct  121  LSCAYTKGVVILEAAILCSIVVVSLTLYTFWAVKRGWDFTFLGPFLFASLLVLLIFALIQ  180

Query  603  MFFPL  617
            +F PL
Sbjct  181  VFLPL  185



>ref|XP_006396483.1| hypothetical protein EUTSA_v10028915mg [Eutrema salsugineum]
 gb|ESQ37936.1| hypothetical protein EUTSA_v10028915mg [Eutrema salsugineum]
Length=246

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E       LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAAGGSRPLYPTML--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVHPIALF  67

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + +V +P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G 
Sbjct  68   FATTSAGLALYIVIVIMPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +VLE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +LI+ G IQ+FFPL
Sbjct  128  VVLESAILTTVVVLSLTLYTFWAAKRGYDFNFLGPFLFGALIVLIVFGIIQIFFPL  183



>gb|EYU40897.1| hypothetical protein MIMGU_mgv1a012728mg [Erythranthe guttata]
Length=242

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN---EV  278
            K D+E G   LYP +     +LRW FIRK+Y I+S Q+LLT  V+ + V   P++     
Sbjct  8    KDDLESGREPLYPMMT-ESPELRWSFIRKIYTIVSIQLLLTIAVSALVVTVHPISLFFST  66

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +   A+ + LV  PF++L PL+ Y Q+HP+N+I LG+FT +L+F V ++C+ T G ++L
Sbjct  67   TRAGLAVYIVLVITPFIVLCPLYYYYQKHPVNYILLGIFTVALAFSVGLTCSYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA ILT+ VV++LT YT+WAAK+G+DFNFLGP L  ++ +L++   IQ+F+PL
Sbjct  127  EAAILTAVVVVSLTLYTYWAAKRGQDFNFLGPFLSGAIMVLLVFALIQIFYPL  179



>ref|XP_006292690.1| hypothetical protein CARUB_v10018936mg [Capsella rubella]
 gb|EOA25588.1| hypothetical protein CARUB_v10018936mg [Capsella rubella]
Length=239

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KYDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKINSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+F P +++ PL+ Y Q+HP+N+I LG+FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIFTPLIVMCPLYYYHQKHPVNYILLGIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  ESVILTAVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>ref|XP_006443997.1| hypothetical protein CICLE_v10021936mg [Citrus clementina]
 ref|XP_006479663.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
 gb|ESR57237.1| hypothetical protein CICLE_v10021936mg [Citrus clementina]
 gb|KDO68644.1| hypothetical protein CISIN_1g026195mg [Citrus sinensis]
 gb|KDO68645.1| hypothetical protein CISIN_1g026195mg [Citrus sinensis]
Length=242

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRK+Y II+ Q+L T  VA V V   P++     
Sbjct  8    KSDVEAGATPLYPMMS-ESPQLRWAFIRKIYSIIAIQLLATIAVASVVVSVRPISHFFSS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT +LSF V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYYQKHPVNYLLLGVFTIALSFAVGLTCAYTKGEVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E+ ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  127  ESAILTAVVVISLTLYTFWAARRGHDFNFLGPFLFGAVMVLLVFAFIQILFPL  179



>ref|XP_002283304.2| PREDICTED: BI1-like protein [Vitis vinifera]
Length=242

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +3

Query  114  KGDIE---EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            KGDIE   EG LYP +      +RW FIRKVY I+S Q+LLT +VA + V+  P+++ + 
Sbjct  7    KGDIETGGEGHLYPMM-LESPPMRWAFIRKVYAILSMQLLLTVVVAAIVVVVDPISDFMV  65

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L LF+V L  +L+  L  + +RHP+N I LG+FT +++F + +SCA   G I+
Sbjct  66   HNRAGLGLYLFIVVLSLILMCALAAFHKRHPVNLILLGMFTLTMAFTMGLSCAFVKGKII  125

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LEA ILTS V + LT YTFWAAK+G DF+FLGP LF SL +L++   IQMFFP+
Sbjct  126  LEAAILTSVVTIGLTLYTFWAAKRGHDFSFLGPFLFASLLVLLVFSMIQMFFPM  179



>gb|KJB22579.1| hypothetical protein B456_004G056000 [Gossypium raimondii]
Length=242

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     ++RW FIRK+Y II+ Q+  T  VA   V   P++     
Sbjct  8    KNDTEAGPRPLYPMM-LEPPEMRWAFIRKIYSIIAVQLFATIAVAATVVTVHPISNFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFITLCPLYYYYQKHPVNYLLLGVFTVSLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV+ALT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  ESVILTTVVVVALTLYTFWAAKRGHDFNFLGPFLFGAVLVLMVFALIQILFPL  179



>ref|XP_002307607.1| hypothetical protein POPTR_0005s23570g [Populus trichocarpa]
 gb|EEE94603.1| hypothetical protein POPTR_0005s23570g [Populus trichocarpa]
Length=242

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 116/173 (67%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I++ Q+LLT  VA V V   P+      
Sbjct  8    KNDVEVGARPLYPMM-LESPQLRWAFIRKVYSILAFQLLLTIAVAAVVVSVRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+ +P   L PL+ Y Q+HP+N+I LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TVAGLGVYILLILMPLFTLLPLYYYHQKHPVNYILLGIFTICLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  ESVILTTVVVVSLTLYTFWAARRGHDFNFLGPFLFGAIMVLMVFSLIQILFPL  179



>ref|XP_003557479.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=242

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 117/172 (68%), Gaps = 7/172 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPG+    + LRW  IRK+Y I+S Q+ +T  VA   V    ++E    S
Sbjct  9    DLEAGGSEALYPGMVESPD-LRWALIRKIYVILSVQLAMTAAVAAFVVKVPAVSEFFVSS  67

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   AL +FL+ LP ++L PL  Y Q+HP+N + LGLFT S+SF V ++CA T G ++LE
Sbjct  68   NSGIALYIFLLILPLIVLCPLRYYHQKHPVNLLLLGLFTVSISFAVGMTCAFTSGKVILE  127

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            A ILT+ VV++LT YTFWAAK+G DFNFLGP LF SL +LI+  FIQ+FFPL
Sbjct  128  AAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFGSLMVLIVFSFIQIFFPL  179



>gb|EPS72667.1| hypothetical protein M569_02091, partial [Genlisea aurea]
Length=237

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 121/173 (70%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRK+Y II+ Q+LLT  VA V V   P++     
Sbjct  4    KNDVESGSQPLYPMM-LESPELRWSFIRKIYSIITIQLLLTIAVAAVVVNVHPISHFFVA  62

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+F PF++L+PL+ Y Q+HP+N+  LGLFT SLSF V ++CA T G ++L
Sbjct  63   TRAGLGIYIVLIFTPFIVLFPLYYYYQKHPVNYFLLGLFTLSLSFCVGLTCAFTSGKVIL  122

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E+ ILT+ VV++LT YTFWAA++G+DFNFLG  LF +L +LI+   IQ+FFPL
Sbjct  123  ESAILTATVVISLTLYTFWAARRGQDFNFLGTFLFAALIVLIVFALIQIFFPL  175



>ref|XP_009601840.1| PREDICTED: BI1-like protein isoform X1 [Nicotiana tomentosiformis]
Length=245

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY I+S Q+LLT  VA V V   P+      
Sbjct  11   KDDVEGGARALYPTM-LESPELRWTFIRKVYSILSLQLLLTIAVASVVVTVHPIAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFITLCPLYYYHQKHPVNFLILGLFTVALAFAVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+AVVL+LT YTF AAK+G DFNFLGP LF +L +L+L  FIQ+ FPL
Sbjct  130  ESVILTTAVVLSLTVYTFCAAKRGHDFNFLGPFLFGALIVLMLFPFIQLLFPL  182



>emb|CDM85340.1| unnamed protein product [Triticum aestivum]
Length=242

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = +3

Query  117  GDIEEGT-------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            GDIE GT       LYPG+     +LRW  IRK+Y I+S Q+LLT  VA V V    +  
Sbjct  4    GDIEAGTSAAPAGALYPGMA-ESPELRWALIRKIYVILSLQLLLTAAVAAVVVKVPAIPH  62

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                S A   L +FL+ LPF++L PL++Y+Q+HPLN + LG+FT ++SF V ++CA T G
Sbjct  63   FFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPLNLLLLGVFTVAISFAVGMTCAFTSG  122

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LEA ILT+ VV +LT YTFWA K+GKDF+FLGP LF SL +L++ GFIQ+ FPL
Sbjct  123  KVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFPL  179



>ref|XP_010695291.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=239

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (68%), Gaps = 6/170 (4%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G LYP +   EN Q RW FIRKVY II+ Q++LT  +A V +   P++  L  + +
Sbjct  9    DIETGQLYPNME--ENPQFRWAFIRKVYVIIAIQMVLTAAIAAVVIFVRPISHYLVSTPS  66

Query  297  ---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEAL  467
               + + ++  P +++ PL+ Y +RHP+NF+ LGLFT +++F V ++CA   G +VLEAL
Sbjct  67   GLGIYIVILISPIIIMCPLYAYAKRHPINFVLLGLFTIAIAFGVGMTCAFVKGKVVLEAL  126

Query  468  ILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ILT  VV++LT YTF AAK+G DF+FLGP LF  + +L++   IQ+F PL
Sbjct  127  ILTCVVVVSLTIYTFLAAKRGVDFSFLGPFLFAGMMVLMVFMLIQIFIPL  176



>ref|XP_002874901.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51160.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=247

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 117/177 (66%), Gaps = 11/177 (6%)
 Frame = +3

Query  114  KGDIEEG-----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGFSSRRPLYPTML--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVHPIAL  67

Query  276  VLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  68   FFATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTNG  127

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ++LE+ ILTS VVL+LT YTFWAA+KG DFNFLGP LF +L +LI    IQ+ FPL
Sbjct  128  KVILESAILTSVVVLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFALIQILFPL  184



>ref|XP_002524726.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
 gb|EEF37569.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
Length=242

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY I+  Q+L T  VA V V   P+      
Sbjct  8    KSDVEAGARPLYPMM-LESPELRWSFIRKVYSILCIQLLATIAVASVVVSVRPIATFFVT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+ +PF+++ PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIIMPFIVICPLYYYHQKHPVNYLLLGVFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VVL+LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  ESVILTTVVVLSLTFYTFWAARRGHDFNFLGPFLFGAIMVLMVFALIQILFPL  179



>ref|XP_009138661.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=239

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+F P +++WPL+ Y + HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIFTPLIVMWPLYYYHETHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>ref|XP_002312548.2| hypothetical protein POPTR_0008s15690g [Populus trichocarpa]
 gb|EEE89915.2| hypothetical protein POPTR_0008s15690g [Populus trichocarpa]
Length=205

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYP +     QLRW FIRKVY I++ Q+LLT  VA   V   P+   +  +
Sbjct  10   DMEAGISNQLYPMMQ-EPPQLRWAFIRKVYIILAMQLLLTVGVAATVVFVPPIPRFILHT  68

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   A+ +  + L  +LLWPLHVY +RHP N+ F+ LFT  ++F V +SCA T G IVLE
Sbjct  69   TPGLAIYIVSLILTLILLWPLHVYSKRHPWNYFFMALFTICIAFAVGLSCALTKGRIVLE  128

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            A ILTS VV+ LT YTFWAAK+G+DF+FLGP LF+++ +LI+ G IQ  FPL
Sbjct  129  AAILTSVVVVGLTLYTFWAAKRGQDFSFLGPFLFSAVLVLIVFGLIQFLFPL  180



>ref|XP_002878509.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54768.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=239

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KHDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + ++F P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G ++L
Sbjct  64   TTAGFALYILVIFTPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  ESVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>ref|XP_011032646.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=242

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 116/173 (67%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I++ Q+LLT  VA V V   P+      
Sbjct  8    KNDLEVGGRPLYPMM-LESPQLRWAFIRKVYSILAFQLLLTIAVAAVVVSVRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+ +P   L PL+ Y Q+HP+N+I LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TGAGLGVYILLILMPLFTLLPLYYYHQKHPVNYILLGIFTICLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ IL++   IQ+ FPL
Sbjct  127  ESVILTTVVVVSLTLYTFWAARRGHDFNFLGPFLFGAIMILMIFALIQILFPL  179



>ref|NP_191890.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4 [Arabidopsis thaliana]
 emb|CAB86432.1| putative protein [Arabidopsis thaliana]
 gb|AAV74230.1| At3g63310 [Arabidopsis thaliana]
 gb|AAX22267.1| At3g63310 [Arabidopsis thaliana]
 gb|AEE80466.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4 [Arabidopsis thaliana]
Length=239

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KHDLESAQTPLYPMMS-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G ++L
Sbjct  64   TTAGFALYILLILTPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  ESVILTAVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>ref|XP_010422556.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGGSSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T+G 
Sbjct  68   FATTGLGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLSCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LE+ ILT+ VVL+LT YTFWAA+KG DFNFLGP LF +L +LI+   IQ+ FPL
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARKGYDFNFLGPFLFGALIVLIVFAIIQVLFPL  183



>gb|KDO74482.1| hypothetical protein CISIN_1g026616mg [Citrus sinensis]
Length=236

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD+E GT  LYPG+     ++RW FIRKVY I++ QILLT  VA V V   P+++ L  
Sbjct  3    KGDVERGTTELYPGM-IEPPEIRWAFIRKVYAIVAMQILLTIAVASVVVFVKPIHKFLAS  61

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +    LL+ +  L  LL+ PL  Y++RHP NF+ L LFT  LSF + V+CA + G I+L
Sbjct  62   GTPGLVLLIVVFILTLLLICPLFAYRKRHPWNFVLLVLFTILLSFTLGVACAFSKGKIIL  121

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            EA ILT A V  LT YTFWA K+GKDF+FLGP
Sbjct  122  EAFILTGAAVAGLTLYTFWAVKRGKDFSFLGP  153



>ref|XP_002300819.1| hypothetical protein POPTR_0002s04980g [Populus trichocarpa]
 gb|EEE80092.1| hypothetical protein POPTR_0002s04980g [Populus trichocarpa]
Length=242

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 116/173 (67%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I+  Q+L+T  VA + V   P+      
Sbjct  8    KTDLEAGARPLYPMM-LESPQLRWAFIRKVYSILCFQLLITIAVAAMVVSIRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L P++ Y Q+HP+N+  LG+FT SL+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLILTPFITLLPMYYYHQKHPVNYFLLGIFTISLAFAVGLTCAFTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E+ ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  127  ESAILTTVVVVSLTMYTFWAARRGHDFNFLGPFLFGAVMVLMVFAFIQILFPL  179



>ref|XP_010512744.1| PREDICTED: BI1-like protein [Camelina sativa]
 ref|XP_010413166.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=239

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KYDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+F P +++ PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TNAGLALYILLIFTPLIVMCPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPL
Sbjct  124  EAVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPL  176



>gb|AFK43813.1| unknown [Medicago truncatula]
Length=207

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++     
Sbjct  10   KTDVETGSRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVRPISTFFAT  68

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q HP+N++ L +FT SLSF V +SCA T   ++L
Sbjct  69   TGAGLALYIVLIFVPFITLCPLYYYYQTHPINYLLLAVFTLSLSFVVGLSCAFTSEKVIL  128

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ALT YTFWAA +G DFNFLGP LF ++ +L++ G IQ+FFPL
Sbjct  129  EAVILTAVVVIALTLYTFWAASRGYDFNFLGPFLFGAILVLMVFGMIQIFFPL  181



>ref|XP_007050515.1| Bax inhibitor-1 family protein [Theobroma cacao]
 gb|EOX94672.1| Bax inhibitor-1 family protein [Theobroma cacao]
Length=243

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     ++RW FIRK+Y I++ Q+L T  VA   V   P+      
Sbjct  9    KNDTEAGPRPLYPMM-LEPPEMRWAFIRKIYSIVAIQLLATIAVASTVVTVRPIAHFFVS  67

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++C+ T G ++L
Sbjct  68   TGAGLALYIVLIITPFIVLCPLYYYHQRHPVNYLLLGVFTVSLAFAVGLTCSFTSGKVIL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  128  ESVILTAVVVVALTLYTFWAARRGHDFNFLGPFLFGAILVLMVFALIQILFPL  180



>gb|KHG09280.1| hypothetical protein F383_07618 [Gossypium arboreum]
Length=243

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 113/171 (66%), Gaps = 6/171 (4%)
 Frame = +3

Query  120  DIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D E G   LYP +     ++RW FIRK+Y I+  Q+L T  VA   V   P+      + 
Sbjct  11   DAEAGGRPLYPMM-LERPEMRWAFIRKIYSIVVIQLLATIAVAATVVTVHPIAHFFVSTG  69

Query  294  ---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
               AL + L+  PF+ L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++LE+
Sbjct  70   TGFALYIVLIITPFITLCPLYYYHQRHPVNYLLLGVFTISLAFAVGLTCAFTSGKVILES  129

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+FFPL
Sbjct  130  VILTAVVVVALTLYTFWAARRGHDFNFLGPFLFGAVIVLMVFSLIQIFFPL  180



>ref|XP_010026938.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
Length=256

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 119/193 (62%), Gaps = 8/193 (4%)
 Frame = +3

Query  60   KAKMYGFERVSSSYDGGMKGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            K+K    E      +    GD E G     LYP +     QLRW FIRKVY II AQ+LL
Sbjct  2    KSKTGDVENRGGDIENRRDGDNESGRDATALYPNM-LESPQLRWAFIRKVYVIILAQLLL  60

Query  228  ttlvagvtvlYAPLNEVL---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFT  398
            T  +A    L  P+   +   K  SA+ + L+ LP +L+ PL  Y +RHP+NF+ LGLFT
Sbjct  61   TVGIASAVFLAKPMKRFVAETKLGSAIFIVLLVLPLILICPLRAYHKRHPVNFVLLGLFT  120

Query  399  ASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfi  578
             +++F +  SCA T   I+LE+ ILTS VV+ALT YTFWA K+G DF+FLGP LF SL +
Sbjct  121  VTMAFGLCFSCAFTKEKIILESAILTSVVVVALTLYTFWAVKRGHDFSFLGPFLFASLLV  180

Query  579  liltgfiQMFFPL  617
            +I+   IQ+FFPL
Sbjct  181  IIVFALIQIFFPL  193



>ref|XP_006288281.1| hypothetical protein CARUB_v10001524mg [Capsella rubella]
 gb|EOA21179.1| hypothetical protein CARUB_v10001524mg [Capsella rubella]
Length=309

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 129/203 (64%), Gaps = 17/203 (8%)
 Frame = +3

Query  42   ERDLRAKAKMYGFERVSSSYDGGM---KGDIEEG----TLYPGIGYGEN-QLRWGFIRKV  197
            +RD+++      F  +S  Y   +   K D+E G     LYP +   EN  LRWGFIRK+
Sbjct  50   DRDIQSS----NFPALSVMYQWNLPYRKDDVETGGSSRPLYPTML--ENPDLRWGFIRKI  103

Query  198  YGIISAQIllttlvagvtvlYAPLNEVLKGSS---AlllflvflpflllwplHVYQQRHP  368
            Y II+ Q+L T  VA   V   P+      +    AL + ++  PFL++ PL+ Y Q+HP
Sbjct  104  YSIIAFQLLATVAVAATVVTVHPIALFFATTGLGLALYIVIIITPFLVMCPLYYYHQKHP  163

Query  369  LNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFL  548
            +N++ LG+FT +L+F V ++CA T+G ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFL
Sbjct  164  VNYLLLGVFTLALAFVVGLTCAFTNGKVILESAILTTVVVLSLTLYTFWAAKKGYDFNFL  223

Query  549  GPilftslfililtgfiQMFFPL  617
            GP LF +L +LI+   IQ+ FPL
Sbjct  224  GPFLFGALIVLIVFALIQVLFPL  246



>ref|XP_011079906.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=242

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y I+S Q+LLT  VA V V   P+      
Sbjct  8    KNDVEVGARPLYPMM-LESPELRWSFIRKIYTIVSIQLLLTIAVAAVVVTVHPIAHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+N+  LG+FT +L+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYYQRHPVNYFLLGVFTLALAFAVGLTCAYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L+L   IQ+ FPL
Sbjct  127  ESVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVVVLMLFALIQILFPL  179



>ref|XP_007144660.1| hypothetical protein PHAVU_007G174500g [Phaseolus vulgaris]
 gb|ESW16654.1| hypothetical protein PHAVU_007G174500g [Phaseolus vulgaris]
Length=242

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +      LRW FIRKVY II+ Q+L+T ++  V V   P+      
Sbjct  8    KTDLESGARPLYPMM-LESPDLRWSFIRKVYSIIAIQLLVTIVIGAVVVTVRPIGVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SLSF V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYYQKHPINYLLLGVFTVSLSFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ LT YTFWAA++G+DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGQDFNFLGPFLFGAVLVLMVFALIQVLFPL  179



>ref|XP_006420012.1| hypothetical protein CICLE_v10006442mg [Citrus clementina]
 ref|XP_006489444.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
 gb|ESR33252.1| hypothetical protein CICLE_v10006442mg [Citrus clementina]
Length=236

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E GT  LYPG+     ++RW FIRKVY I++ QILLT  VA V V   P+++ L  
Sbjct  3    KGDAERGTTELYPGM-IEPPEIRWAFIRKVYAIVAMQILLTIAVASVVVFVKPIHKFLAS  61

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +    LL+ +  L  LL+ PL  Y++RHP NF+ L LFT  LSF V V+CA + G I+L
Sbjct  62   GTPGLVLLIVVFILTLLLICPLFAYRKRHPWNFVLLVLFTILLSFTVGVACAFSKGKIIL  121

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            EA ILT A V  LT YTFWA K+GKDF+FLGP
Sbjct  122  EAFILTGAAVAGLTLYTFWAVKRGKDFSFLGP  153



>ref|XP_003590585.1| BI1-like protein [Medicago truncatula]
 gb|AES60836.1| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=244

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++     
Sbjct  10   KTDVETGSRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVRPISTFFAT  68

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q HP+N++ L +FT SLSF V +SCA T   ++L
Sbjct  69   TGAGLALYIVLIFVPFITLCPLYYYYQTHPINYLLLAVFTLSLSFVVGLSCAFTSEKVIL  128

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ALT YTFWAA +G DFNFLGP LF ++ +L++ G IQ+FFPL
Sbjct  129  EAVILTAVVVIALTLYTFWAASRGYDFNFLGPFLFGAILVLMVFGMIQIFFPL  181



>gb|KFK30873.1| hypothetical protein AALP_AA6G036900 [Arabis alpina]
Length=246

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRWGFIRKVY II+ Q+L T  VA V V   P++   
Sbjct  10   KDDVETGGGSRPLYPAME-ESPELRWGFIRKVYSIIAFQLLATVAVAAVVVTVRPISLFF  68

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +    +L + ++  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G +
Sbjct  69   ATTGVGLSLYILIIITPLIVMCPLYYYHQKHPVNYLLLGVFTLALAFAVGLTCAFTNGKV  128

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +LI+ GFIQ+ FPL
Sbjct  129  ILESAILTTVVVLSLTFYTFWAAKRGHDFNFLGPFLFGALIVLIVFGFIQILFPL  183



>ref|XP_004145423.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004168546.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 gb|KGN61667.1| hypothetical protein Csa_2G222100 [Cucumis sativus]
Length=238

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL-NEVLKGSSA  296
            D+E   +YP +     QLRWGFIRKVY IIS Q+LLT  VA   V   P+ N  +K +  
Sbjct  8    DLENDQIYPMM-MESPQLRWGFIRKVYAIISMQLLLTAAVAAAVVFIRPIPNFFVKTTPG  66

Query  297  lllf--lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            ++ +  +V + F++L PL+ Y + HP NFI L LFT  ++F V +SCA T G I+LEA  
Sbjct  67   IIAYIGIVIVTFIVLCPLYAYHKHHPWNFILLTLFTIGIAFSVGISCAFTKGEIILEAAG  126

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LTS VVL LT YTFWA K+G+DFNFLGP LF S+ +L + G IQ+FFPL
Sbjct  127  LTSGVVLGLTLYTFWAVKRGQDFNFLGPFLFASVLVLFMFGLIQIFFPL  175



>emb|CBI28738.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 113/156 (72%), Gaps = 4/156 (3%)
 Frame = +3

Query  162  EN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpfl  329
            EN QLRW FIRK+Y I++ Q+LLT  VA V V   P+      + A   L + L+F+PF+
Sbjct  3    ENPQLRWAFIRKIYSIVAVQLLLTIAVAAVVVTVHPIAYFFVSTGAGLALYIVLIFVPFI  62

Query  330  llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYT  509
            +L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++LE++ILT+ VV++LT YT
Sbjct  63   VLCPLYYYHQRHPVNYLLLGVFTVSLAFVVGLTCAFTSGKVILESVILTTVVVVSLTLYT  122

Query  510  FWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            FWAAK+G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  123  FWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPL  158



>ref|XP_010932816.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=244

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 6/171 (4%)
 Frame = +3

Query  120  DIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G   LYP +     +LRW FIRK+Y I++ Q+LLT  VA V V   P++     S 
Sbjct  12   DVESGPRPLYPMM-LESPELRWAFIRKIYAILTVQMLLTVAVAAVVVTVRPISHFFVSSG  70

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L +FL+ LPF++L PL+ Y Q HP+N++ LG+FT SLSF V ++CA T G ++LE+
Sbjct  71   AGLGLYIFLIILPFIVLCPLYYYHQTHPVNYLLLGIFTVSLSFAVGLTCAFTSGKVILES  130

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILTS VV++LT YTFWAA++G DF+FLGP LF ++ ILI+   IQ+ FPL
Sbjct  131  VILTSVVVVSLTLYTFWAARRGHDFSFLGPFLFAAVMILIVFALIQILFPL  181



>ref|XP_003559738.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=249

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G+    LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDPEAGSAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L +FL+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++
Sbjct  73   STPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ+FFPL
Sbjct  133  LESAILTAVVVVSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQIFFPL  186



>ref|XP_010455996.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGGSSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G 
Sbjct  68   FATTGLGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LE+ ILT+ VVL+LT YTFWAA+KG DFNFLGP LF +L +LI+   IQ+ FPL
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARKGYDFNFLGPFLFGALIVLIVFAIIQIVFPL  183



>ref|XP_010430038.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGASSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T+G 
Sbjct  68   FATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLSCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LE+ ILT+ VVL+LT YTFWAA++G DFNFLGP LF +L +LI+ G IQ+ FPL
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARRGYDFNFLGPFLFGALIVLIVFGIIQILFPL  183



>ref|XP_002466473.1| hypothetical protein SORBIDRAFT_01g008350 [Sorghum bicolor]
 gb|EER93471.1| hypothetical protein SORBIDRAFT_01g008350 [Sorghum bicolor]
Length=250

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAETGQAARPLYPMM-LEDPRLRWSFIRKVYSILSIQMLLTVAVAAVVVYVRPIALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLIILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF ++ IL+L   IQ+FFPL
Sbjct  134  LESAILTAVVVLSLTAYTFWAAKRGHDFNFLGPFLFAAVMILMLFALIQLFFPL  187



>ref|NP_001059026.1| Os07g0177300 [Oryza sativa Japonica Group]
 dbj|BAC83445.1| putative z-protein [Oryza sativa Japonica Group]
 dbj|BAD30317.1| putative z-protein [Oryza sativa Japonica Group]
 dbj|BAF20940.1| Os07g0177300 [Oryza sativa Japonica Group]
 gb|EAZ02960.1| hypothetical protein OsI_25100 [Oryza sativa Indica Group]
 gb|EAZ38886.1| hypothetical protein OsJ_23305 [Oryza sativa Japonica Group]
Length=244

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +3

Query  117  GDIEEGT------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            GD+E GT      LYPG+     ++RW  IRK+Y I+S Q+LLT  VA V V    ++  
Sbjct  8    GDVEAGTSGGARELYPGMT-EPPEMRWALIRKIYVILSMQLLLTAAVAAVVVKVRAISHF  66

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               S A   L +FL+ LPF++L PL+ Y Q+HP+N I LGLFT ++SF V ++CA T G 
Sbjct  67   FVSSHAGLGLYIFLIILPFIVLCPLYYYHQKHPVNLILLGLFTVAISFAVGMTCAFTSGK  126

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LE+ ILT+ VV +LT YTFWAAK+G+DF+FLGP LF SL +L++  FIQ+ FPL
Sbjct  127  VILESAILTTVVVFSLTAYTFWAAKRGRDFSFLGPFLFASLIVLLVFAFIQILFPL  182



>ref|XP_009367582.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
 ref|XP_009367583.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=242

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGLRPLYPMM-LESPELRWSFIRKIYAIVAIQLLATIAVGAVVVSVRPVANFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+ +PF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TAAGLALYIVLIIMPFIVLCPLYYYHQKHPVNYLLLGIFTISLAFVVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV+ LT YTFWAA++G DFNFLGP LF +L +LI+ G IQ+FFPL
Sbjct  127  ESVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGALLVLIVFGLIQVFFPL  179



>ref|XP_011026112.1| PREDICTED: BI1-like protein isoform X1 [Populus euphratica]
Length=242

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I+  Q+LLT  VA + V   P+      
Sbjct  8    KTDLEAGARPLYPMM-LESPQLRWAFIRKVYSILCFQLLLTIAVAAMVVSIRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N+  LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLILTPFITLLPLYYYHQKHPVNYFLLGIFTIFLAFAVGLTCAFTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  ESVILTTVVVVSLTMYTFWAARRGHDFNFLGPFLFGAVMVLMVFALIQILFPL  179



>ref|XP_011027040.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=243

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYP +     Q+RW FIRKVY I++ Q+LLT  VA   V   P+   +  +
Sbjct  10   DMEAGISNQLYPMMQ-EPPQIRWAFIRKVYMILAMQLLLTVGVAATVVFVPPIPRFILHT  68

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   A+ +  + L  +LLWPLHVY +RHP N+ F+ LFT  ++F V +SCA T G IVLE
Sbjct  69   TPGLAIYIVSLILTLILLWPLHVYSKRHPWNYFFMALFTICIAFAVGLSCALTKGRIVLE  128

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            A ILTS VV+ LT YTFWAAK+G+DF+FLGP LF+++ +LI+ G IQ  FPL
Sbjct  129  AAILTSVVVVGLTLYTFWAAKRGQDFSFLGPFLFSAVLVLIVFGLIQFLFPL  180



>ref|XP_009402334.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=244

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = +3

Query  117  GDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            GD+E G   LYP +     +LRW FIRK+Y I+  Q+LLT  VA V V   P+++    S
Sbjct  11   GDVESGAQPLYPAM-LERPELRWAFIRKIYSILVVQMLLTVAVASVVVAVRPVSQFFVSS  69

Query  291  SA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
             A   L +FL+ LPF++L PL+ Y Q HP NF+ LG+FT S+SF V ++CA T G ++LE
Sbjct  70   GAGLGLYIFLIILPFIVLCPLYYYYQHHPWNFLLLGVFTVSISFAVGLTCAFTSGKVILE  129

Query  462  ALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            + ILT+ VV++LT YTFWAA +G DFNFLGP LF+++  L++  FIQ+ FP+
Sbjct  130  SAILTTVVVVSLTLYTFWAASRGHDFNFLGPFLFSAMLALMVFAFIQLLFPM  181



>gb|KEH23825.1| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=237

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 116/173 (67%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G  TLYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P+      
Sbjct  4    KRDVESGERTLYPTM-LESPELRWSFIRKVYSIITFQLLLTVAVASVVVFVPPIPRFFVS  62

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++    L + L+F+P + L PL+ Y  +HPLN+  L +FT +++FPV +SCA   G ++L
Sbjct  63   TTPGLVLYIVLIFIPLITLCPLYYYHNKHPLNYFLLLIFTVTMAFPVGLSCAFVSGKVIL  122

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV +LT YTFWAAK+G DF+FLGP LF +L +L++  FIQ+ FPL
Sbjct  123  EAVILTTVVVFSLTLYTFWAAKRGHDFSFLGPFLFAALLVLLVFAFIQILFPL  175



>ref|XP_008665403.1| PREDICTED: BI1-like protein [Zea mays]
 tpg|DAA51301.1| TPA: hypothetical protein ZEAMMB73_665176 [Zea mays]
Length=250

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             ++A   L +FL+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STAAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ +LT+ VVL+LT YTFWAAK+G DFNFLGP LF ++ IL+L   IQ+FFPL
Sbjct  134  LESAVLTAVVVLSLTAYTFWAAKRGHDFNFLGPFLFAAVMILMLFALIQLFFPL  187



>ref|XP_011399245.1| BI1-like protein [Auxenochlorella protothecoides]
 gb|KFM26349.1| BI1-like protein [Auxenochlorella protothecoides]
Length=247

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 3/175 (2%)
 Frame = +3

Query  96   SYDGGMKGDIEE---GTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
            S  G   GD  E   G LYPGI   +N LRWGF+RKVYGI++ Q+ LT  VA V  L   
Sbjct  8    SNSGAKYGDDLESGGGLLYPGIDATDNSLRWGFVRKVYGIVTIQLALTAAVALVVTLVPS  67

Query  267  LNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            +N  L  S A  + L+ L  L L PL +Y+ RHPLN   LGL+T +++  V V+C+  + 
Sbjct  68   VNAFLARSLAANIGLMVLSLLALIPLFIYKDRHPLNLALLGLWTLTMATTVGVACSFYEP  127

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFF  611
            AIVLEAL LT+ VV ALT Y+FWA  +G DF+ +GP+L   L+ ++  G  Q+FF
Sbjct  128  AIVLEALALTTTVVAALTAYSFWATARGVDFSPVGPLLAGLLWAMLAWGLFQIFF  182



>ref|XP_008789734.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=243

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +3

Query  108  GMKGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +     + RW FIRK+Y I++AQ+ LT  VA + +   P++   
Sbjct  8    GKDGDVEAGLRPLYPMM-LESPEFRWVFIRKIYVILTAQLALTVAVASIVIAVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              SSA   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFTAS+SF V ++CA T G I
Sbjct  67   VSSSAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTASISFAVGLTCAFTSGKI  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LEA ILT AVV++LT YTF AA++G DFNFLGP LF S+F+L++   IQM F L
Sbjct  127  ILEAAILT-AVVVSLTLYTFRAARRGHDFNFLGPFLFASVFVLLVFALIQMSFSL  180



>gb|EMS50944.1| hypothetical protein TRIUR3_13925 [Triticum urartu]
Length=272

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 15/181 (8%)
 Frame = +3

Query  117  GDIEEGT-----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
            GDIE GT           LYPG+     +LRW  IRK+Y IIS Q+LLT +VA V V   
Sbjct  30   GDIEAGTSGRTAAAPAGALYPGMA-ESPELRWALIRKIYVIISLQLLLTAVVAAVVVKVH  88

Query  264  PLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
             +      S A   L +FL+ LPF++L PL++Y+Q+HP+N + LG+FT ++SF V ++CA
Sbjct  89   AIPHFFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPVNLLLLGVFTVAISFAVGMTCA  148

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
             T G ++LEA ILT+ VV +LT YTFWA K+GKDF+FLGP LF SL +L++ GFIQ+ FP
Sbjct  149  FTSGKVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFP  208

Query  615  L  617
            L
Sbjct  209  L  209



>ref|XP_008386439.1| PREDICTED: BI1-like protein [Malus domestica]
 ref|XP_008386440.1| PREDICTED: BI1-like protein [Malus domestica]
Length=241

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 111/173 (64%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGARLLYP-VMLESPELRWSFIRKIYAIVAIQLLATIAVGAVVVSVRPVANFFVS  66

Query  288  SSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A L   + L      +L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGIFTISLAFVVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV+ LT YTFWAA++G+DF+FLGP L  +L +LI+   IQ+FFPL
Sbjct  127  ESVILTAVVVIGLTLYTFWAARRGQDFHFLGPFLSGALLVLIVFALIQVFFPL  179



>ref|XP_008449318.1| PREDICTED: BI1-like protein [Cucumis melo]
Length=238

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 4/169 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL-NEVLKGSSA  296
            D+E   +YP +     QLRWGFIRKVY IIS Q+LLT  VA   V   P+ N  +K +  
Sbjct  8    DVENDEIYPMM-MESPQLRWGFIRKVYAIISMQLLLTAAVAAAVVFIRPIPNFFVKTTPG  66

Query  297  lllf--lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            ++ +  +V   F++L PL+ Y + HP NFI L LFT  ++F V ++CA T G I+LEA  
Sbjct  67   IIAYIGIVIFTFIVLCPLYAYHRHHPWNFILLTLFTIGIAFSVGITCAFTKGEIILEAAA  126

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LTS VV+ LT YTFWA K+G DFNFLGP LF SL +L +   IQ+FFPL
Sbjct  127  LTSGVVVGLTLYTFWAVKRGHDFNFLGPFLFASLLVLFMFSLIQIFFPL  175



>ref|XP_002966079.1| hypothetical protein SELMODRAFT_84281 [Selaginella moellendorffii]
 gb|EFJ33499.1| hypothetical protein SELMODRAFT_84281 [Selaginella moellendorffii]
Length=229

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +3

Query  105  GGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
             G  GDIE           +  LRWGFIRKVYGI+ +Q++LT +VAG+ V   P+N  L 
Sbjct  2    AGGSGDIESAR-----STSDLSLRWGFIRKVYGILMSQLVLTAIVAGIVVAVKPINRALG  56

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  + L L     +LL PL++Y+Q+HPLN I LG FT  LS  V   CA T G IVL+A
Sbjct  57   HTPWISLALGVFALILLCPLYIYRQKHPLNLILLGFFTILLSLTVGFVCAYTRGNIVLQA  116

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LILT+ + + LT +TFWA  +G DF FLGP+LF S+ +LI+ G IQ FFP+
Sbjct  117  LILTATITIGLTLFTFWAVNRGYDFGFLGPLLFASVLVLIVWGIIQAFFPI  167



>ref|XP_002971406.1| hypothetical protein SELMODRAFT_95705 [Selaginella moellendorffii]
 gb|EFJ27155.1| hypothetical protein SELMODRAFT_95705 [Selaginella moellendorffii]
Length=229

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +3

Query  105  GGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
             G  GDIE           +  LRWGFIRKVYGI+ +Q++LT +VAG+ V   P+N  L 
Sbjct  2    AGGSGDIESAR-----STSDLDLRWGFIRKVYGILMSQLVLTAIVAGIVVAVKPINRALG  56

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  + L L     +LL PL++Y+Q+HPLN I LG FT  LS  V   CA T G IVL+A
Sbjct  57   HTPWISLALGVFALILLCPLYIYRQKHPLNLILLGFFTILLSLTVGFVCAYTRGNIVLQA  116

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LILT+ + + LT +TFWA  +G DF FLGP+LF S+ +LI+ G IQ FFP+
Sbjct  117  LILTATITIGLTLFTFWAVNRGYDFGFLGPLLFASVLVLIVWGIIQAFFPI  167



>ref|XP_006657498.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=247

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 120/179 (67%), Gaps = 13/179 (7%)
 Frame = +3

Query  117  GDIEEGT---------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GD+E GT         LYPG+     ++RW  IRK+Y I+S Q+LLT  VA V V    +
Sbjct  8    GDVEAGTSGGVAGARELYPGMT-EPPEMRWALIRKIYVILSMQLLLTAAVAAVVVKVRAI  66

Query  270  NEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANT  440
            +     S A   L +FL+ LPF++L PL+ Y Q+HP+N I LGLFT ++SF V ++CA T
Sbjct  67   SHFFVSSHAGIGLYIFLIILPFIVLCPLYFYHQKHPVNLILLGLFTVAISFAVGMTCAFT  126

Query  441  DGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             G ++LE+ ILT+ VV +LT YTFWAAK+G+DF+FLGP LF SL +L++  FIQ+ FPL
Sbjct  127  SGKVILESAILTTVVVFSLTAYTFWAAKRGRDFSFLGPFLFASLIVLLVFAFIQILFPL  185



>gb|ABK27003.1| unknown [Picea sitchensis]
Length=243

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 117/171 (68%), Gaps = 5/171 (3%)
 Frame = +3

Query  120  DIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G+  LYPGI   +N  RW FIRK+Y I+S Q++LT  +  + V   P+      S 
Sbjct  10   DLEGGSIPLYPGISLEDNVFRWAFIRKIYTILSLQLILTVAIGSIVVFVRPVAVFFVSSP  69

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + LV LPF+LL PL+ Y Q+HP+N I L LFT ++ F V ++ + T G I+LE+
Sbjct  70   AGLALYIVLVILPFILLCPLYYYSQKHPVNLILLSLFTVAIGFAVGLTFSFTAGKIILES  129

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILT+ VV++LT YTFWAA++G DF+FLGPILF+++ +LI  G IQ FFPL
Sbjct  130  VILTALVVVSLTAYTFWAARRGHDFSFLGPILFSAIMVLIFFGLIQAFFPL  180



>ref|NP_001237340.1| uncharacterized protein LOC100527528 [Glycine max]
 gb|ACU16623.1| unknown [Glycine max]
 gb|KHN03822.1| BI1-like protein [Glycine soja]
Length=242

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ L +FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLAVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  EAVILTAVVVIALTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVLFPL  179



>gb|EMT04947.1| hypothetical protein F775_08799 [Aegilops tauschii]
Length=245

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 121/179 (68%), Gaps = 14/179 (8%)
 Frame = +3

Query  117  GDIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
            GDIE GT          LYPG+     +LRW  IRK+Y IIS Q+LLT +VA V V    
Sbjct  4    GDIEAGTSGGAAAPAQVLYPGMA-ESPELRWALIRKIYVIISLQLLLTAVVAAVVVKVPA  62

Query  267  LNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCAN  437
            +      S A   L +FL+ LPF++L PL++Y+Q+HP+N + LG+FT ++SF V ++CA 
Sbjct  63   IPHFFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPVNLLLLGVFTVAISFAVGMTCAF  122

Query  438  TDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            T G ++LEA ILT+ VV +LT YTFWA K+GKDF+FLGP LF SL +L++ GFIQ+ FP
Sbjct  123  TSGKVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFP  181



>ref|XP_003518904.1| PREDICTED: BI1-like protein-like [Glycine max]
 gb|KHN18858.1| BI1-like protein [Glycine soja]
Length=242

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLGVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVLFPL  179



>ref|XP_008775649.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 6/171 (4%)
 Frame = +3

Query  120  DIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G   LYP +     +LRW FIRK+Y I++ Q+LLT  VA V V   P++     S 
Sbjct  12   DVESGPQALYPTM-LESPELRWAFIRKIYAILTVQMLLTVAVAAVVVSVRPISHFFVSSG  70

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L +FL+ LPF++L PL+ Y Q HP+N++ LG+FT SLSF V ++CA T G ++LE+
Sbjct  71   AGLGLYIFLIILPFIVLCPLYYYYQTHPVNYLLLGVFTVSLSFVVGLTCAFTSGKVILES  130

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ ILI+   IQ+ FPL
Sbjct  131  VILTAVVVVSLTLYTFWAARRGHDFSFLGPFLFAAVMILIVFALIQILFPL  181



>gb|EMT04950.1| hypothetical protein F775_18737 [Aegilops tauschii]
Length=243

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +3

Query  117  GDIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            GD+E GT  P     E+ +LRW  IRK+Y ++  Q+LLT +VA V V    +      S 
Sbjct  10   GDVEAGTAAPYPATTESPELRWALIRKIYVVLCLQLLLTAVVAVVVVKVRAIPHFFVSSY  69

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + ++  PF++++PLH Y+Q+HP+N + LG+FT ++SF V ++CA T G ++LEA
Sbjct  70   AGLGLYISILIFPFIVMFPLHFYRQKHPVNLLLLGVFTVAISFSVGLTCAFTSGKVILEA  129

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
             ILT  VVL+LT YTFWAA++GKDF+FLGP LF SL IL++ GFIQ+FFPL
Sbjct  130  GILTIVVVLSLTAYTFWAARRGKDFSFLGPFLFASLMILLVFGFIQIFFPL  180



>gb|EMT30807.1| hypothetical protein F775_10013 [Aegilops tauschii]
Length=249

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDAEAGQAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             S A   L +FL+ LPF++L PL+ Y QRHP+N + L LFT ++SF V ++CA T G ++
Sbjct  73   SSPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLALFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ FFPL
Sbjct  133  LESAILTAVVVVSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQAFFPL  186



>ref|XP_006650573.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=247

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 4/163 (2%)
 Frame = +3

Query  138  LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllf  308
            LYP +     QLRW FIRKVY I+S Q+LLT  VA V V   P+      +S    L +F
Sbjct  23   LYPMM-LESPQLRWAFIRKVYTILSIQMLLTVAVASVVVYVRPVALFFVSTSGGFGLYIF  81

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            L+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++LE+ ILT+ VV
Sbjct  82   LIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVILESAILTAVVV  141

Query  489  LALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ+FFPL
Sbjct  142  VSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQIFFPL  184



>ref|XP_006650725.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=241

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 114/173 (66%), Gaps = 8/173 (5%)
 Frame = +3

Query  120  DIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL--  281
            D+E G     LYPG+    + LRW  I K+Y I+S QI +T  VA   V    ++E    
Sbjct  7    DLEAGGASEPLYPGMVESPD-LRWALIHKIYVILSVQIAMTAAVAAFVVKVRGVSEFFVS  65

Query  282  -KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             K   AL +FL+ LP ++L PL  Y Q+HP+N + LG+FT ++SF V ++CA T G ++ 
Sbjct  66   SKAGLALYIFLLVLPLIVLCPLRYYHQKHPVNLLLLGVFTVAISFAVGMTCAYTSGKVIF  125

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA ILT+ VV++LT YTFWAAK+G DFNFLGP LF+++ +LIL   IQ+FFPL
Sbjct  126  EAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFSAVMVLILFSLIQVFFPL  178



>ref|XP_010096442.1| hypothetical protein L484_002350 [Morus notabilis]
 gb|EXB64217.1| hypothetical protein L484_002350 [Morus notabilis]
Length=242

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I+  Q+L T  VA + V   P+      
Sbjct  8    KTDEEVGARPLYPMM-LESPELRWSFIRKIYSIVCIQLLATIAVAAIVVSVRPIAHFFAS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y ++HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFITLCPLYYYYRKHPVNYLLLGIFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FP+
Sbjct  127  ESVILTTVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVMVLMVFALIQILFPM  179



>emb|CDM85336.1| unnamed protein product [Triticum aestivum]
Length=248

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEGTLYP-GIGYG----ENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            GDIE GT  P G  Y       +LRW  IRK+Y ++  Q+LLT  VA V V    +    
Sbjct  11   GDIEAGTAAPKGAPYAGTTESPELRWALIRKIYVVLCLQLLLTAAVAAVFVTVTAIPHFF  70

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S A   L +F++  PF++L PLH+Y+Q+HP+N + LG+FT ++SF V ++CA T G +
Sbjct  71   VSSYAGLGLYIFILVFPFIVLCPLHIYRQKHPINLLLLGVFTVAISFSVGLTCAFTSGKV  130

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +L+A ILT  VVL+LT YTFWAA++GKDF+FLGP LF SL IL++  FIQ+FFPL
Sbjct  131  ILQAGILTIVVVLSLTAYTFWAARRGKDFSFLGPFLFASLMILLVFAFIQIFFPL  185



>gb|EMS57375.1| hypothetical protein TRIUR3_34180 [Triticum urartu]
Length=249

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDAEAGQAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             S A   L +FL+ LPF++L PL+ Y QRHP+N + L LFT ++SF V ++CA T G ++
Sbjct  73   SSPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLALFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILT+ VV++LT YTFWAA +G DF+FLGP LF ++ IL++   IQ FFPL
Sbjct  133  LESAILTAVVVVSLTAYTFWAASRGHDFSFLGPFLFAAVMILMVFALIQAFFPL  186



>gb|KHG20710.1| hypothetical protein F383_10571 [Gossypium arboreum]
Length=242

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 107/173 (62%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +      LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPALRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A L   + L       L PL+ + Q+HP N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYIVLIVTPFITLCPLYYFHQKHPWNYLLLGIFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPL
Sbjct  127  EATILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPL  179



>ref|XP_004955618.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=249

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 124/188 (66%), Gaps = 12/188 (6%)
 Frame = +3

Query  87   VSSSYDGGMKGDIEEGT--------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            +SS++     GD+E GT        LYPG+     ++RW  IRK+Y I+S Q+LLT  VA
Sbjct  1    MSSAFGYQKGGDLEAGTSGAPGPRALYPGMQ-ESPEMRWALIRKIYVILSLQLLLTAAVA  59

Query  243  gvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
             V V    +      + A   L +FL+ LPF++L PL+ Y +RHP+N I LGLFT ++SF
Sbjct  60   AVVVKVRAIPHFFTTTHAGLGLYIFLIILPFIVLCPLYYYHERHPVNLILLGLFTLAISF  119

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtg  593
             V ++CA T G ++LE+ ILT+ VVL+LT YTFWA ++GKDF+FLGP LF SL +L++  
Sbjct  120  AVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVRRGKDFSFLGPFLFASLIVLLVFA  179

Query  594  fiQMFFPL  617
            FIQ+ FPL
Sbjct  180  FIQILFPL  187



>gb|KJB23000.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=242

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 107/173 (62%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A L   + L       L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPL
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPL  179



>gb|ACU19259.1| unknown [Glycine max]
Length=242

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLGVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA+ILT+ VV+ LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPL
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVQFPL  179



>ref|XP_010024226.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW60687.1| hypothetical protein EUGRSUZ_H03417 [Eucalyptus grandis]
Length=239

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 113/174 (65%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD+E G     LYPG+     QLRW FIRKVY II  Q+LLT  VA    L  P++  + 
Sbjct  6    GDVESGQAAAALYPGM-LESPQLRWAFIRKVYAIILVQLLLTAGVATAVGLVKPVSRFIA  64

Query  285  GS---SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +     +L+ L+ L F+++  L  Y  R+P+NF+ LGLFT +++  V +SCA ++  ++
Sbjct  65   KTWPGFGVLMALIVLSFIIVIVLRAYHNRYPVNFVLLGLFTVTMASMVGLSCAFSEEKVI  124

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILTS V++ALT YTFW  K+G DF+FLGP LF SL +L++   IQ+FFPL
Sbjct  125  LESAILTSVVIVALTFYTFWVVKRGGDFSFLGPFLFASLLVLLVFALIQIFFPL  178



>gb|EPS70625.1| hypothetical protein M569_04132, partial [Genlisea aurea]
Length=231

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 107/169 (63%), Gaps = 3/169 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G LYPG G  EN QLRWGFIRKVY I+S Q+LLT  V  V +L+ P+ + ++ ++ 
Sbjct  1    DIETGQLYPGQGMYENPQLRWGFIRKVYSILSMQLLLTVAVGLVMILFDPVRQFMQTTTG  60

Query  297  --lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              +++  + L  +L + +  + QRHP N I L LFT +LS+ V  +C    G  VL A  
Sbjct  61   LYVMIAAMVLTVMLCFMMSCFSQRHPWNIILLILFTLALSWMVGATCTQRKGQAVLMAAT  120

Query  471  LTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LT  V  +LT +TF AAK+G DFNFLGP L  ++ +L+  G I++ FP+
Sbjct  121  LTLLVTFSLTLFTFLAAKRGYDFNFLGPFLLCAVLLLMAFGIIRIIFPM  169



>emb|CDM85345.1| unnamed protein product [Triticum aestivum]
Length=249

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 124/185 (67%), Gaps = 15/185 (8%)
 Frame = +3

Query  105  GGMKG-DIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            G  KG DIE GT          LYPG+     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  3    GYQKGVDIEAGTSGGAAAPTRGLYPGMT-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  61

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      SSA   L +FL+  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V 
Sbjct  62   VKVRAIPHFFVSSSAGLGLYIFLIIFPFIVLCPLYFYRQKHPVNLLLLGVFTVAISFAVG  121

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LEA ILT+ VV +LT YTFWAAK+G+DF+FLGP LF SL +L++ GFIQ
Sbjct  122  MTCAFTSGKVILEAAILTTVVVFSLTAYTFWAAKRGQDFSFLGPFLFASLIMLLVFGFIQ  181

Query  603  MFFPL  617
            + FP+
Sbjct  182  ILFPM  186



>ref|XP_004493722.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=240

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +3

Query  114  KGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
             G+ E  TLYP +     QLRW FIRKVY II+ Q+LLT  VA V V   P++     S+
Sbjct  9    NGETETRTLYPTM-LESPQLRWSFIRKVYSIITFQLLLTVAVASVVVFVPPVSHFFVSST  67

Query  294  ---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
                L + L+F+PF+ L PL+ Y Q+HPLN+  L +FT +L+ P+ ++CA   G ++LE+
Sbjct  68   QGLILYIVLIFVPFITLCPLYYYHQKHPLNYFLLLIFTVTLAIPIGLTCAFVSGKVILES  127

Query  465  LILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +ILT+AVV +LT YTFWAA++G DF+FLGP LF +L +L++   IQ+ FPL
Sbjct  128  VILTTAVVFSLTLYTFWAARRGHDFSFLGPFLFGALLVLMIFALIQILFPL  178



>ref|XP_007162464.1| hypothetical protein PHAVU_001G154500g [Phaseolus vulgaris]
 gb|ESW34458.1| hypothetical protein PHAVU_001G154500g [Phaseolus vulgaris]
Length=241

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 119/178 (67%), Gaps = 11/178 (6%)
 Frame = +3

Query  111  MKGDIEEG-----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            MK D+E G      LYP +   EN QLRW FIRKVY I++ Q+LLT  VA V V   P+ 
Sbjct  3    MKRDVESGGGSERPLYPSML--ENPQLRWSFIRKVYSILTFQLLLTIAVAAVVVFVRPIP  60

Query  273  EVLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
              +  ++    + + L+F+PF+ L PL+ Y Q+HPLN+  L +FT +L+F V ++CA T 
Sbjct  61   HFIVSTTPGLVIYIILIFVPFITLCPLYYYHQKHPLNYFLLLIFTVTLAFSVGLTCAFTS  120

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            G I+LE++ILT+ VV +LT YTF+AA++G DFNFLGP LF +L +LI+   IQ+  PL
Sbjct  121  GKIILESVILTTVVVFSLTLYTFFAARRGHDFNFLGPFLFGALLVLIVFSLIQILIPL  178



>ref|NP_001130584.1| uncharacterized protein LOC100191683 [Zea mays]
 gb|ACF78861.1| unknown [Zea mays]
 tpg|DAA59751.1| TPA: transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=249

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 123/189 (65%), Gaps = 8/189 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++     + G  G    G    LYPG+     +LRW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQK-GLDVEAGTSGAAATGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVV  58

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      +SA   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++S
Sbjct  59   AAVVVKVRAIPHFFTTTSAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAIS  118

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +GKDF+FLGP LF ++ +L++ 
Sbjct  119  FAVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFAAIIVLLVF  178

Query  591  gfiQMFFPL  617
              IQ+ FPL
Sbjct  179  ALIQILFPL  187



>ref|XP_009410985.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=245

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = +3

Query  105  GGMKG-DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            G  KG D+E      LYP +     QLRW FIRK+Y I++ Q+LLT  VA V V   P++
Sbjct  6    GYWKGRDVEAAGAPPLYPMM-LEPPQLRWAFIRKIYTILAVQMLLTVAVAAVVVSVPPVS  64

Query  273  EVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
                 S A   L +FL+ LPF++L PL+ Y Q+HPLNF+ LG+FT S+SF V ++CA T 
Sbjct  65   RFFVSSGAGLGLYIFLIILPFIVLCPLYYYYQKHPLNFLLLGVFTVSISFAVGLTCAFTS  124

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            G ++LE++ILT+ VV++LT YTFWAA KG DF+FLGP LF+++ IL++   IQ+FFP+
Sbjct  125  GKVILESVILTAVVVVSLTLYTFWAASKGHDFSFLGPFLFSAVMILMVFALIQVFFPM  182



>gb|ACG33000.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=249

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 123/189 (65%), Gaps = 8/189 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++     + G  G    G    LYPG+     +LRW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQK-GLDVEAGTSGAAATGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVV  58

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      +SA   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++S
Sbjct  59   AAVVVKVRAIPHFFTTTSAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAIS  118

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +GKDF+FLGP LF +L +L++ 
Sbjct  119  FAVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFAALIVLLVF  178

Query  591  gfiQMFFPL  617
              IQ+ FPL
Sbjct  179  ALIQILFPL  187



>ref|NP_001051551.1| Os03g0795800 [Oryza sativa Japonica Group]
 gb|AAT76424.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99337.1| Uncharacterized protein family UPF0005 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13465.1| Os03g0795800 [Oryza sativa Japonica Group]
 gb|EAY92173.1| hypothetical protein OsI_13887 [Oryza sativa Indica Group]
 gb|EAZ28904.1| hypothetical protein OsJ_12944 [Oryza sativa Japonica Group]
 dbj|BAG95443.1| unnamed protein product [Oryza sativa Japonica Group]
Length=241

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = +3

Query  120  DIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            D+E G     LYPG+    + LRW  I K+Y I+S Q+ +T  VA   V    ++E    
Sbjct  7    DLEAGGSSEPLYPGMVESPD-LRWALIHKIYVILSVQLAMTAAVAAFVVKVRGVSEFFVS  65

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            S+A   L +FL+FLP ++L PL  Y Q+HP+N + LGLFT ++SF V ++CA T G ++ 
Sbjct  66   SNAGFALYIFLLFLPLIVLCPLRYYHQKHPVNLLLLGLFTVAISFAVGMTCAYTSGKVIF  125

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            EA  LT+ VV++LT YTFWAAK+G DFNFLGP LF+++ +LIL   IQ+FFPL
Sbjct  126  EAAALTAVVVISLTAYTFWAAKRGHDFNFLGPFLFSAVMVLILFSLIQIFFPL  178



>ref|XP_003557492.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=251

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 116/163 (71%), Gaps = 4/163 (2%)
 Frame = +3

Query  138  LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllf  308
            LYPG+     +LRW  IRK+Y I+S Q+LLT  VA V V    ++     S+A   L +F
Sbjct  27   LYPGMT-ESPELRWALIRKIYTILSLQLLLTAAVAAVVVKVRAISHFFVSSNAGLGLYIF  85

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            LV  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V ++CA T G ++LEA ILT+ VV
Sbjct  86   LVIFPFIVLCPLYFYRQKHPVNLLLLGIFTVAISFAVGMTCAFTSGKVILEAAILTAVVV  145

Query  489  LALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            ++LT YTFWAAK+G+DF+FLGP LF SL +LI+  FIQ+ FP+
Sbjct  146  VSLTAYTFWAAKRGQDFSFLGPFLFASLIVLIVFAFIQILFPM  188



>emb|CBI26304.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 3/152 (2%)
 Frame = +3

Query  171  LRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpflllwp  341
            +RW FIRKVY I+S Q+LLT +VA + V+  P+++ +  + A   L LF+V L  +L+  
Sbjct  7    MRWAFIRKVYAILSMQLLLTVVVAAIVVVVDPISDFMVHNRAGLGLYLFIVVLSLILMCA  66

Query  342  lHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAA  521
            L  + +RHP+N I LG+FT +++F + +SCA   G I+LEA ILTS V + LT YTFWAA
Sbjct  67   LAAFHKRHPVNLILLGMFTLTMAFTMGLSCAFVKGKIILEAAILTSVVTIGLTLYTFWAA  126

Query  522  KKGKDFNFLGPilftslfililtgfiQMFFPL  617
            K+G DF+FLGP LF SL +L++   IQMFFP+
Sbjct  127  KRGHDFSFLGPFLFASLLVLLVFSMIQMFFPM  158



>emb|CDM86339.1| unnamed protein product [Triticum aestivum]
Length=254

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 118/185 (64%), Gaps = 19/185 (10%)
 Frame = +3

Query  117  GDIEEGT---------------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            GDIE GT               LYP +     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  8    GDIEAGTSGGTAMAPPPAPAQVLYPWMA-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  66

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      S A   L + ++  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V 
Sbjct  67   VKVWAIPHFFVSSYAGLGLYISILIFPFIVLCPLYCYRQKHPVNLLLLGVFTVAISFAVG  126

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LEA ILT  VVL+LT YTFWA KKGKDF+FLGP LF SL +L++ GFIQ
Sbjct  127  MTCAFTSGKVILEAAILTMVVVLSLTAYTFWAVKKGKDFSFLGPFLFASLVMLLVFGFIQ  186

Query  603  MFFPL  617
            + FPL
Sbjct  187  ILFPL  191



>gb|KJB23003.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=249

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 108/180 (60%), Gaps = 13/180 (7%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSAlllflvfl----------pflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCAN  437
            + A L   + L            + L PL+ + Q+HP N++ LG FT SL+F + ++CA 
Sbjct  67   TGAGLALYMVLIVTPFIKMCLALVALCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAF  126

Query  438  TDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            T G ++LEA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPL
Sbjct  127  TQGKVILEAAILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPL  186



>dbj|BAK00103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 126/189 (67%), Gaps = 7/189 (4%)
 Frame = +3

Query  69   MYGFER---VSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++   V +   GG         LYPG+     ++RW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQKGVDVEAGPSGGTGAAAPTRGLYPGMT-ESPEMRWALIRKIYVILSLQLLLTAVV  59

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      SSA   L +FL+  PF++L PL+ Y+Q+HP+N + LG+FT ++S
Sbjct  60   AAVVVKVRAIPHFFVSSSAGLGLYIFLIIFPFIVLCPLYFYRQKHPVNLLLLGVFTVAIS  119

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililt  590
            F V ++CA T G ++LEA ILT+ VV +LT YTFWAA++G+DF+FLGP LF SL +L++ 
Sbjct  120  FAVGMTCAFTSGKVILEAAILTTVVVFSLTAYTFWAARRGQDFSFLGPFLFASLIMLLVF  179

Query  591  gfiQMFFPL  617
            GFIQ+ FP+
Sbjct  180  GFIQILFPM  188



>ref|XP_002461535.1| hypothetical protein SORBIDRAFT_02g004350 [Sorghum bicolor]
 gb|EER98056.1| hypothetical protein SORBIDRAFT_02g004350 [Sorghum bicolor]
Length=248

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 121/185 (65%), Gaps = 15/185 (8%)
 Frame = +3

Query  105  GGMKG-DIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            G  KG D+E GT          LYPG+     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  3    GYQKGVDVEAGTSAATGGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  61

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      ++A   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++SF V 
Sbjct  62   VKVRAIPHFFTTTNAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAISFSVG  121

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +GKDF+FLGP LF SL +L++   IQ
Sbjct  122  LTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFASLIVLLVFALIQ  181

Query  603  MFFPL  617
            + FPL
Sbjct  182  ILFPL  186



>ref|XP_008355439.1| PREDICTED: BI1-like protein [Malus domestica]
Length=245

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E     LYP +     +LRW FIRK+Y I++ Q+L T  +  V V   P+      
Sbjct  11   KSDPEAQARPLYPTM-LESPELRWSFIRKIYAIVAMQLLATIAIGAVVVSVRPVAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT SL+  V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGIFTLSLACVVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            E++ILT+ VV+ LT YTFWAAK+G DFNFLGP L  ++ +L +   IQ+ FPL
Sbjct  130  ESVILTAVVVIGLTLYTFWAAKRGHDFNFLGPFLAGAILVLFVFALIQILFPL  182



>ref|NP_193209.2| Bax inhibitor-1 family protein [Arabidopsis thaliana]
 gb|AEE83489.1| Bax inhibitor-1 family protein [Arabidopsis thaliana]
Length=235

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 114/174 (66%), Gaps = 7/174 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K DIE G    LYPG+    ++LRW FIRK+Y I+S Q+L+T  V+ V     P+ E + 
Sbjct  3    KSDIETGGGNELYPGMK-ESSELRWAFIRKLYSILSLQLLVTVGVSAVVYFVRPIPEFIT  61

Query  285  GSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +    A+   ++ LP LLLWPL  ++++HP+N I L +FT S+SF V + C+ + G IV
Sbjct  62   ETHRGLAVFFVILLLPLLLLWPLLAFEKKHPINCIVLSIFTLSISFSVGICCSLSQGRIV  121

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LEA ILT+ +V  LT YTFWA K+G DF+FLGP LF +L I+++   +Q+F PL
Sbjct  122  LEAAILTAVMVFGLTIYTFWAVKRGHDFSFLGPFLFGALLIILVFTLLQIFHPL  175



>gb|ABR16790.1| unknown [Picea sitchensis]
Length=244

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 104/175 (59%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G   D+E G   LYP     E  LRW FIRK+Y I++ Q+LLT  VA V V   P+    
Sbjct  7    GPYADLETGNSALYPAQASDEIPLRWAFIRKIYSILTIQLLLTIAVASVVVFVRPVAHFF  66

Query  282  KGSSAlllflvflpflllwp---lHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A L   +F     L     L+ Y Q+HP+N+I L  FT  + F V ++CA T G +
Sbjct  67   VSTPAGLALYIFAIIFPLILIWPLYYYSQKHPVNYILLATFTVFMGFSVGLTCAFTAGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            +LE+ ILT+ VV++LT YTFWAAK+G DF+FL PILF    +L++   IQ+F PL
Sbjct  127  ILESAILTAVVVVSLTLYTFWAAKRGHDFSFLAPILFAGFMVLLVFILIQIFIPL  181



>ref|XP_002870289.1| hypothetical protein ARALYDRAFT_355323 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46548.1| hypothetical protein ARALYDRAFT_355323 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 19/186 (10%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            K DIE G    LYPG+    ++LRW FIRKVY I+S Q+LLT  V+ +     P+ E + 
Sbjct  3    KSDIETGGGNELYPGMK-ESSELRWAFIRKVYSILSLQMLLTVGVSALVYFVRPIPEFIT  61

Query  282  ---KGSSAlllflvflpflllwplHV-----------YQQRHPLNFIFLGLFTASLSFPV  419
               +G +   + L+      +  LH+           ++++HP+N I L +FT S+SF V
Sbjct  62   ETHRGLAVFFVILILPFLRYVSFLHISFFFVLWPLLAFEKKHPINCIVLSIFTLSISFAV  121

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfi  599
             + C+ + G IVLEA ILTS +V  LT YTFWA K+G DF+FLGP LF +L I++    +
Sbjct  122  GICCSLSKGRIVLEAAILTSVMVFGLTIYTFWAVKRGHDFSFLGPFLFGALLIILAFTLL  181

Query  600  QMFFPL  617
            Q+F PL
Sbjct  182  QIFHPL  187



>ref|NP_001151352.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG42484.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=250

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
             D E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   SDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVFVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLLILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ +LT+AVVL+LT YTFWAAK+G DF+FLGP LF ++ IL+L   IQ+FFPL
Sbjct  134  LESAVLTAAVVLSLTAYTFWAAKRGHDFSFLGPFLFAAVMILMLFALIQLFFPL  187



>gb|AFW67649.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=250

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
             D E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   SDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLLILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ +LT+AVVL+LT YTFWAAK+G DF+FLGP LF ++ IL+L   IQ+FFPL
Sbjct  134  LESAVLTAAVVLSLTAYTFWAAKRGHDFSFLGPFLFAAVMILMLFALIQLFFPL  187



>ref|XP_004981803.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=250

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAEAGQAARPLYPMM-LEDPRLRWSFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLIILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGQVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFPL  617
            LE+ ILTS VV++LT YTFWAAK+G DF+FLGP LF  + IL++   IQ+FFPL
Sbjct  134  LESAILTSVVVVSLTAYTFWAAKRGHDFSFLGPFLFAGVMILVVFSLIQLFFPL  187



>gb|KJB23001.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=172

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGP  158



>gb|KDD74103.1| inhibitor of apoptosis-promoting Bax1 [Helicosporidium sp. ATCC 
50920]
Length=243

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 117/175 (67%), Gaps = 1/175 (1%)
 Frame = +3

Query  90   SSSYDGGMKGDIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
            +S++  G K D+E G+L YPGI   EN LRWGF+RKVYGI+  Q+ LT +VAGV +    
Sbjct  3    ASAWGYGSKYDVESGSLLYPGIDATENMLRWGFVRKVYGIVGTQLALTAVVAGVFMQSPG  62

Query  267  LNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            +     GS AL + L+      L PL++++ +HP N  FLGL+T  +S  V ++ +    
Sbjct  63   VQAFFLGSVALQVLLLVGSLAALIPLYMFKDQHPHNLGFLGLWTLLMSVTVGMATSLYAP  122

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFF  611
            ++VLEAL+LT+ VV ALT Y+F+A K+G DF ++GP+  T+L++++L G IQ+FF
Sbjct  123  SVVLEALVLTAGVVFALTAYSFYATKRGVDFGWMGPLFATTLWVMLLWGVIQLFF  177



>gb|KDO74902.1| hypothetical protein CISIN_1g0265232mg, partial [Citrus sinensis]
Length=116

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYEGVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SL
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSL  116



>ref|XP_010923521.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=243

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 111/174 (64%), Gaps = 11/174 (6%)
 Frame = +3

Query  120  DIEEGT----LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            DIE G     LYP +   EN Q+RW F+RKVY I+  QILLT  VA V +   P++  L 
Sbjct  8    DIEAGVGGGALYPNMI--ENPQIRWAFVRKVYTIVVIQILLTIAVACVVIFVPPISRFLL  65

Query  282  ---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
                 S A+L+ +   P L++ P+  +++RHP+N + L LFT  +S  V ++CA   G +
Sbjct  66   ARTPASLAVLILISIAPLLVMLPMIYFRERHPINLVLLILFTICISLTVGLACATRSGKV  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
            +LEA  LT+ VV+ LT YTFWAAK+G DFNFLGP LF +L +L++  F+Q+F P
Sbjct  126  ILEAASLTAVVVVGLTMYTFWAAKRGHDFNFLGPFLFAALLVLMIYCFVQIFIP  179



>gb|KJB23002.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=187

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGP  158



>tpg|DAA59750.1| TPA: hypothetical protein ZEAMMB73_617181 [Zea mays]
Length=197

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 109/168 (65%), Gaps = 8/168 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++     + G  G    G    LYPG+     +LRW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQK-GLDVEAGTSGAAATGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVV  58

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      +SA   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++S
Sbjct  59   AAVVVKVRAIPHFFTTTSAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAIS  118

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGP  554
            F V ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +GKDF+FLGP
Sbjct  119  FAVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGP  166



>ref|XP_008786053.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=243

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 111/176 (63%), Gaps = 11/176 (6%)
 Frame = +3

Query  102  DGGMKGDIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + GM G    G LYP +   EN Q+RW F+RKVY I+  QILLT  VA V +    ++  
Sbjct  10   EAGMGG----GALYPNMM--ENPQIRWAFVRKVYTIVVIQILLTIAVACVVIFVPAISRF  63

Query  279  L----KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            L      S A+ + ++  PFL++ P+  ++QRHP+N I L LFT  +S  V ++CA   G
Sbjct  64   LLAHTPASLAVFILIIIAPFLVMLPMIYFRQRHPINLILLMLFTVCISLTVGLACATRSG  123

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGKDFNFLGPilftslfililtgfiQMFFP  614
             ++LEA  LT  VV+ LT YTFWAAK+G DFNFLGP LF +L +L++  FIQ+F P
Sbjct  124  KVILEAASLTVVVVIGLTLYTFWAAKRGHDFNFLGPFLFAALLVLMIYCFIQIFIP  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090