BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003B02 601 bp,

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99237.1|  unnamed protein product                                239   3e-76   Coffea canephora [robusta coffee]
ref|XP_007035120.1|  Glutathione S-transferase tau 7                    225   3e-70   Theobroma cacao [chocolate]
gb|KDP40336.1|  hypothetical protein JCGZ_02334                         224   5e-70   Jatropha curcas
ref|XP_007035121.1|  Glutathione S-transferase tau 7 isoform 1          223   1e-69   Theobroma cacao [chocolate]
ref|XP_007035122.1|  Glutathione S-transferase tau 7 isoform 2          221   6e-69   Theobroma cacao [chocolate]
gb|KEH20685.1|  glutathione S-transferase                               219   4e-68   Medicago truncatula
emb|CDP08010.1|  unnamed protein product                                219   5e-68   Coffea canephora [robusta coffee]
gb|ACJ83863.1|  unknown                                                 217   2e-67   Medicago truncatula
ref|XP_006378334.1|  hypothetical protein POPTR_0010s08170g             217   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase      217   3e-67   Populus euphratica
ref|XP_011091312.1|  PREDICTED: glutathione transferase GST 23-like     217   3e-67   Sesamum indicum [beniseed]
emb|CDO99236.1|  unnamed protein product                                216   4e-67   Coffea canephora [robusta coffee]
ref|XP_007159485.1|  hypothetical protein PHAVU_002G241400g             213   6e-66   Phaseolus vulgaris [French bean]
ref|XP_010069125.1|  PREDICTED: glutathione transferase GST 23-like     211   7e-65   Eucalyptus grandis [rose gum]
ref|XP_003629836.1|  Receptor-like protein kinase                       224   8e-65   
ref|XP_010069124.1|  PREDICTED: glutathione transferase GST 23-like     209   2e-64   Eucalyptus grandis [rose gum]
ref|XP_010025836.1|  PREDICTED: glutathione transferase GST 23-like     211   5e-64   Eucalyptus grandis [rose gum]
emb|CDP08048.1|  unnamed protein product                                209   2e-63   Coffea canephora [robusta coffee]
ref|XP_002285214.1|  PREDICTED: glutathione transferase GST 23          206   7e-63   Vitis vinifera
ref|XP_003632015.1|  PREDICTED: probable glutathione S-transferase      205   8e-63   Vitis vinifera
ref|XP_006420238.1|  hypothetical protein CICLE_v10005771mg             206   9e-63   Citrus clementina
emb|CAN63628.1|  hypothetical protein VITISV_018696                     205   1e-62   Vitis vinifera
ref|XP_002285220.1|  PREDICTED: glutathione transferase GST 23          204   2e-62   Vitis vinifera
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      204   4e-62   Vitis vinifera
gb|AEC32486.1|  tau class glutathione S-transferase                     203   7e-62   Glycine soja [wild soybean]
ref|XP_003524975.2|  PREDICTED: probable glutathione S-transferase      203   7e-62   
ref|XP_008224351.1|  PREDICTED: probable glutathione S-transferase      202   1e-61   Prunus mume [ume]
gb|ACU14737.1|  unknown                                                 203   1e-61   Glycine max [soybeans]
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      202   2e-61   Vitis vinifera
gb|AJE59670.1|  tau class glutathione S-transferase                     202   2e-61   Glycine max [soybeans]
ref|XP_002285212.1|  PREDICTED: glutathione transferase GST 23          201   3e-61   Vitis vinifera
ref|XP_007226113.1|  hypothetical protein PRUPE_ppa011087mg             201   4e-61   Prunus persica
gb|AAG34804.1|AF243369_1  glutathione S-transferase GST 14              201   5e-61   Glycine max [soybeans]
gb|KHN48021.1|  Putative glutathione S-transferase                      202   5e-61   Glycine soja [wild soybean]
gb|AFK41941.1|  unknown                                                 200   7e-61   Lotus japonicus
ref|NP_001234957.1|  glutathione S-transferase GST 17                   200   1e-60   Glycine max [soybeans]
gb|ACU20120.1|  unknown                                                 200   1e-60   Glycine max [soybeans]
gb|KHN48020.1|  Glutathione transferase GST 23                          199   3e-60   Glycine soja [wild soybean]
gb|KHN06425.1|  Putative glutathione S-transferase                      199   3e-60   Glycine soja [wild soybean]
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    197   1e-59   Citrus sinensis [Valencia orange]
ref|XP_008232144.1|  PREDICTED: probable glutathione S-transferase      197   1e-59   Prunus mume [ume]
gb|AFF18814.1|  glutathione transferase                                 197   2e-59   Dimocarpus longan [longan]
ref|XP_006489726.1|  PREDICTED: probable glutathione S-transferas...    197   2e-59   Citrus sinensis [Valencia orange]
gb|KCW57371.1|  hypothetical protein EUGRSUZ_H00157                     196   2e-59   Eucalyptus grandis [rose gum]
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             197   2e-59   Citrus clementina
gb|AFF18816.1|  glutathione transferase                                 196   3e-59   Dimocarpus longan [longan]
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             196   4e-59   Citrus clementina
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      196   4e-59   Nelumbo nucifera [Indian lotus]
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   196   4e-59   Citrus sinensis [Valencia orange]
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   196   5e-59   Citrus sinensis [Valencia orange]
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     195   1e-58   Elaeis guineensis
ref|XP_002523996.1|  glutathione s-transferase, putative                194   1e-58   Ricinus communis
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like     194   3e-58   Citrus sinensis [Valencia orange]
gb|AJE59654.1|  tau class glutathione S-transferase                     193   3e-58   Glycine max [soybeans]
ref|XP_010067033.1|  PREDICTED: probable glutathione S-transferase      194   3e-58   Eucalyptus grandis [rose gum]
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             193   3e-58   Citrus clementina
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-li...    193   6e-58   Fragaria vesca subsp. vesca
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      192   6e-58   Vitis vinifera
emb|CAN72240.1|  hypothetical protein VITISV_010777                     192   7e-58   Vitis vinifera
ref|XP_006489727.1|  PREDICTED: probable glutathione S-transferas...    193   7e-58   Citrus sinensis [Valencia orange]
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      192   1e-57   Phoenix dactylifera
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             192   1e-57   Prunus persica
ref|XP_006420237.1|  hypothetical protein CICLE_v10005779mg             192   1e-57   Citrus clementina
ref|XP_002532523.1|  glutathione s-transferase, putative                192   1e-57   Ricinus communis
emb|CAN78656.1|  hypothetical protein VITISV_006850                     192   1e-57   Vitis vinifera
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like       192   1e-57   Citrus sinensis [Valencia orange]
ref|XP_002460369.1|  hypothetical protein SORBIDRAFT_02g027080          192   2e-57   Sorghum bicolor [broomcorn]
ref|XP_010922854.1|  PREDICTED: probable glutathione S-transferase      191   2e-57   Elaeis guineensis
gb|KDP39591.1|  hypothetical protein JCGZ_02611                         191   3e-57   Jatropha curcas
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             191   3e-57   Prunus persica
ref|NP_001104994.1|  glutathione transferase GST 23                     191   4e-57   Zea mays [maize]
ref|XP_003629835.1|  Glutathione S-transferase GST                      191   4e-57   Medicago truncatula
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferase      190   5e-57   Fragaria vesca subsp. vesca
tpg|DAA61851.1|  TPA: hypothetical protein ZEAMMB73_518022              191   5e-57   Zea mays [maize]
ref|XP_004297032.1|  PREDICTED: probable glutathione S-transferase      190   6e-57   Fragaria vesca subsp. vesca
gb|KHN06423.1|  Putative glutathione S-transferase                      190   6e-57   Glycine soja [wild soybean]
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                   190   7e-57   Citrus sinensis [Valencia orange]
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    190   7e-57   Citrus sinensis [Valencia orange]
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like       190   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like     190   8e-57   Setaria italica
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...    189   9e-57   Pyrus x bretschneideri [bai li]
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      189   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    189   2e-56   Cucumis sativus [cucumbers]
ref|XP_008232147.1|  PREDICTED: probable glutathione S-transferase      189   2e-56   Prunus mume [ume]
ref|XP_003532764.1|  PREDICTED: probable glutathione S-transferase      189   2e-56   
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     189   2e-56   Phoenix dactylifera
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      188   3e-56   Cucumis melo [Oriental melon]
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    188   3e-56   Vitis vinifera
gb|KDP42499.1|  hypothetical protein JCGZ_00296                         188   3e-56   Jatropha curcas
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferase      188   4e-56   Fragaria vesca subsp. vesca
ref|XP_009343222.1|  PREDICTED: glutathione transferase GST 23-li...    187   5e-56   Pyrus x bretschneideri [bai li]
emb|CDP15482.1|  unnamed protein product                                188   5e-56   Coffea canephora [robusta coffee]
gb|KDP42500.1|  hypothetical protein JCGZ_00297                         187   5e-56   Jatropha curcas
ref|XP_002532525.1|  glutathione s-transferase, putative                187   6e-56   Ricinus communis
ref|XP_006420235.1|  hypothetical protein CICLE_v10006671mg             187   7e-56   Citrus clementina
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           187   9e-56   Theobroma cacao [chocolate]
gb|KJB76665.1|  hypothetical protein B456_012G099100                    187   1e-55   Gossypium raimondii
ref|XP_010067034.1|  PREDICTED: glutathione transferase GST 23-like     187   1e-55   Eucalyptus grandis [rose gum]
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     187   2e-55   Elaeis guineensis
ref|XP_002307924.1|  hypothetical protein POPTR_0006s02510g             186   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002523997.1|  glutathione s-transferase, putative                186   2e-55   Ricinus communis
ref|XP_007210928.1|  hypothetical protein PRUPE_ppa026181mg             185   2e-55   Prunus persica
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    186   2e-55   
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    186   2e-55   Cucumis sativus [cucumbers]
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     186   2e-55   Nicotiana tomentosiformis
emb|CDP09302.1|  unnamed protein product                                186   2e-55   Coffea canephora [robusta coffee]
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     186   2e-55   Elaeis guineensis
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    186   3e-55   Vitis vinifera
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          186   3e-55   Vitis vinifera
ref|NP_001063423.1|  Os09g0467200                                       185   5e-55   
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     185   5e-55   Prunus mume [ume]
ref|NP_001234088.1|  uncharacterized protein LOC543815                  185   6e-55   Solanum lycopersicum
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      185   7e-55   Vitis vinifera
emb|CBI26437.3|  unnamed protein product                                185   8e-55   Vitis vinifera
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      184   9e-55   Cucumis melo [Oriental melon]
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      184   9e-55   Prunus mume [ume]
gb|ADB11356.1|  putative tau class glutathione transferase GSTU23       186   1e-54   Populus trichocarpa [western balsam poplar]
emb|CDP21862.1|  unnamed protein product                                184   1e-54   Coffea canephora [robusta coffee]
ref|XP_011004953.1|  PREDICTED: probable glutathione S-transferase      184   1e-54   Populus euphratica
ref|XP_002527848.1|  glutathione s-transferase, putative                184   1e-54   Ricinus communis
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             184   2e-54   Prunus persica
ref|XP_011004483.1|  PREDICTED: probable glutathione S-transferase      184   2e-54   Populus euphratica
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      184   2e-54   Elaeis guineensis
ref|XP_011040645.1|  PREDICTED: probable glutathione S-transferase      184   2e-54   Populus euphratica
ref|XP_004307163.2|  PREDICTED: probable glutathione S-transferase      184   2e-54   Fragaria vesca subsp. vesca
gb|KJB44380.1|  hypothetical protein B456_007G249200                    183   2e-54   Gossypium raimondii
ref|XP_002319750.2|  hypothetical protein POPTR_0013s06950g             183   3e-54   Populus trichocarpa [western balsam poplar]
gb|AAG34831.1|AF244688_1  glutathione S-transferase GST 23              183   3e-54   Zea mays [maize]
ref|XP_006489767.1|  PREDICTED: glutathione transferase GST 23-like     182   3e-54   Citrus sinensis [Valencia orange]
dbj|BAK02670.1|  predicted protein                                      183   3e-54   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006420236.1|  hypothetical protein CICLE_v10005779mg             183   4e-54   Citrus clementina
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...    183   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_007029835.1|  Glutathione S-transferase TAU 8                    184   4e-54   Theobroma cacao [chocolate]
gb|ADB11328.1|  tau class glutathione transferase GSTU46                183   4e-54   Populus trichocarpa [western balsam poplar]
gb|ADB11367.1|  putative tau class glutathione transferase GSTU41       183   5e-54   Populus trichocarpa [western balsam poplar]
ref|NP_001237959.1|  uncharacterized protein LOC100305870               182   5e-54   Glycine max [soybeans]
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     183   5e-54   Phoenix dactylifera
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      183   5e-54   Vitis vinifera
ref|XP_011086578.1|  PREDICTED: glutathione transferase GST 23-like     182   6e-54   Sesamum indicum [beniseed]
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg             182   6e-54   Citrus clementina
gb|AFK35732.1|  unknown                                                 182   7e-54   Lotus japonicus
ref|XP_010097693.1|  putative glutathione S-transferase                 182   8e-54   Morus notabilis
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                   182   9e-54   Citrus sinensis [Valencia orange]
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g             182   1e-53   Populus trichocarpa [western balsam poplar]
gb|KEH26957.1|  glutathione S-transferase                               182   1e-53   Medicago truncatula
gb|AFK34634.1|  unknown                                                 182   1e-53   Lotus japonicus
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             182   1e-53   Populus trichocarpa [western balsam poplar]
emb|CDP19810.1|  unnamed protein product                                181   2e-53   Coffea canephora [robusta coffee]
ref|XP_003578262.1|  PREDICTED: glutathione transferase GST 23-li...    181   2e-53   Brachypodium distachyon [annual false brome]
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      181   2e-53   Populus euphratica
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like     181   2e-53   
emb|CBI26438.3|  unnamed protein product                                181   2e-53   Vitis vinifera
ref|XP_004299656.1|  PREDICTED: probable glutathione S-transferase      181   2e-53   Fragaria vesca subsp. vesca
gb|EMT19525.1|  hypothetical protein F775_31981                         181   2e-53   Aegilops tauschii
ref|XP_002266994.1|  PREDICTED: probable glutathione S-transferase      181   3e-53   Vitis vinifera
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   181   3e-53   Citrus sinensis [Valencia orange]
ref|XP_002268774.2|  PREDICTED: probable glutathione S-transferase      181   4e-53   Vitis vinifera
gb|ADB11358.1|  tau class glutathione transferase GSTU26                180   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    180   5e-53   Pyrus x bretschneideri [bai li]
emb|CAN73419.1|  hypothetical protein VITISV_027346                     181   5e-53   Vitis vinifera
ref|NP_001237698.1|  glutathione S-transferase GST 20                   180   5e-53   Glycine max [soybeans]
ref|XP_006580178.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    179   6e-53   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     179   8e-53   Elaeis guineensis
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     179   1e-52   Phoenix dactylifera
emb|CDP11459.1|  unnamed protein product                                179   1e-52   Coffea canephora [robusta coffee]
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      179   1e-52   Vitis vinifera
ref|XP_007145574.1|  hypothetical protein PHAVU_007G250000g             179   1e-52   Phaseolus vulgaris [French bean]
gb|AFP20277.1|  glutathione transferase 23                              179   1e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     179   2e-52   Nicotiana sylvestris
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    179   2e-52   Solanum tuberosum [potatoes]
ref|XP_010469949.1|  PREDICTED: glutathione S-transferase U1            178   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    178   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like     178   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009343224.1|  PREDICTED: probable glutathione S-transferas...    178   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_009790678.1|  PREDICTED: glutathione transferase GST 23-like     178   3e-52   Nicotiana sylvestris
ref|XP_004978487.1|  PREDICTED: glutathione transferase GST 23-like     178   3e-52   Setaria italica
ref|XP_008240195.1|  PREDICTED: probable glutathione S-transferase      177   4e-52   Prunus mume [ume]
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    177   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_010510486.1|  PREDICTED: glutathione S-transferase U1-like       177   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004504278.1|  PREDICTED: probable glutathione S-transferas...    177   5e-52   Cicer arietinum [garbanzo]
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase      177   6e-52   Vitis vinifera
ref|XP_010238250.1|  PREDICTED: glutathione transferase GST 23-li...    177   9e-52   Brachypodium distachyon [annual false brome]
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g             177   9e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             177   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     177   1e-51   Elaeis guineensis
ref|NP_001234091.1|  uncharacterized protein LOC543816                  176   1e-51   Solanum lycopersicum
gb|KEH35720.1|  glutathione S-transferase, amino-terminal domain ...    176   1e-51   Medicago truncatula
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     176   2e-51   Eucalyptus grandis [rose gum]
ref|NP_001234986.1|  glutathione S-transferase GST 19                   176   2e-51   Glycine max [soybeans]
gb|AFK37185.1|  unknown                                                 176   2e-51   Medicago truncatula
gb|KJB28257.1|  hypothetical protein B456_005G037700                    176   2e-51   Gossypium raimondii
ref|XP_002881053.1|  glutathione S-transferase 19                       176   2e-51   Arabidopsis lyrata subsp. lyrata
emb|CDP11462.1|  unnamed protein product                                177   2e-51   Coffea canephora [robusta coffee]
gb|EYU26814.1|  hypothetical protein MIMGU_mgv1a013348mg                176   2e-51   Erythranthe guttata [common monkey flower]
gb|KHG20964.1|  Glutathione S-transferase U7 -like protein              176   3e-51   Gossypium arboreum [tree cotton]
ref|XP_010243655.1|  PREDICTED: probable glutathione S-transferase      176   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             175   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002520477.1|  glutathione s-transferase, putative                175   4e-51   Ricinus communis
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      176   4e-51   Eucalyptus grandis [rose gum]
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      175   4e-51   Populus euphratica
ref|XP_008346936.1|  PREDICTED: probable glutathione S-transferase      177   4e-51   
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      175   4e-51   Eucalyptus grandis [rose gum]
ref|XP_002520474.1|  glutathione s-transferase, putative                175   4e-51   
gb|KJB19709.1|  hypothetical protein B456_003G127600                    176   4e-51   Gossypium raimondii
ref|XP_006294917.1|  hypothetical protein CARUB_v10023969mg             175   5e-51   Capsella rubella
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          175   7e-51   Vitis vinifera
ref|XP_007209589.1|  hypothetical protein PRUPE_ppa011268mg             174   7e-51   Prunus persica
ref|XP_002520476.1|  glutathione s-transferase, putative                175   7e-51   Ricinus communis
ref|XP_010542655.1|  PREDICTED: glutathione S-transferase U1-like       174   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          176   9e-51   Theobroma cacao [chocolate]
gb|KJB27950.1|  hypothetical protein B456_005G038200                    174   9e-51   Gossypium raimondii
ref|XP_002520473.1|  glutathione s-transferase, putative                175   1e-50   
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          174   1e-50   Theobroma cacao [chocolate]
ref|NP_180510.1|  glutathione S-transferase tau 1                       174   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010098.1|  PREDICTED: probable glutathione S-transferase      174   1e-50   Populus euphratica
ref|XP_008363399.1|  PREDICTED: glutathione transferase GST 23-like     174   1e-50   Malus domestica [apple tree]
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       174   1e-50   Eucalyptus grandis [rose gum]
ref|XP_007026866.1|  Tau class glutathione transferase GSTU45           174   1e-50   Theobroma cacao [chocolate]
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      174   1e-50   Eucalyptus grandis [rose gum]
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      173   2e-50   Vitis vinifera
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       173   3e-50   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002881054.1|  glutathione-s-transferase 9                        173   3e-50   Arabidopsis lyrata subsp. lyrata
gb|ABW81199.1|  glutathione-S-transferase 9                             173   3e-50   Arabidopsis cebennensis
ref|XP_009141006.1|  PREDICTED: glutathione S-transferase U2            174   3e-50   Brassica rapa
gb|KJB80746.1|  hypothetical protein B456_013G113600                    173   3e-50   Gossypium raimondii
gb|AFY26875.1|  glutathione-S-transferase                               173   3e-50   Ipomoea batatas [batate]
ref|XP_011092669.1|  PREDICTED: glutathione S-transferase U7-like       173   4e-50   Sesamum indicum [beniseed]
ref|XP_010414381.1|  PREDICTED: glutathione S-transferase U1-like       173   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004229525.1|  PREDICTED: glutathione transferase GST 23-like     172   4e-50   Solanum lycopersicum
emb|CAN73675.1|  hypothetical protein VITISV_001110                     172   4e-50   Vitis vinifera
gb|KDP34500.1|  hypothetical protein JCGZ_11050                         172   4e-50   Jatropha curcas
emb|CDP06552.1|  unnamed protein product                                173   5e-50   Coffea canephora [robusta coffee]
ref|XP_008806389.1|  PREDICTED: glutathione transferase GST 23-like     172   5e-50   Phoenix dactylifera
gb|ADB11327.1|  tau class glutathione transferase GSTU45                172   6e-50   Populus trichocarpa [western balsam poplar]
gb|KCW65098.1|  hypothetical protein EUGRSUZ_G02603                     172   7e-50   Eucalyptus grandis [rose gum]
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840          172   7e-50   Amborella trichopoda
emb|CDY51364.1|  BnaA04g28580D                                          172   8e-50   Brassica napus [oilseed rape]
ref|XP_007029718.1|  Glutathione S-transferase tau 7                    172   9e-50   Theobroma cacao [chocolate]
ref|NP_001238721.1|  glutathione S-transferase GST 13                   171   1e-49   Glycine max [soybeans]
ref|XP_009347672.1|  PREDICTED: glutathione S-transferase U8-like       172   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_004301267.1|  PREDICTED: glutathione S-transferase U7-like       171   1e-49   Fragaria vesca subsp. vesca
ref|XP_006354571.1|  PREDICTED: glutathione transferase GST 23-li...    171   1e-49   Solanum tuberosum [potatoes]
gb|KJB28236.1|  hypothetical protein B456_005G036300                    172   1e-49   Gossypium raimondii
ref|XP_002518184.1|  glutathione s-transferase, putative                171   2e-49   Ricinus communis
gb|ADB11374.1|  tau class glutathione transferase GSTU50                171   2e-49   Populus trichocarpa [western balsam poplar]
gb|ACU15611.1|  unknown                                                 171   2e-49   Glycine max [soybeans]
gb|ADB11377.1|  putative tau class glutathione transferase GSTU53       171   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like       171   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_006410006.1|  hypothetical protein EUTSA_v10017660mg             171   2e-49   Eutrema salsugineum
ref|XP_009606213.1|  PREDICTED: glutathione transferase GST 23-like     171   2e-49   Nicotiana tomentosiformis
ref|XP_002521517.1|  glutathione s-transferase, putative                171   2e-49   Ricinus communis
ref|XP_010521901.1|  PREDICTED: glutathione S-transferase U1-like       171   2e-49   Tarenaya hassleriana [spider flower]
gb|ABW81132.1|  GST40                                                   171   2e-49   Capsella rubella
ref|XP_006294909.1|  hypothetical protein CARUB_v10023960mg             171   3e-49   Capsella rubella
gb|KFK44230.1|  hypothetical protein AALP_AA1G231500                    176   3e-49   Arabis alpina [alpine rockcress]
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              171   3e-49   Gossypium arboreum [tree cotton]
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           170   3e-49   Theobroma cacao [chocolate]
gb|KDP42181.1|  hypothetical protein JCGZ_02911                         171   3e-49   Jatropha curcas
gb|AFK45620.1|  unknown                                                 170   3e-49   Lotus japonicus
gb|ACU15816.1|  unknown                                                 170   3e-49   Glycine max [soybeans]
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                170   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      170   4e-49   Populus euphratica
ref|XP_006849232.1|  hypothetical protein AMTR_s00027p00233060          170   4e-49   Amborella trichopoda
gb|KHN05112.1|  Putative glutathione S-transferase                      170   4e-49   Glycine soja [wild soybean]
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...    170   4e-49   
emb|CBI16040.3|  unnamed protein product                                174   4e-49   Vitis vinifera
ref|XP_010469952.1|  PREDICTED: glutathione S-transferase U4 isof...    170   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006365401.1|  PREDICTED: probable glutathione S-transferas...    170   4e-49   Solanum tuberosum [potatoes]
ref|XP_002520478.1|  glutathione s-transferase, putative                170   5e-49   Ricinus communis
gb|KJB36831.1|  hypothetical protein B456_006G178600                    170   5e-49   Gossypium raimondii
ref|XP_010271921.1|  PREDICTED: probable glutathione S-transferase      170   5e-49   Nelumbo nucifera [Indian lotus]
emb|CDY51366.1|  BnaA04g28600D                                          170   5e-49   Brassica napus [oilseed rape]
ref|XP_010243637.1|  PREDICTED: probable glutathione S-transferase      170   5e-49   Nelumbo nucifera [Indian lotus]
ref|NP_180503.1|  glutathione S-transferase tau 7                       170   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            169   6e-49   Vitis vinifera
ref|XP_008374802.1|  PREDICTED: glutathione S-transferase U8-like       169   6e-49   
ref|XP_004229524.1|  PREDICTED: glutathione transferase GST 23-like     169   6e-49   Solanum lycopersicum
gb|KFK44228.1|  hypothetical protein AALP_AA1G231200                    169   8e-49   Arabis alpina [alpine rockcress]
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      169   8e-49   Eucalyptus grandis [rose gum]
ref|XP_009596758.1|  PREDICTED: probable glutathione S-transferase      169   9e-49   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   169   9e-49   
gb|KDP38795.1|  hypothetical protein JCGZ_05131                         169   1e-48   
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       169   1e-48   
ref|XP_010942640.1|  PREDICTED: glutathione transferase GST 23-like     169   1e-48   
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    169   1e-48   
ref|XP_010414384.1|  PREDICTED: glutathione S-transferase U4-like       169   1e-48   
gb|ADD71974.1|  glutathione S-transferase                               169   1e-48   
ref|XP_010510490.1|  PREDICTED: glutathione S-transferase U4-like       169   1e-48   
emb|CDX97882.1|  BnaC04g40570D                                          169   1e-48   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            169   2e-48   
gb|KHN06986.1|  Putative glutathione S-transferase                      169   2e-48   
emb|CDY53373.1|  BnaC04g54530D                                          169   2e-48   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      169   2e-48   
ref|XP_007034530.1|  Tau class glutathione transferase GSTU43           169   2e-48   
ref|XP_008344765.1|  PREDICTED: glutathione S-transferase U8-like       168   2e-48   
ref|XP_002266744.1|  PREDICTED: probable glutathione S-transferase      168   2e-48   
emb|CDX97887.1|  BnaC04g40520D                                          168   2e-48   
ref|XP_010510487.1|  PREDICTED: glutathione S-transferase U2-like       168   2e-48   
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            168   3e-48   
ref|XP_008363401.1|  PREDICTED: glutathione S-transferase U8-like       168   3e-48   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               167   3e-48   
gb|ABW81194.1|  glutathione-S-transferase 5                             168   3e-48   
emb|CDY45446.1|  BnaA05g12550D                                          167   3e-48   
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    167   4e-48   
gb|AFS51729.1|  tau class glutathione S-transferase                     167   4e-48   
ref|XP_009399930.1|  PREDICTED: probable glutathione S-transferase      167   4e-48   
ref|XP_006354574.1|  PREDICTED: glutathione transferase GST 23-like     167   4e-48   
gb|AJE59685.1|  tau class glutathione S-transferase                     167   4e-48   
ref|XP_006296522.1|  hypothetical protein CARUB_v10025711mg             167   5e-48   
gb|ABW81037.1|  glutathione-s-transferase 7                             167   5e-48   
ref|XP_002862399.1|  glutathione-s-transferase                          167   5e-48   
emb|CDX97884.1|  BnaC04g40550D                                          167   6e-48   
gb|ABW81189.1|  glutathione-S-transferase                               167   6e-48   
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       167   6e-48   
ref|XP_009776230.1|  PREDICTED: probable glutathione S-transferase      167   6e-48   
emb|CAN73674.1|  hypothetical protein VITISV_001109                     170   6e-48   
ref|XP_002881051.1|  glutathione-s-transferase 2                        167   7e-48   
ref|XP_010263987.1|  PREDICTED: probable glutathione S-transferase      167   7e-48   
gb|KJB28258.1|  hypothetical protein B456_005G037800                    167   8e-48   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     167   8e-48   
ref|XP_009360111.1|  PREDICTED: glutathione S-transferase U8-like       167   9e-48   
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    172   1e-47   
ref|XP_009141004.1|  PREDICTED: glutathione S-transferase U4            166   1e-47   
emb|CAN60691.1|  hypothetical protein VITISV_044168                     166   1e-47   
gb|ACU24385.1|  unknown                                                 166   1e-47   
ref|XP_003632026.2|  PREDICTED: probable glutathione S-transferase      166   1e-47   
ref|XP_006420234.1|  hypothetical protein CICLE_v10005809mg             166   1e-47   
ref|XP_006849226.1|  hypothetical protein AMTR_s00027p00230760          166   1e-47   
gb|AEB77869.1|  glutathione S-transferase protein                       166   1e-47   
emb|CDY51369.1|  BnaA04g28630D                                          166   1e-47   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      166   1e-47   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               166   1e-47   
gb|KHN05118.1|  Putative glutathione S-transferase                      166   1e-47   
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             166   2e-47   
ref|XP_002881050.1|  glutathione-s-transferase 3                        166   2e-47   
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             166   2e-47   
ref|XP_006489729.1|  PREDICTED: probable glutathione S-transferas...    166   2e-47   
gb|AGH14251.1|  glutathione S-transferase                               166   2e-47   
gb|KHN25840.1|  Putative glutathione S-transferase                      166   2e-47   
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    166   2e-47   
ref|NP_001237856.1|  uncharacterized protein LOC100500680               166   2e-47   
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       166   2e-47   
ref|XP_011041578.1|  PREDICTED: probable glutathione S-transferase      165   2e-47   
gb|KHN05121.1|  Putative glutathione S-transferase                      166   2e-47   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   166   2e-47   
gb|KHG01946.1|  Glutathione S-transferase U7 -like protein              166   2e-47   
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like       166   2e-47   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             166   2e-47   
ref|XP_010039180.1|  PREDICTED: glutathione S-transferase U8-like       167   2e-47   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    166   3e-47   
gb|KDO57584.1|  hypothetical protein CISIN_1g036834mg                   166   3e-47   
ref|XP_002520472.1|  glutathione s-transferase, putative                165   3e-47   
ref|XP_002881042.1|  glutathione-s-transferase                          165   3e-47   
ref|NP_180508.1|  glutathione S-transferase tau 3                       165   3e-47   
ref|NP_001238659.1|  glutathione S-transferase GST 7                    165   3e-47   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g             165   3e-47   
ref|XP_002524046.1|  glutathione s-transferase, putative                165   4e-47   
ref|XP_011016467.1|  PREDICTED: glutathione S-transferase U8-like       162   4e-47   
ref|NP_001238675.1|  glutathione S-transferase GST 8                    165   4e-47   
ref|NP_001104997.1|  LOC541848                                          164   4e-47   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       164   4e-47   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    165   5e-47   
gb|ACG44510.1|  glutathione S-transferase GSTU6                         164   5e-47   
ref|XP_009606317.1|  PREDICTED: probable glutathione S-transferase      165   5e-47   
ref|NP_001238643.1|  glutathione S-transferase GST 6                    165   5e-47   
ref|XP_009140998.1|  PREDICTED: glutathione S-transferase U7            165   5e-47   
ref|NP_001238439.1|  probable glutathione S-transferase                 165   5e-47   
ref|XP_007034547.1|  Tau class glutathione transferase GSTU43           168   5e-47   
gb|KHN05113.1|  Putative glutathione S-transferase                      164   6e-47   
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           164   6e-47   
ref|XP_002267733.1|  PREDICTED: probable glutathione S-transferase      164   6e-47   
ref|XP_010414382.1|  PREDICTED: glutathione S-transferase U2            164   7e-47   
gb|AFK40836.1|  unknown                                                 164   8e-47   
emb|CAN62219.1|  hypothetical protein VITISV_042912                     164   1e-46   
gb|AJE59664.1|  tau class glutathione S-transferase                     164   1e-46   
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    164   1e-46   
ref|XP_009370935.1|  PREDICTED: glutathione transferase GST 23-like     164   1e-46   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    164   1e-46   
ref|XP_010091847.1|  Glutathione transferase GST 23                     164   1e-46   
gb|KFK44229.1|  hypothetical protein AALP_AA1G231400                    164   1e-46   
ref|XP_010469950.1|  PREDICTED: glutathione S-transferase U2-like       163   2e-46   
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      163   2e-46   
ref|XP_008372419.1|  PREDICTED: glutathione transferase GST 23-like     163   2e-46   
gb|ADB11371.1|  putative tau class glutathione transferase GSTU47       163   2e-46   
gb|ABW69659.2|  glutathione S-transferase                               163   2e-46   
ref|NP_180509.1|  glutathione S-transferase tau 2                       163   2e-46   
gb|AEB77872.1|  glutathione S-transferase protein                       163   2e-46   
gb|ABW81195.1|  gluthathione-S-transferase                              163   2e-46   
ref|XP_007219176.1|  hypothetical protein PRUPE_ppa016653mg             162   2e-46   
gb|ADB11369.1|  tau class glutathione transferase GSTU43                163   3e-46   
ref|XP_009789711.1|  PREDICTED: probable glutathione S-transferase      162   3e-46   
ref|XP_008438428.1|  PREDICTED: probable glutathione S-transferas...    163   3e-46   
ref|XP_010264128.1|  PREDICTED: glutathione transferase GST 23-like     163   3e-46   
gb|AFF18812.1|  glutathione transferase                                 162   3e-46   
ref|XP_010414386.1|  PREDICTED: glutathione S-transferase U7            162   4e-46   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             162   4e-46   
gb|AAK62449.1|AF387004_1  putative glutathione S-transferase            162   4e-46   
gb|AFK43265.1|  unknown                                                 162   4e-46   
ref|XP_006489730.1|  PREDICTED: probable glutathione S-transferas...    162   4e-46   
gb|ABW81136.1|  GST36                                                   162   4e-46   
ref|NP_180507.1|  glutathione S-transferase tau 4                       162   4e-46   
ref|XP_009782545.1|  PREDICTED: glutathione transferase GST 23-like     162   5e-46   
ref|XP_008448606.1|  PREDICTED: probable glutathione S-transferase      162   5e-46   
ref|XP_009144373.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    162   5e-46   
gb|AGV54744.1|  glutathione transferase                                 162   5e-46   
ref|XP_010101873.1|  putative glutathione S-transferase                 162   6e-46   
ref|XP_004971273.1|  PREDICTED: probable glutathione S-transferas...    162   6e-46   
gb|KJB65834.1|  hypothetical protein B456_010G115400                    161   6e-46   
gb|KFK44227.1|  hypothetical protein AALP_AA1G231100                    162   6e-46   
ref|XP_010069088.1|  PREDICTED: glutathione transferase GST 23-like     162   6e-46   
ref|XP_006420233.1|  hypothetical protein CICLE_v10005812mg             162   7e-46   
ref|XP_009618409.1|  PREDICTED: probable glutathione S-transferase      162   7e-46   
emb|CDY40167.1|  BnaC04g13950D                                          162   7e-46   
gb|AJE59667.1|  tau class glutathione S-transferase                     162   7e-46   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    162   7e-46   
ref|XP_008438427.1|  PREDICTED: probable glutathione S-transferas...    162   8e-46   
gb|ACU20730.1|  unknown                                                 159   8e-46   
ref|NP_001104993.1|  glutathione S-transferase GST 33                   162   8e-46   
gb|AFK37419.1|  unknown                                                 162   8e-46   
ref|XP_002881046.1|  glutathione-s-tranferase 6                         161   9e-46   
ref|XP_010510492.1|  PREDICTED: glutathione S-transferase U7-like       162   9e-46   
ref|XP_009625219.1|  PREDICTED: probable glutathione S-transferase      161   9e-46   
ref|XP_003529121.1|  PREDICTED: probable glutathione S-transferas...    161   1e-45   
gb|KDP42182.1|  hypothetical protein JCGZ_02912                         161   1e-45   
ref|XP_006410003.1|  hypothetical protein EUTSA_v10017840mg             161   1e-45   
dbj|BAC21263.1|  glutathione S-transferase                              161   1e-45   
ref|XP_010650966.1|  PREDICTED: glutathione S-transferase U8            161   1e-45   
gb|AFK41515.1|  unknown                                                 159   1e-45   
ref|XP_010101874.1|  putative glutathione S-transferase                 161   1e-45   
gb|KHN05114.1|  Putative glutathione S-transferase                      161   1e-45   
ref|XP_002892975.1|  predicted protein                                  160   1e-45   
gb|AAO69664.1|  glutathione S-transferase                               161   1e-45   
gb|KHG11257.1|  Glutathione transferase GST 23                          161   1e-45   
ref|XP_008382674.1|  PREDICTED: probable glutathione S-transferase      161   1e-45   
ref|XP_009370927.1|  PREDICTED: probable glutathione S-transferas...    161   1e-45   
ref|XP_010036925.1|  PREDICTED: glutathione transferase GST 23-like     161   1e-45   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      161   2e-45   
gb|KEH28979.1|  glutathione S-transferase, amino-terminal domain ...    160   2e-45   
ref|XP_008382671.1|  PREDICTED: glutathione transferase GST 23-like     160   2e-45   
ref|XP_010693980.1|  PREDICTED: probable glutathione S-transferase      161   2e-45   
ref|XP_002265084.1|  PREDICTED: glutathione transferase GST 23          160   2e-45   
ref|XP_011460877.1|  PREDICTED: glutathione S-transferase U19-like      160   2e-45   
ref|XP_006373901.1|  hypothetical protein POPTR_0016s10120g             158   2e-45   
ref|XP_006293402.1|  hypothetical protein CARUB_v10024637mg             160   2e-45   
gb|KHG11258.1|  putative glutathione S-transferase                      160   2e-45   
ref|XP_004971272.1|  PREDICTED: probable glutathione S-transferas...    160   2e-45   
ref|XP_003591644.1|  hypothetical protein MTR_1g090150                  160   2e-45   
gb|KJB28263.1|  hypothetical protein B456_005G038700                    160   3e-45   
ref|XP_004983843.1|  PREDICTED: probable glutathione S-transferas...    160   3e-45   
gb|ABW74586.1|  glutathione-S-transferase                               160   3e-45   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                160   3e-45   
gb|AFK36747.1|  unknown                                                 160   3e-45   
ref|XP_008812235.1|  PREDICTED: glutathione transferase GST 23-like     161   3e-45   
ref|XP_010469954.1|  PREDICTED: glutathione S-transferase U5            160   3e-45   
ref|XP_011077664.1|  PREDICTED: probable glutathione S-transferase      161   3e-45   
gb|EYU40236.1|  hypothetical protein MIMGU_mgv1a020023mg                160   3e-45   
gb|AFK44026.1|  unknown                                                 160   3e-45   
ref|XP_002520475.1|  glutathione s-transferase, putative                160   3e-45   
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      160   4e-45   
ref|XP_004983860.1|  PREDICTED: probable glutathione S-transferas...    160   4e-45   
ref|XP_004134026.1|  PREDICTED: glutathione transferase GST 23-like     160   4e-45   
ref|XP_007200430.1|  hypothetical protein PRUPE_ppa011142mg             160   4e-45   
ref|XP_004157654.1|  PREDICTED: glutathione transferase GST 23-like     160   4e-45   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                     159   4e-45   
ref|XP_003632028.2|  PREDICTED: glutathione transferase GST 23-like     159   4e-45   
ref|XP_008382670.1|  PREDICTED: glutathione transferase GST 23-like     160   5e-45   
ref|XP_008235548.1|  PREDICTED: probable glutathione S-transferase      159   5e-45   
ref|XP_002520480.1|  glutathione s-transferase, putative                159   5e-45   
ref|NP_180505.1|  glutathione S-transferase tau 6                       159   5e-45   
ref|XP_010264127.1|  PREDICTED: uncharacterized protein LOC104602212    165   5e-45   
ref|XP_004983859.1|  PREDICTED: probable glutathione S-transferas...    160   5e-45   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       159   5e-45   
emb|CBI18225.3|  unnamed protein product                                161   6e-45   
ref|XP_008372418.1|  PREDICTED: probable glutathione S-transferase      159   6e-45   
gb|AFK34023.1|  unknown                                                 157   6e-45   
ref|XP_009768031.1|  PREDICTED: probable glutathione S-transferase      159   6e-45   
gb|ADE76765.1|  unknown                                                 160   6e-45   
gb|KJB80734.1|  hypothetical protein B456_013G112700                    159   7e-45   
ref|XP_007034526.1|  Glutathione S-transferase tau 7                    159   7e-45   
gb|ABW74574.1|  putative gluthiathiones S-transferase 40                159   8e-45   
emb|CBI16039.3|  unnamed protein product                                161   8e-45   
ref|XP_006829814.1|  hypothetical protein AMTR_s00119p00077600          159   9e-45   
ref|XP_007201513.1|  hypothetical protein PRUPE_ppa015182mg             159   9e-45   
ref|XP_006849236.1|  hypothetical protein AMTR_s00027p00235060          159   9e-45   
ref|XP_006344661.1|  PREDICTED: glutathione S-transferase U8-like       159   9e-45   
ref|XP_008438430.1|  PREDICTED: probable glutathione S-transferase      159   1e-44   
ref|XP_010023536.1|  PREDICTED: glutathione transferase GST 23-like     159   1e-44   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                159   1e-44   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       159   1e-44   
ref|XP_009133847.1|  PREDICTED: glutathione S-transferase U5            159   1e-44   
gb|KJB42412.1|  hypothetical protein B456_007G151400                    159   1e-44   
ref|XP_002518185.1|  glutathione s-transferase, putative                159   1e-44   
emb|CBI38197.3|  unnamed protein product                                160   1e-44   
ref|XP_002315607.2|  hypothetical protein POPTR_0010s07100g             159   1e-44   
ref|XP_010469955.1|  PREDICTED: glutathione S-transferase U7-like       159   1e-44   
gb|ACU16110.1|  unknown                                                 157   1e-44   
ref|XP_010039179.1|  PREDICTED: glutathione S-transferase U8-like       158   1e-44   
ref|XP_010039176.1|  PREDICTED: probable glutathione S-transferase      158   1e-44   
ref|XP_010510491.1|  PREDICTED: glutathione S-transferase U5-like       158   1e-44   
ref|XP_004983846.1|  PREDICTED: probable glutathione S-transferas...    159   1e-44   



>emb|CDO99237.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M   +G+K++GFWVSP+VLRVKWAL++KG+EYEYIEED+FNK+PLL +LNPV  +VPVLV
Sbjct  1    MEENQGVKLLGFWVSPYVLRVKWALKLKGIEYEYIEEDVFNKSPLLLKLNPVKGQVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H+GKP+PES++ILEYIDE WKH+PLLP DPYERA +RFWA FA  K+   AWEALCS+G+
Sbjct  61   HDGKPIPESIVILEYIDEVWKHSPLLPQDPYERANSRFWAKFAAEKLQAYAWEALCSRGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              E A+N++MEA+EK+E ELNGK+FFGG+KIG++DLV G++++ LP++EE+ S+
Sbjct  121  DHERAINASMEALEKMEKELNGKKFFGGDKIGFVDLVAGFISYQLPVYEEIVSM  174



>ref|XP_007035120.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY06046.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=248

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 150/177 (85%), Gaps = 2/177 (1%)
 Frame = +3

Query  36   VIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPV  215
            ++MA +E +K++GFWVSPFV RV+WAL++KG++YEYIEEDIFNK+ LL +LNPV  KVPV
Sbjct  21   ILMATKE-VKLLGFWVSPFVFRVEWALKIKGVKYEYIEEDIFNKSTLLMELNPVRKKVPV  79

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVH+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL+ AW ALCS+
Sbjct  80   LVHDGKVIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILEGAWNALCSQ  139

Query  396  GKQQESAVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            G++++ A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S+
Sbjct  140  GEEKQKALRQTIEAMEKIEGELEGKQQFFGGESVGYLDIILGWISYWLPVWEEVGSM  196



>gb|KDP40336.1| hypothetical protein JCGZ_02334 [Jatropha curcas]
Length=230

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++G WVSPFV RV+WAL++KG++YEYIEEDIFNK+PLL QLNPV+ KVPVLV
Sbjct  1    MAKKEEVKLLGLWVSPFVRRVEWALKLKGVDYEYIEEDIFNKSPLLLQLNPVNKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H  K + ES +ILEYIDETWKHN PLLP DPY+RA+ARFWA FAE KI + AW ALCS G
Sbjct  61   HGNKVIAESFVILEYIDETWKHNYPLLPQDPYQRAKARFWAKFAEEKIFEAAWNALCSLG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             ++E A+   +EA+EKLE EL GKQFFGGE IGY+D++ GW+++ LP++EEV S+
Sbjct  121  DEKERAIKMTIEALEKLEGELEGKQFFGGENIGYVDILAGWISYWLPVWEEVGSM  175



>ref|XP_007035121.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
 gb|EOY06047.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
Length=241

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++GFWVSP V RVKWAL +KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MATEE-VKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL  AW ALCS+G+
Sbjct  60   HDGKAIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGE  119

Query  402  QQESAVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +++ A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S+
Sbjct  120  EKQKALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSM  174



>ref|XP_007035122.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
 gb|EOY06048.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
Length=222

 Score =   221 bits (563),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFWVSP V RVKWAL +KG++YEYIEEDIFNK+ LL +LNPVH KVPVLVH+GK
Sbjct  1    EEVKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLVHDGK  60

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL  AW ALCS+G++++ 
Sbjct  61   AIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGEEKQK  120

Query  414  AVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S+
Sbjct  121  ALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSM  171



>gb|KEH20685.1| glutathione S-transferase [Medicago truncatula]
Length=224

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+ AW A+C+ G++Q
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ LP+FEEV S+
Sbjct  122  EKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWLPVFEEVGSM  173



>emb|CDP08010.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M    G+K++GFWVSPF  RVKWAL++KG++YEYIEEDI+NK+PLLS+LNPV+  VPVLV
Sbjct  1    MEETGGVKLLGFWVSPFAQRVKWALKLKGVQYEYIEEDIYNKSPLLSKLNPVYGMVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+ARFWA FAE K+    WEA+CS G+
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQARFWAKFAEEKVRQSVWEAMCSSGE  120

Query  402  QQESAVNSamea--mekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +++ AV SA+EA    + E +  G +FFGGE IG++D+V G +++ L + EEV S+
Sbjct  121  EKQKAVKSAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLAVHEEVGSI  176



>gb|ACJ83863.1| unknown [Medicago truncatula]
 gb|AFK45626.1| unknown [Medicago truncatula]
Length=224

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+ AW A+C+ G+++
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ LP+FEEV S+
Sbjct  122  EKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWLPVFEEVGSM  173



>ref|XP_006378334.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
 gb|ADB11376.1| tau class glutathione transferase GSTU52 [Populus trichocarpa]
 gb|ERP56131.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
Length=229

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  E +K++GFW SPF  RV+WAL++KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MANTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSSLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  K + ES +ILE+IDETWK  PL+P DPYERA+ RFWA FAE KILD AW A+CS G+
Sbjct  61   HGRKVIAESFVILEFIDETWKQCPLMPQDPYERAKTRFWAKFAEEKILDGAWIAMCSLGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++E A+  A+EA+EK+E EL GK FFGGE IGYLD+ +GW+++ LP++EEV S+
Sbjct  121  EKEKAIKLAVEAIEKIEGELKGKHFFGGENIGYLDIAMGWMSYWLPVWEEVGSM  174



>ref|XP_011030495.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=229

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA+ E +K++GFW SPF  RV+WAL++KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MASTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSTLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
               K + ES +ILE+IDETWK  PL+P DPYERA  RFWA FAE KILD AW A+CS G+
Sbjct  61   RGRKVIAESFVILEFIDETWKQCPLMPQDPYERAMTRFWAKFAEEKILDAAWIAMCSLGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++E A+  A+EAMEK+E EL GKQFFGGE IGYLD+ +GW+++ LP++EEV S+
Sbjct  121  EKEKALKLAVEAMEKIEGELKGKQFFGGENIGYLDIAMGWMSYWLPVWEEVGSM  174



>ref|XP_011091312.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=231

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            E  +K+VGFWVSPFV RV+WAL++KG+EYEYIEEDIFNK+PLLS+LNP++ KVPVLVH+G
Sbjct  6    ESSVKLVGFWVSPFVHRVRWALKLKGVEYEYIEEDIFNKSPLLSELNPLYKKVPVLVHDG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KPL +S +ILEY+D+ W+ NPL P DPY+RA+A  WA FA+ K+L+ AW ALCS+GK QE
Sbjct  66   KPLSDSSIILEYVDQKWRSNPLFPDDPYQRAQAHLWARFADEKVLESAWLALCSEGKTQE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             AV  A+E +E +E +L GK+FFGG+ IG++DL++G++++ LP++EEV  +
Sbjct  126  RAVKQAIENLEHVEEKLKGKRFFGGDIIGHVDLMMGFISYMLPVWEEVGGV  176



>emb|CDO99236.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  66   MVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++GFW SPFV RVKWAL++KG+EYEYIEED+F+K+ LL +LNPV   VPVLVHN KP+ E
Sbjct  8    LLGFWASPFVQRVKWALKLKGVEYEYIEEDLFDKSSLLLKLNPVQKLVPVLVHNRKPISE  67

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNS  425
            S+LILEYIDE WK NPLLP DPYERA+ARFWA FAE K+ +  W+ALCS+G+++E AV S
Sbjct  68   SILILEYIDEVWKQNPLLPHDPYERAQARFWAKFAEEKVRESTWDALCSRGEEREKAVKS  127

Query  426  ameamek--leaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++EA+EK   E +L G +FFGGE IG++DLV G++++ LP+FEEV S+
Sbjct  128  SIEALEKFEEELKLKGTKFFGGETIGFVDLVAGFISYQLPVFEEVGSM  175



>ref|XP_007159485.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
 gb|ESW31479.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
Length=228

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K+V FWVSPF +RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVL+
Sbjct  1    MGSEE-VKVVSFWVSPFGIRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLL  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +IL+YIDE WKH PLLP  PY+RA   FWA F + K+LDP+W A+CS G 
Sbjct  60   HAHKPIAESFIILQYIDEIWKHYPLLPQHPYQRALVHFWANFGDQKLLDPSWIAMCSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             QE+A+  A E+MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ LP++EEV S+
Sbjct  120  DQENALKVARESMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWLPVWEEVGSM  173



>ref|XP_010069125.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57370.1| hypothetical protein EUGRSUZ_H00155 [Eucalyptus grandis]
Length=226

 Score =   211 bits (536),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L  AW ALCS+G+
Sbjct  61   HGGRVICESFLILEYIDETWKQSPLLPQDPYDRATARFWASVAEGQLLRNAWIALCSEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++E A+  A EA+  +E  + GK FFGGE IGYLDL +GWV H LP+++E+ S+
Sbjct  121  EKERAIEFATEALGHIEGVIEGKAFFGGEGIGYLDLAIGWVCHWLPVWDELGSM  174



>ref|XP_003629836.1| Receptor-like protein kinase [Medicago truncatula]
Length=869

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 152/189 (80%), Gaps = 5/189 (3%)
 Frame = +3

Query  9    EEQDRNITVV----IMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPL  176
            E +DR   +V    IM +++ +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPL
Sbjct  631  ERRDRGNKLVQQYNIMGSQD-VKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPL  689

Query  177  LSQLNPVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEF  356
            L +LNPVH KVPVLVH  KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE 
Sbjct  690  LLELNPVHKKVPVLVHAQKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQ  749

Query  357  KILDPAWEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNL  536
            K+L+ AW A+C+ G++QE A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ L
Sbjct  750  KLLNAAWIAMCNSGEEQEKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWL  809

Query  537  PIFEEVASL  563
            P+FEEV S+
Sbjct  810  PVFEEVGSM  818



>ref|XP_010069124.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57369.1| hypothetical protein EUGRSUZ_H00154 [Eucalyptus grandis]
Length=226

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H G+ + ES LILEYIDETWK  PLLP DPY+RA ARFWA  AE ++L  AW A CS+G+
Sbjct  61   HAGRVVCESFLILEYIDETWKQIPLLPRDPYDRAMARFWASVAEGQLLANAWVASCSEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +QE A+  A EA+  +E  + GK FFGGE IGYLDL +GWVA+ LPI++EV S+
Sbjct  121  EQERAIKVATEALGHIEGVIKGKAFFGGEGIGYLDLAIGWVAYWLPIWDEVGSM  174



>ref|XP_010025836.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=292

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  45   AAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVH  224
            A  E +K++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNP H KVPVLVH
Sbjct  68   ANPEEVKLLGLWVSPFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVH  127

Query  225  NGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
             G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L  AW AL S+G++
Sbjct  128  GGRVICESFLILEYIDETWKQSPLLPQDPYDRAMARFWASVAEGQLLKNAWIALISEGEE  187

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +E A+  A E +   E  + GK FFGGE IGYLDL +GW++H+LP+++EV S+
Sbjct  188  KERAIEFATEVLGHFEGVIEGKAFFGGEGIGYLDLAIGWISHSLPVYDEVGSM  240



>emb|CDP08048.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M    G+K+ GFWVSPF  RVKWAL++KG++YEYIEED +NK+PLL +LNPV+ KVPVLV
Sbjct  1    MEEAGGVKLFGFWVSPFAQRVKWALKLKGIQYEYIEEDKYNKSPLLLKLNPVYGKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+A FWA FAE K+     EA+CS G 
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQAHFWAKFAEEKVRQSVVEAMCSSGD  120

Query  402  QQESAVN--SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +++ AV          + E +  G +FFGGE IG++D+V G +++ LP+ EEV SL
Sbjct  121  EKQKAVKLAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLPVHEEVGSL  176



>ref|XP_002285214.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+ + AW ALCS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLFESAWMALCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A   AMEA+EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  +
Sbjct  122  ERAAKLAMEAVEKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCM  173



>ref|XP_003632015.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=227

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDIFNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+ AW  +CS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A   A+EA+ K+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  +
Sbjct  122  ERAAKLAIEAVAKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCM  173



>ref|XP_006420238.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
 gb|ESR33478.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
Length=236

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = +3

Query  36   VIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPV  215
            +IMA +  +K++GFW SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPV
Sbjct  1    MIMATK--VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPV  58

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVH+ K + ESL+ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++  AW++ C+K
Sbjct  59   LVHDDKVIVESLVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTCTK  118

Query  396  GKQQESAVNSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASL  563
            G+++E A+ + ME +EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS+
Sbjct  119  GEEKEDALKATMEVLEKIEGELKGKSYFGGENKYAYLEIAIGWINYLIPIWEEIASI  175



>emb|CAN63628.1| hypothetical protein VITISV_018696 [Vitis vinifera]
Length=227

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDIFNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+ AW  +CS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A   A+EA+EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  +
Sbjct  122  ERAAKLAIEAVEKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCM  173



>ref|XP_002285220.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP +PYERA ARFWA FAE K+++ AW   CS+G+++
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQNPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A N AME +EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  +
Sbjct  122  ERAANLAMETVEKIEELVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCM  173



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G  +S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K L  AWEA  ++G+++E 
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEEKEK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ SA+E+   LE  + GK+FFGGEK+G+LDLVVGW+ H L + EEV  +
Sbjct  123  AMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGM  172



>gb|AEC32486.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN06426.1| Putative glutathione S-transferase [Glycine soja]
Length=224

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPQDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S+
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>ref|XP_003524975.2| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|AJE59657.1| tau class glutathione S-transferase [Glycine max]
Length=224

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S+
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>ref|XP_008224351.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 134/172 (78%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDIFNK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQ  404
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD A+ AL CS G+Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAAFTALICSTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            QE A+ S +EA+E +E +L GK+  GGE IGYLD+ +GW+++ LPI+EEV S
Sbjct  122  QEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGS  173



>gb|ACU14737.1| unknown [Glycine max]
Length=244

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S+
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G   S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSIKSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K +  AWEA  ++G+++E 
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCMFGAWEAFKAEGEEKEK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ SA+E+   LE  + GK+FFGGEK+G+LDLVVGW+ H L + EEV  +
Sbjct  123  AMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGM  172



>gb|AJE59670.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIF K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D AW A+C+ G 
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             Q++AV    E MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ +P++EEV S+
Sbjct  120  DQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWIPVWEEVGSM  173



>ref|XP_002285212.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+++ AW   CS+G+++
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A   AME +EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  +
Sbjct  122  ERAAKLAMETVEKIEELVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCM  173



>ref|XP_007226113.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
 gb|EMJ27312.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
Length=224

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDIFNK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQ  404
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD  + AL CS G+Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAGFTALICSTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            QE A+ S +EA+E +E +L GK+  GGE IGYLD+ +GW+++ LPI+EEV S
Sbjct  122  QEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGS  173



>gb|AAG34804.1|AF243369_1 glutathione S-transferase GST 14, partial [Glycine max]
Length=219

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLVH  KP+
Sbjct  1    VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLVHAHKPI  60

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G +Q++AV
Sbjct  61   AESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGDEQQNAV  120

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S+
Sbjct  121  KVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  168



>gb|KHN48021.1| Putative glutathione S-transferase [Glycine soja]
Length=285

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIF K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D AW A+C+ G 
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             Q++AV    E MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ +P++EEV S+
Sbjct  120  DQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWIPVWEEVGSM  173



>gb|AFK41941.1| unknown [Lotus japonicus]
Length=228

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            + +K++  W SPF  RV+WAL++KG+EYEY+EEDIFNK+ LL +LNPVH K+PVLVH  K
Sbjct  4    QDVKLLSSWPSPFSERVEWALKLKGVEYEYVEEDIFNKSSLLLELNPVHKKIPVLVHGHK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ES +I+EYIDETWK  PLLP DPYERA ARFWA F E K+L+  + A+C  G +QE 
Sbjct  64   TIAESFIIIEYIDETWKQYPLLPHDPYERALARFWANFTEQKLLETVFVAMCITGDEQEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+N A EAMEK+E  + GK+FFGGE IGYLD+ VGW+++ + I+EEV S+
Sbjct  124  ALNEAREAMEKIEEVIEGKRFFGGENIGYLDIAVGWISYWIHIWEEVGSI  173



>ref|NP_001234957.1| glutathione S-transferase GST 17 [Glycine max]
 gb|AAG34807.1|AF243372_1 glutathione S-transferase GST 17 [Glycine max]
 gb|AJE59656.1| tau class glutathione S-transferase [Glycine max]
Length=229

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +QE AV  A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S+
Sbjct  121  EQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSM  174



>gb|ACU20120.1| unknown [Glycine max]
Length=229

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +QE AV  A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S+
Sbjct  121  EQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSM  174



>gb|KHN48020.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59669.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+    W A+ + G +Q
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+  A E MEK+E E+ GK FFGG+ IGYLD+ +GW+A+ +P++EEV S+
Sbjct  122  EEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIGWIAYLVPVWEEVGSM  173



>gb|KHN06425.1| Putative glutathione S-transferase [Glycine soja]
Length=228

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLVH  KP+
Sbjct  6    VKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G++QE AV
Sbjct  66   AESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGEEQEKAV  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S+
Sbjct  126  KEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSM  173



>ref|XP_006484731.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=225

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEV  169



>ref|XP_008232144.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=223

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVSYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  ++GK QE A+
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKVLPSIWESFTNEGKGQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E +  LE EL GK+FFGGEK+G  D+ +GW+AH   +FE+VA +
Sbjct  124  VKAKENLNYLEEELKGKKFFGGEKLGLADIALGWLAHYESVFEDVAGM  171



>gb|AFF18814.1| glutathione transferase, partial [Dimocarpus longan]
Length=216

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +3

Query  63   KMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLP  242
            +++GFW SPFV RVKWAL +KG++YEYIEEDIFNK+  L +LNPVH KVPV VH  + + 
Sbjct  1    QLLGFWASPFVFRVKWALELKGIDYEYIEEDIFNKSSRLLELNPVHKKVPVFVHEHRVIS  60

Query  243  ESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVN  422
            ES +ILEYIDETW+ NPLLP DPY+RA ARFWA FAE K+L+PAW A+ SKG+++E A  
Sbjct  61   ESFVILEYIDETWRQNPLLPQDPYQRAMARFWAKFAEEKLLEPAWMAMWSKGEEKEKAKK  120

Query  423  SameamekleaelNGKQFFGG--EKIGYLDLVVGWVAHNLPIFEEVASL  563
              +EA+EK+E +L G Q+FGG  +KIGYLD+ +GW+++ LP++EEV SL
Sbjct  121  QTIEALEKIEEQLKGTQYFGGDDDKIGYLDVAIGWISYWLPVWEEVGSL  169



>ref|XP_006489726.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++  AW++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASL  563
             +  E +EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS+
Sbjct  125  KATKEVLEKIEGELKGKSYFGGENKYAYLEVAIGWINYLIPIWEEIASI  173



>gb|KCW57371.1| hypothetical protein EUGRSUZ_H00157, partial [Eucalyptus grandis]
Length=211

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  87   PFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEY  266
            PFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNP H KVPVLVH G+ + ES LILEY
Sbjct  1    PFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVHGGRVICESFLILEY  60

Query  267  IDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamek  446
            IDETWK +PLLP DPY+RA ARFWA  AE ++L  AW AL S+G+++E A+  A E +  
Sbjct  61   IDETWKQSPLLPQDPYDRAMARFWASVAEGQLLKNAWIALISEGEEKERAIEFATEVLGH  120

Query  447  leaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             E  + GK FFGGE IGYLDL +GW++H+LP+++EV S+
Sbjct  121  FEGVIEGKAFFGGEGIGYLDLAIGWISHSLPVYDEVGSM  159



>ref|XP_006437360.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
 gb|ESR50600.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
Length=225

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++++ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFVDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEV  169



>gb|AFF18816.1| glutathione transferase, partial [Dimocarpus longan]
Length=224

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++KG+EY+ I ED+ NK+PLL Q NP++ KVPVL+HNGK
Sbjct  3    EKVKLFNTWSSRFGLRIVWALKLKGVEYDSINEDLSNKSPLLLQYNPIYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P  ESL+ILEYIDETWKHNPLLP DPYE+A ARFWA F + K++   W A  ++GK+QE 
Sbjct  63   PTSESLVILEYIDETWKHNPLLPEDPYEKATARFWAKFGDDKVMSSIWSAFTNEGKEQED  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A+  A+E +  LE +L GK+FFGGEKIG  DL +GW+A+ + +FEE+
Sbjct  123  AIGQAIENLNFLEEQLKGKKFFGGEKIGLTDLALGWLANLVRVFEEI  169



>ref|XP_006433894.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
 gb|ESR47134.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
Length=222

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPEDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A +
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGV  172



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+VG   S F  R++WAL+++G+EYEY++ED+ NK+PLL + NPVH KVPV +HNG+P+
Sbjct  4    VKVVGSSPSLFCYRIEWALKLQGIEYEYLKEDLRNKSPLLLKYNPVHKKVPVFLHNGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK+NPLLP DP+ERA ARFWA F + K L  AW ALC++G ++E AV
Sbjct  64   AESLVILEYIDETWKNNPLLPEDPHERALARFWAKFGDEKCLMGAWAALCAEGPEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +AME +  LE ++ GK+FFGG+ IG+LDLV+GW+ H L + +EV  +
Sbjct  124  ETAMETLNYLEKQIEGKKFFGGKTIGFLDLVIGWIPHWLDVLDEVGGM  171



>gb|KDO81087.1| hypothetical protein CISIN_1g027498mg [Citrus sinensis]
Length=222

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A +
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGV  172



>gb|KDO46806.1| hypothetical protein CISIN_1g027333mg [Citrus sinensis]
Length=225

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F + K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGDDKVLASIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLPDLALGWLANLIGVFEEV  169



>ref|XP_010938159.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A+  +K++G W SPFVLR+KWAL+MKG+EY++IEED+ NK+PLL + NPVH KVPVLVH 
Sbjct  2    AKAEVKLLGTWSSPFVLRIKWALKMKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHE  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEY+DETWK NP+LP DPY+RA ARFW+ F E K L   W    S+G+  
Sbjct  62   GKPIAESLVILEYMDETWKENPILPEDPYQRAMARFWSKFGEEKCLPSIWRVFISQGENT  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+ SA E ++ LE EL GK+FF GE +G+ D+ +GW+ + + + EE+  L
Sbjct  122  EEALVSASENLKILEGELKGKKFFNGETLGFADISLGWIVNMVILLEEIMEL  173



>ref|XP_002523996.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38364.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LR+ WAL++K + Y+ I+ED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLKTWSSIFGLRIVWALKLKAINYDSIDEDLTNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETW+ NPLLP DP++RA ARFWA F + K++   W  L  +GK+QE 
Sbjct  63   PIVESLVILEYIDETWQQNPLLPQDPHDRAEARFWAKFGDDKVIPSMWAILTKEGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            A     E ++ LE EL GK+FFGGE+IGYLD+ +GW+A+++P+ EE++
Sbjct  123  ASAQTNENLKFLEEELKGKKFFGGEQIGYLDIALGWLANSVPVLEEIS  170



>ref|XP_006472526.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=222

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA AR WA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARLWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A +
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGV  172



>gb|AJE59654.1| tau class glutathione S-transferase [Glycine max]
Length=217

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +GW+++ LP+ EEV S+
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGWISYWLPVVEEVGSM  174



>ref|XP_010067033.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW65099.1| hypothetical protein EUGRSUZ_G02604 [Eucalyptus grandis]
Length=224

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+     SPF LRV WALR+KG++YE + ED+  K+ LL Q NPV+ KVPVL+HNG+
Sbjct  3    EEVKLFKTLSSPFALRVDWALRLKGIQYESVLEDLSEKSDLLLQYNPVYKKVPVLLHNGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESL+ILEYI+ETWK +PLLP DPY RARARFWA F + K+L   W A  S+GK+QE+
Sbjct  63   SISESLIILEYIEETWKQDPLLPQDPYARARARFWAKFGDDKVLPSLWTAFISEGKEQEA  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A E ++KLE ELNGK+FFGG+ IGYLD+ +GW+A+ + +FEE++SL
Sbjct  123  ALAEASENLQKLEGELNGKKFFGGDNIGYLDIALGWLANLITVFEEISSL  172



>ref|XP_006437359.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
 gb|ESR50599.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
Length=221

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLTTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETW+ NPLLP  PY+RARARFWA F++ K+    W     +GK++E 
Sbjct  63   PISESLVILEYVDETWRQNPLLPDGPYDRARARFWAKFSDDKVSPSIWGVFIKQGKEREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A +   E ++ LE EL GK+FFGGEKIG+ DL +GW+A  + + EE+
Sbjct  123  AFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEI  169



>ref|XP_004307164.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469436.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=223

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++K ++Y+ I ED+ NK+PLL Q NPVH KVPVLVHNGK +
Sbjct  4    VKLFRTWSSPFALRIVWALKLKDVQYDTIFEDLSNKSPLLLQYNPVHKKVPVLVHNGKSV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYI+ETWKHNPLL  DP+ERA ARFWA F + K+L   WEA  S+G++QE  +
Sbjct  64   AESFVILEYIEETWKHNPLLSEDPHERAAARFWAKFGDEKVLTSIWEAFISEGEKQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE ELNGK+FFGGE+IG+ D+ +GW+   + +FEEV S+
Sbjct  124  VKAKENLKYLEGELNGKKFFGGEQIGFADIALGWLTEYVDVFEEVTSM  171



>ref|XP_002264117.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L    W     +GK+QE
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + IFEEVA L
Sbjct  123  EAMLEAMEHLQFLEDELKGKRFFGGERIGFVDLALGWLANMISIFEEVAGL  173



>emb|CAN72240.1| hypothetical protein VITISV_010777 [Vitis vinifera]
Length=225

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L    W     +GK+QE
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + IFEEVA L
Sbjct  123  EAMLEAMEHLQFLEDELKGKRFFGGERIGFVDLALGWLANMISIFEEVAGL  173



>ref|XP_006489727.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   193 bits (490),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGVWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++   W++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTVWKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASL  563
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS+
Sbjct  125  KATMEALEKIEGELKGKSYFGGENKYAYLEVAIGWINYLIPIWEEIASI  173



>ref|XP_008793319.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE  +K++G W SPFVLR+KWAL++KG+EY++IEED+ NK+PLL + NPVH KVPVLVH+
Sbjct  2    AEAEVKLLGTWSSPFVLRIKWALKLKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GK + ES +ILEYIDETWK NP+LP DPY+RA ARFW+ F + K L   W+   S+G+++
Sbjct  62   GKSIAESYVILEYIDETWKENPILPEDPYQRAMARFWSKFGDEKFLPSMWKFFISQGEKR  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+ SA E ++ LE EL GK+FF GE +G+ D+ +GW+   + + EE+  L
Sbjct  122  EEALVSASENLKILEGELKGKKFFNGETLGFADISLGWIVDMVSLLEEIMEL  173



>ref|XP_007218360.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
 gb|EMJ19559.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
Length=223

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K +   WE+  ++GK+QE A+
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKAVPSIWESFTNEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G  D+ +G +AH   +FEEVA +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGLADIALGLLAHYESVFEEVAGM  171



>ref|XP_006420237.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33477.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=234

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPFV RV WAL++KG+E+EYIEED+FNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K++  A ++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEKLMQTACKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASL  563
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + LPI+EE+AS+
Sbjct  125  KATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWINYLLPIWEEIASI  173



>ref|XP_002532523.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29857.1| glutathione s-transferase, putative [Ricinus communis]
Length=227

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  R++WAL++KG++YE ++ED+ NK+P+L + NPVH KVPVLVH   P+
Sbjct  6    VKLIGSETSVFCTRIEWALKLKGVDYENLKEDLMNKSPILLKYNPVHKKVPVLVHGENPV  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWKHNPLLP DPYERA ARFWA FA+ K L   ++A   +G+Q+E+A+
Sbjct  66   AESLVILEYIDETWKHNPLLPQDPYERAMARFWAKFADEKCLYGMFDACWQEGEQKENAI  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SAME++  LE ++ GK+FF GEKIGYLD+V+GW+ H L + EEV ++
Sbjct  126  ASAMESLAFLEEQIKGKKFFNGEKIGYLDIVIGWIPHWLNVMEEVGAM  173



>emb|CAN78656.1| hypothetical protein VITISV_006850 [Vitis vinifera]
Length=228

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 125/170 (74%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR  WAL++KG++YE I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPLLLQYNPVFKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWKH PLLP DP+ERA ARFWA F E K+L   W     +GK+QE 
Sbjct  63   PIAESLVILEYIDETWKHAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A+E ++ LE EL GK+FFGGE IG++DL +GW+ + + I EE+  L
Sbjct  123  AMVPALENLKFLEEELKGKKFFGGETIGFVDLALGWLGNLISILEEIVGL  172



>ref|XP_006489728.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=227

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F + K+L+ A++A+ SKG++++ A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
              A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE  
Sbjct  125  KEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAG  170



>ref|XP_002460369.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
 gb|EER96890.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
Length=222

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K++G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            G P+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GNPIAESTIIVEYIDEAWKGGYPIMPADPYERAQARFWARFAEEKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            Q  AV  A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV
Sbjct  122  QRKAVQEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWYAHWLPVMEEV  171



>ref|XP_010922854.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=224

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFVL VKWALR+KG+EYEYIEED+ NK+ LL + NPVH KVPV+VHNGKP+
Sbjct  6    VKLFGIWSSPFVLIVKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVMVHNGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYI+ETWK+NP+LP DPYERA ARFW  F   K+  P W    S+GK+QE A 
Sbjct  66   AESAVILEYIEETWKNNPILPDDPYERAMARFWCKFVVDKLSPPIWRLFISQGKEQEEAY  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A+E ++ LE EL GK FF GE IG  D+ +G +A+ +PI+EE+  L
Sbjct  126  ALAIENLKILEQELQGKMFFCGETIGLADISIGPLAYVMPIYEEITKL  173



>gb|KDP39591.1| hypothetical protein JCGZ_02611 [Jatropha curcas]
Length=217

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K++  W SPF LR+ WAL++KG++Y+ I+ED+ NK+PLL Q NPVH K+PV V
Sbjct  1    MAGE--VKLLKSWSSPFALRIVWALKLKGIQYDSIDEDMTNKSPLLLQYNPVHKKIPVFV  58

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES +ILEYIDE WKH PLLP DP++RA ARF A F + K++   W    +KGK
Sbjct  59   HNGKPIAESFVILEYIDEMWKHYPLLPQDPHKRATARFLAKFGDEKVMKSLWAISITKGK  118

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +QE A   A E ++ LE  L GK+FFGGEKIG+LD+ +GW+A+ +P+ EE+   
Sbjct  119  EQEEASAKATENLKYLEEALTGKRFFGGEKIGFLDIALGWLANVVPVVEEIVGF  172



>ref|XP_007220010.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
 gb|EMJ21209.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
Length=224

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  S GK+QE A+
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTSDGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVA-HNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A +   +FE+V  +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGFVDIALGWLAQYESSVFEDVTGM  172



>ref|NP_001104994.1| glutathione transferase GST 23 [Zea mays]
 sp|Q9FQA3.1|GST23_MAIZE RecName: Full=Glutathione transferase GST 23; AltName: Full=Glutathione 
transferase GST 36 [Zea mays]
 gb|AAG34844.1|AF244701_1 glutathione S-transferase GST 36 [Zea mays]
 gb|ACF85476.1| unknown [Zea mays]
 gb|ACG35906.1| glutathione S-transferase [Zea mays]
 tpg|DAA61852.1| TPA: glutathione S-transferase GST 23 [Zea mays]
Length=222

 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K++G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            Q  AV+ A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV  
Sbjct  122  QRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTG  173



>ref|XP_003629835.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AET04311.1| glutathione S-transferase [Medicago truncatula]
 gb|AFK38611.1| unknown [Medicago truncatula]
Length=225

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 130/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M   + +K++ F +SP   RV+WAL++KG+E++YIEEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MMGNQDVKLLNFLLSPVGRRVEWALKLKGVEFDYIEEDIFNKSSLLLEMNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  K + ESL+ILEYIDETWK  PLLP DPY+R+RARFWA  ++ K+   +W AL  KG 
Sbjct  61   HGQKSIAESLIILEYIDETWKQYPLLPPDPYQRSRARFWAKLSDEKLALGSWIALIKKGN  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            + E A+  A E MEKLE ++ GK+FFGG+ IGYLDL +GW+   LPI+EE+ S
Sbjct  121  EWEKALKEAREIMEKLEEDIKGKKFFGGDTIGYLDLTLGWITCFLPIWEEIGS  173



>ref|XP_004299557.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+V    S F  RV+WAL++KG+EYE+IEED+ NK+P+L + NPVH KVPVLVH+  P
Sbjct  3    GVKLVATTQSFFCTRVQWALKLKGVEYEFIEEDLRNKSPVLLKYNPVHKKVPVLVHHDTP  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDETWK NPLLP DP++RA ARFWA FA+ K++   W A  ++G+ +E A
Sbjct  63   IVESLVILEYIDETWKENPLLPQDPFDRAAARFWAKFADEKVVFGVWTACTAEGEGKEKA  122

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            + +A+E++  LE ++ GK+FFGGE+IGYLDLV+GW+ H L   EEV  +
Sbjct  123  IEAALESLAHLEKQIEGKKFFGGEQIGYLDLVLGWIPHWLNTVEEVGGM  171



>tpg|DAA61851.1| TPA: hypothetical protein ZEAMMB73_518022, partial [Zea mays]
Length=230

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K++G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            Q  AV+ A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV  
Sbjct  122  QRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTG  173



>ref|XP_004297032.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H  VPVLVHNGK +
Sbjct  4    VKLFRTWSSSFALRIVWALKLKDVPYDTIFEDLSNKSPLLLQHNPIHKLVPVLVHNGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYI+ETWKHNPLLPADP+ RA ARFWA F + K+  P  + LCS+GK+QE A+
Sbjct  64   AESLVILEYIEETWKHNPLLPADPHNRAAARFWAKFGDDKVFPPILDTLCSEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A ++++ LE EL GK+FFGGE+IG+ D+ +GW+AH+  +F EVA++
Sbjct  124  VKAKDSLKYLEEELKGKKFFGGEQIGFADIALGWLAHHENVFAEVANV  171



>gb|KHN06423.1| Putative glutathione S-transferase [Glycine soja]
Length=217

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DP +RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPNQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +GW+++ LP+ EEV S+
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGWISYWLPVVEEVGSM  174



>gb|KDO57583.1| hypothetical protein CISIN_1g046710mg [Citrus sinensis]
Length=227

 Score =   190 bits (483),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES + LEYIDETW  +PLLP DPYE+A ARFWA F + K+L+ A++A+ SKG++++ A+
Sbjct  65   VESFVFLEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
              A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE  
Sbjct  125  KEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAG  170



>ref|XP_006484732.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score =   190 bits (482),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLMTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETW+  PLLP  PY+RARARFWA F++ K+    W     +GK++E 
Sbjct  63   PISESLVILEYVDETWRQYPLLPDGPYDRARARFWAKFSDDKVSPSMWGVFIKQGKEREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            A +   E ++ LE EL GK+FFGGEKIG+ DL +GW+A  + + EE+
Sbjct  123  AFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEI  169



>ref|XP_010521899.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
Length=222

 Score =   190 bits (482),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++G W SPF  R++ AL++KG+ Y+Y+EED+ NK+PLL QLNPVH K+PV V
Sbjct  1    MAEEEEVKLLGLWSSPFSCRIEMALKLKGVPYKYLEEDLENKSPLLLQLNPVHKKIPVFV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+IL+YIDETWKHNP+LP DPYERA ARFWA F + ++L    + +   G+
Sbjct  61   HNGKPIAESLVILDYIDETWKHNPILPQDPYERAMARFWARFIDEQVLLTGLKIVAQTGR  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVA  527
            ++E+AV +  + ++ LE EL GK FFGGE  GYLD+V   VA
Sbjct  121  EREAAVEATRDLVKFLEKELKGKDFFGGESFGYLDMVATLVA  162



>ref|XP_004957087.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=222

 Score =   190 bits (482),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK  +P++PADPYERA+ARFWA +AE K     +    + G++
Sbjct  62   GKPIAESTIIVEYIDEAWKGGHPIMPADPYERAQARFWARYAEDKCNAALYPIFTATGEE  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            Q      A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV  +
Sbjct  122  QRKVAQEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVVEEVCGV  174



>ref|XP_009343223.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   189 bits (481),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+L   WE    +GK+QE A+
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVLPSIWEFFTKEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+N  +FEEVA +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYNESLFEEVAGM  171



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK+ G W SPF  RVK AL++KG++YEY EED+ NK+P L + +PVH K+PVLVH+GKP+
Sbjct  6    LKLFGAWFSPFSFRVKLALKLKGIQYEYAEEDLQNKSPELLKYSPVHKKIPVLVHDGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DPYERA  RFW  FAE K ++    AL S+G +QE  V
Sbjct  66   VESLIILEYIDETWKQNPLLPEDPYERAMVRFWVTFAEEKFIEALRRALFSEGTKQEKEV  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                EA+E LE EL GK+FFGGE IG+LD+ + WV   L + EEVAS 
Sbjct  126  KQIAEALEILERELKGKKFFGGETIGFLDIALSWVPAWLGVMEEVASF  173



>ref|XP_004133937.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004155775.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN56630.1| hypothetical protein Csa_3G126940 [Cucumis sativus]
Length=222

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EYE + ED+ NK+PLL + NP+H KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYETVYEDLANKSPLLLEYNPIHKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+   +   ++GK +E
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVRE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              V  AME ++ LE EL GK+FFGGE IG++D+ VGW+A+ + + EEV  L
Sbjct  122  EGVEEAMENLKHLEEELKGKRFFGGEAIGFVDIAVGWLANIVSVMEEVVGL  172



>ref|XP_008232147.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  + GK+QE A+
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTNDGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVA-HNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW++ +   +FE+V  +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGFVDIALGWLSQYESSVFEDVTGM  172



>ref|XP_003532764.1| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|KHN48019.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59668.1| tau class glutathione S-transferase [Glycine max]
Length=226

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = +3

Query  39   IMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            +M ++  +K++ F +SP   RV+WAL++KG+E+EY+EEDIFNK+ LL +LNPVH KVPVL
Sbjct  1    MMGSKNDVKLLSFLLSPVGHRVEWALKLKGVEFEYVEEDIFNKSNLLLELNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+ KP+ ESL+I+EYID+TWK +PLLP  PY+RA ARFW   A+ K++  ++ A+CS G
Sbjct  61   VHHQKPIAESLIIVEYIDQTWKQHPLLPQHPYQRALARFWGTVAD-KLVKTSYVAMCSSG  119

Query  399  KQQESAVN-SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +QE +V  +     +  E  + GK+FFGG+ IGYLDL  GW+ + LPI+EEV S+
Sbjct  120  DEQEKSVKEAKEVMDKIEEEIIKGKKFFGGDNIGYLDLAFGWIPYWLPIWEEVGSM  175



>ref|XP_008781341.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=231

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = +3

Query  42   MAAEEG-LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            MA+  G +K+ G W SP V RV+WAL+MKG+EYEYIEED+ NK+  L   NP++ +VPVL
Sbjct  1    MASGGGEVKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +HNGKP+ ESL+I+EYIDE WKHNP+LP DPYER +ARFW+ ++E K  D   +   ++G
Sbjct  61   LHNGKPIAESLVIIEYIDEVWKHNPILPEDPYERTKARFWSTYSEGKCRDAVGKGYFTEG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            +++E+A+    E +  L+ EL GK+FFGGE +G+ DLV+GW+A  LP+ EEVA
Sbjct  121  EEKENAIKYLEETVRVLDEELKGKKFFGGENLGFSDLVLGWMAFWLPVAEEVA  173



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+EYEYI ED+ NK+ LL + NPV+ K+PVL+HN K +
Sbjct  4    VKIIGSAASLFSVRVEWALKLKGIEYEYIVEDLRNKSELLLKSNPVYKKIPVLLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLLGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +A++ +  L+ E+ GK+FFGGEKIGYLDL  GW+ H L + +EV  +
Sbjct  124  EAAVQHLALLDKEIQGKKFFGGEKIGYLDLAAGWICHWLSVLDEVGEM  171



>ref|XP_010661155.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=225

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED++NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPA-WEALCSKGKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+     W     +GK+QE
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFWGVFVKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA L
Sbjct  123  EAMVEAMENLQFLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGL  173



>gb|KDP42499.1| hypothetical protein JCGZ_00296 [Jatropha curcas]
Length=224

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SPF LRV WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EELKVFRTWSSPFALRVVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQE  410
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+    +  +  K GK+QE
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFCDDKVAQTIFNGVFLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
             A+  A+E ++ LE EL GK+FFGG+KIG +DL +GW+AH   +FEE+
Sbjct  123  EAIPLAIENLKHLEKELRGKKFFGGDKIGLVDLALGWLAHYNGVFEEI  170



>ref|XP_004299558.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S    R++WAL++KG+EYE+IEED+ NK+ LL + NPVH KVPVLVH+ KP+
Sbjct  4    VKLLGTTQSFPCARIQWALKLKGVEYEFIEEDLGNKSSLLRKYNPVHKKVPVLVHHDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DPY++A ARFWA FA+ K+L   W A  ++G+++E A+
Sbjct  64   AESLVILEYIDETWKDNPLLPQDPYDKAVARFWAKFADEKVLIAVWGAFTAEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+E +  LE ++ GK+FFGGEKIGY DLVVGW++  L + EEV  +
Sbjct  124  KSALEPLAYLEQQIEGKKFFGGEKIGYFDLVVGWLSQWLNVMEEVGGM  171



>ref|XP_009343222.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  4    VKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + K+L   WE    +GK+QE A+
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVLPSIWEFFTKEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+N  +FEEVA +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYNESLFEEVAGM  171



>emb|CDP15482.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK++G   S FV R  WAL++KGLEY YIEE+++NK+ LL +LNPV+ KVPVLVH GK
Sbjct  4    EDLKLLGTRSSSFVWRTVWALKIKGLEYTYIEENLYNKSSLLLELNPVYKKVPVLVHRGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+I+EYIDETWK NP+LP DP ERA ARFWA F++ K+ + A + L + G++Q  
Sbjct  64   PICESLVIIEYIDETWKENPILPEDPLERAYARFWAKFSDEKLAESAGQVLRTTGEEQAK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+    EAME LE E++GK+FFGG+KIGYLD+V+GW A+ L   EEV   
Sbjct  124  ALERMTEAMEILEREISGKKFFGGDKIGYLDIVIGWSAYWLQFLEEVGCF  173



>gb|KDP42500.1| hypothetical protein JCGZ_00297 [Jatropha curcas]
Length=221

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR  WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EDLKVFRTWSSSFALRAVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+     +     +GK+QE
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFGDDKVFQSIVYGIFLKQGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
             A+  A+E ++ LE EL GK+FFGGEKIG LDL +GW+AH+  +FEE+
Sbjct  123  EAIPLAIENLKHLEKELRGKKFFGGEKIGLLDLALGWLAHHNGVFEEI  170



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G + S F  RV+WAL++KG+EYEY++ED+ NK+P+L ++NPVH KVPVLVH  KP+
Sbjct  4    VKVIGSYTSLFCTRVEWALKIKGVEYEYLKEDLRNKSPILLKVNPVHKKVPVLVHEEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW  NPL P DPYERA ARFWA FA+ K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWNKNPLFPQDPYERAMARFWAKFADDKCLYGAFHACWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SAME+   LE ++ GK+FF GE+IGYLDL +GW+ + L + EEV  +
Sbjct  124  ESAMESFAMLEEQIKGKKFFNGEQIGYLDLALGWIPYWLNVMEEVGGM  171



>ref|XP_006420235.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
 gb|ESR33475.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
Length=231

 Score =   187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE----FKILDPAWEALCSKGKQQ  407
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F +     K+L+ A++A+ SKG+++
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKVTVKLLESAYKAMWSKGEEK  124

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            + A+  A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE  
Sbjct  125  QKAMKEAVESLEKIEEVLRGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAG  174



>ref|XP_007036677.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
 gb|EOY21178.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
Length=224

 Score =   187 bits (475),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK++   +S F  R++WAL++KG+ YEY+EED+ NK+PLL   NPVH KVPVL+ NGKP+
Sbjct  4    LKLIASSLSVFCARIEWALKLKGVGYEYLEEDLRNKSPLLLTHNPVHKKVPVLLQNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYI+ETWK +PLLP DPYE+A ARFWA FA+ K L  A++A  + G ++E A+
Sbjct  64   AESLIILEYIEETWKDSPLLPEDPYEKAMARFWAKFADEKCLHGAFDACRAVGDEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA ++   LE +L GK++FGGE+IGYLDL +GW+ H L + EEV  +
Sbjct  124  ESAAKSFAFLEKQLEGKKYFGGEQIGYLDLALGWIPHWLNVMEEVGCM  171



>gb|KJB76665.1| hypothetical protein B456_012G099100 [Gossypium raimondii]
Length=220

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LRV WAL++KG+ YE I+ED+ NK+ LL Q NPVH K+PVLVHNG 
Sbjct  3    EEVKLLKTWSSRFGLRVVWALKLKGIPYEAIDEDLSNKSALLLQYNPVHKKIPVLVHNGN  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP DP  RAR RFWA F++ K+L   W A   +GK +E 
Sbjct  63   PISESLVILEYIDETWKQNPILPQDPLHRARERFWAKFSDEKLLPSVWGAFTKEGKDREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ + ME ++ +E EL GK+FF GEKIG +DLV GW+A+ + IFEEV+  
Sbjct  123  AMAATMENLKFVEEELKGKKFFSGEKIGLVDLVFGWLANLISIFEEVSGF  172



>ref|XP_010067034.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=235

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  39   IMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            I+A  E +K+   W SPF LRV WAL++KG++YE + ED+ NK+ LL Q NPV+ KVPVL
Sbjct  9    ILARPEEVKLFKTWSSPFPLRVAWALQLKGIQYESVLEDLSNKSNLLLQYNPVYKKVPVL  68

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +HNG+P+ ESL+ILEY+DETWK  PLLP DPY RA ARFWA F + K+L   +    S+G
Sbjct  69   LHNGRPISESLIILEYVDETWKQYPLLPQDPYARAMARFWAKFGDDKVLPSIYAVFKSEG  128

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            K+QE+ +  A E ++KLE EL GK+FF G+ IGYLD+ +GW+A+ + +FEEV+SL
Sbjct  129  KEQEAVLAEASEHLQKLEEELRGKKFFRGDNIGYLDIALGWLANLVRVFEEVSSL  183



>ref|XP_010921338.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=231

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG+EYEYIEED+ NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKIKGIEYEYIEEDLSNKSTSLLEYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H GKP+ ESL+++EYIDE WKHNP+LP DPYER +ARFWA + E +  D   +   ++G+
Sbjct  61   HKGKPIVESLVMIEYIDEVWKHNPILPEDPYERTKARFWATYGEGECRDAVGKVYFTEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++E+A+    + +  L+ EL GK+FFGGE IG+ DLV+GW+A  LP+ EEVAS 
Sbjct  121  EKENAIKHLEDTVRVLDEELKGKKFFGGENIGFSDLVLGWMAFWLPVAEEVASF  174



>ref|XP_002307924.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|EEE91447.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|ADB11389.1| tau class glutathione transferase GSTU18 [Populus trichocarpa]
Length=225

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWSSPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVGKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYI+ETWK  PLLP DPY++A ARFWA F++ K+L    W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQTPLLPEDPYQKANARFWAKFSDDKVLQSIKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ L IFEEVA L
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYLNIFEEVAGL  173



>ref|XP_002523997.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38365.1| glutathione s-transferase, putative [Ricinus communis]
Length=216

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+     SPF LRV WAL++KG+ YE IEED+ NK+PLL Q NP++ KVPVLVH+GK
Sbjct  3    EEVKLFNTSPSPFGLRVVWALKLKGIRYESIEEDLSNKSPLLLQYNPIYKKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW+ +PLLPA PY+RA A FWA F + K+L   W     KGK+QE 
Sbjct  63   PVVESLIILEYIEETWQQSPLLPAHPYQRAMAHFWAKFGDDKVLPSIWYVFIKKGKEQED  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A+E ++ LE EL GK+FFGGEKIG++DL  GW+A+ L + EEV  L
Sbjct  123  AIPEALENLKILEEELRGKKFFGGEKIGFVDLAFGWLANTLSVLEEVVGL  172



>ref|XP_007210928.1| hypothetical protein PRUPE_ppa026181mg, partial [Prunus persica]
 gb|EMJ12127.1| hypothetical protein PRUPE_ppa026181mg, partial [Prunus persica]
Length=186

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K+V    S F  R++WAL++KG+EYEYIEED+ NK+P+L + NPVH KVPV VH+ +
Sbjct  2    EGVKLVATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQQE  410
             + ESL+ILEYIDETWK +PLLP D Y+RA ARFWA FA+ K++  AW A   ++G+++E
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVVFGAWRACTAAEGEEKE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+ SA+E++  LE ++ GK+FFGGE+IGYLDL +GW+ H L   EE   +
Sbjct  122  KAIESALESLAYLEKQIEGKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGM  172



>ref|XP_004160429.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +A++ +  L+ E+ GK+FFGGE+IGYLDL  GW+ H L + +EV  +
Sbjct  124  EAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEM  171



>ref|XP_004137330.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN63854.1| hypothetical protein Csa_1G024860 [Cucumis sativus]
Length=224

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +A++ +  L+ E+ GK+FFGGE+IGYLDL  GW+ H L + +EV  +
Sbjct  124  EAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEM  171



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SP+ LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    AGEGVKLLGYWASPYALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETWK NPLLP DPYERA+ARFWA F + K +   +      G++Q
Sbjct  62   GKPIAESLVILEYIDETWKQNPLLPEDPYERAKARFWAKFVDDKCVPGIFATFSKVGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +  V  A E ++ LE EL+ K+FFG  +IG++D+   W+     I EE+  +
Sbjct  122  QKIVKEARENLKLLEGELDKKRFFGDTRIGFIDVASAWIICWAQIVEEIIDI  173



>emb|CDP09302.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SP+ LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLV +GK
Sbjct  3    EEVKLFRTWSSPYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVRDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++   W+   +  K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAHEKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A  +A+E ++ +E +L GK+FF GE IGYLDL  GW+A+ + I EE+ SL
Sbjct  123  AAVAALENLKIVEEQLKGKKFFHGETIGYLDLAFGWIANLVSILEEIMSL  172



>ref|XP_010938160.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 127/174 (73%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA+   +K+ G W SP V RV+WAL++KG+EYEYIEEDI NK+  L + NP++ +VPVL+
Sbjct  1    MASGGEVKLFGMWASPAVRRVEWALKLKGIEYEYIEEDISNKSKDLVKYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+I+EYIDE WKHNP+LP DPYERA ARFWA ++E K      E   ++G+
Sbjct  61   HNGKPIIESLVIIEYIDEVWKHNPILPKDPYERAMARFWATYSEDKCRGAVREVFFAEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++  A+    E +  L+ EL GK+FFGGE IG+ DLV+GW+A  L + EEVAS 
Sbjct  121  KRVKAIKCLEETLRALDEELKGKKFFGGENIGFSDLVLGWMAFWLGVSEEVASF  174



>ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=225

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED++NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+    +  +  K GK+QE
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFGGVFVKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA L
Sbjct  123  EAMVEAMENLQFLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGL  173



>ref|XP_002264054.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=228

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR  WAL++KG++YE I ED+ NK+P L Q NPV+ KVPVLVH GK
Sbjct  3    EEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPSLLQYNPVYKKVPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DP+ERA ARFWA F E K+L   W     +GK+QE 
Sbjct  63   PIAESLVILEYIDETWKQAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A+E ++ LE EL GK+FFGGE IG++DL +GW+ + + I EE+  L
Sbjct  123  AMVPALENLKFLEEELKGKKFFGGETIGFVDLALGWLGNLISILEEIVGL  172



>ref|NP_001063423.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|AAK98545.1|AF402804_1 putative glutathione S-transferase OsGSTU17 [Oryza sativa Japonica 
Group]
 dbj|BAD17523.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAD19734.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAF25337.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|EAZ09424.1| hypothetical protein OsI_31697 [Oryza sativa Indica Group]
 gb|EAZ45045.1| hypothetical protein OsJ_29684 [Oryza sativa Japonica Group]
 dbj|BAG88140.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94156.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=223

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MAA++G+K+ G W SP  +RV+WALR+KG++YEY++ED+ NK+  L + NPV  KVPVLV
Sbjct  1    MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H+GKPL ES +I+EYIDE WKH  P++P+DP++RA+ARFWA FAE K     +    + G
Sbjct  61   HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++Q   V+ A + ++ LE  L GK+FFGG+  GYLD+V GW A+ LP+ EE   +
Sbjct  121  EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGV  175



>ref|XP_008219369.1| PREDICTED: glutathione transferase GST 23-like [Prunus mume]
Length=223

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL Q NPVH K+PVLVH GK
Sbjct  4    DSVKLLGNWASPSALRVKWTLKLKEIEYQYVEEDLSNKSPLLLQYNPVHKKIPVLVHGGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWK NP+LP DPYERA+ARFWA F + K       A   KG+++E 
Sbjct  64   PVAESLVILEYIEETWKPNPILPEDPYERAQARFWAKFVDEKCAPSIMSAFTKKGEEKEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                A E ++ LE+ L GKQFFGGE IG++D+  GW+     I EE+A +
Sbjct  124  VAKEARENLQILESGLGGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEV  173



>ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum]
 gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum]
Length=225

 Score =   185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A E +K++G+W SPF L+V WAL++KG+EYEY EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    ASEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +   +      G +Q
Sbjct  62   GKPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +     A E ++ LE EL  K FFG  KIG++D+   W+     I EEV  +
Sbjct  122  QKIAKEARENLKILEDELGKKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDI  173



>ref|XP_002266900.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQE
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  184



>emb|CBI26437.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQE
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  122

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   
Sbjct  123  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  179



>ref|XP_008438211.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EY+ + ED+ NK+PLL + NP++ KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYDTVYEDLANKSPLLLEYNPIYKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+   +   ++GK +E
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVRE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              V  A+E ++ LE EL GK+FFGGE IG++D+ VGW+A+ + + EEV  L
Sbjct  122  EGVEEALENLKHLEEELKGKRFFGGEAIGFVDIAVGWLANLVSVIEEVVGL  172



>ref|XP_008240197.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=225

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++    S F  R++WAL++KG+EYEYIEED+ NK+P+L + NPVH KVPV VH+ +
Sbjct  2    EGVKLIATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQQE  410
             + ESL+ILEYIDETWK +PLLP D Y+RA ARFWA FA+ K++  AW A   ++G+++E
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVVFGAWRACTAAEGEEKE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +A+ SA+E++  LE ++ GK+FFGGE+IGYLDL +GW+ H L   EE   +
Sbjct  122  TAIESALESLAYLEKQIEGKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGM  172



>gb|ADB11356.1| putative tau class glutathione transferase GSTU23 [Populus trichocarpa]
Length=254

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEE-DIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K++GFW SPF  RV WAL++KG++YEYIEE DIFNK+  L +LNPVH KVPV VH  K 
Sbjct  4    VKLLGFWASPFARRVAWALKLKGVDYEYIEEEDIFNKSSQLIELNPVHKKVPVFVHGQKV  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFA-EFKILDPAWEALCSKGKQQES  413
            + ES +IL+   +TWK  PL+P DP+ERA  RFW  FA E KIL  AW A+CS+G+++E 
Sbjct  64   IAESFVILQDCLKTWKQCPLMPQDPHERAMIRFWTKFAEEKKILHAAWNAMCSRGEEKEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A    ++ +EK+E EL GKQFFGGE IGYLD+ +GW+++ LP++EEV S+
Sbjct  124  AAKLTVDVIEKIEGELKGKQFFGGESIGYLDIALGWMSYWLPVWEEVGSM  173



>emb|CDP21862.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP+H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSGYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPIHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++   W+   ++ K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAREKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A   A+E ++ +E +L GK+FF GE +GYLDL  GW A  + I EE+ SL
Sbjct  123  AAVEALENLKLVEEQLKGKKFFHGETVGYLDLAFGWFADFVSILEEIMSL  172



>ref|XP_011004953.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED+ NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLANKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLVILEYIEETWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E ++ LE EL GKQFFGGE+IG +D+  GW+A+ +P+FEE+ ++
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIAFGWLANLVPVFEEIHAI  172



>ref|XP_002527848.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF34551.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WAL++KG+EYE I ED+ +K+PLL Q NPVH KVPVLVHNGK
Sbjct  3    EEVKIFRTWSSPFALRVIWALKLKGIEYETIYEDLSSKSPLLVQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPA-WEALCSKGKQQE  410
             + ESL+ILEY+DETWK  PLLP DP+ERARARFWA F + K+L    +     +GK+ E
Sbjct  63   AISESLVILEYMDETWKQYPLLPQDPHERARARFWAKFGDDKVLQSIFYGTFLKQGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              + SA E ++ LE EL GK+FFGG+ IG +DL +GW+AH   +FEE+  L
Sbjct  123  EGLASATENLQCLEEELKGKKFFGGDNIGVVDLALGWLAHYNSVFEEIIGL  173



>ref|XP_007223941.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
 gb|EMJ25140.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
Length=223

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL   NPVH K+PVLVH+GK
Sbjct  4    DSVKLLGCWASPAALRVKWTLKLKEIEYQYVEEDLQNKSPLLLHYNPVHKKIPVLVHDGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW  NP+LP DPYERA+ARFWA F E K       A   KG+++E 
Sbjct  64   PVAESLIILEYIEETWMQNPILPEDPYERAQARFWAKFVEEKCGPSIMSAFTKKGEEKEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                A E ++ LE+ L GKQFFGGE IG++D+  GW+     I EE+A +
Sbjct  124  GAKEARENLKILESGLGGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEV  173



>ref|XP_011004483.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+     W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSIKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ + IFEEV  L
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVVGL  173



>ref|XP_010923032.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=222

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFV RV+WAL++KG++YEYIEED++NK+P L   +P++ +VPVL+H+GKP+
Sbjct  3    VKLFGAWSSPFVRRVEWALKIKGIKYEYIEEDLYNKSPSLLTYSPINKQVPVLLHDGKPI  62

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES++I+EYID+TWK  PLLP DPY+R+ ARFW+ + E K  +    A  ++G++Q++AV
Sbjct  63   IESMVIIEYIDDTWKQKPLLPIDPYQRSMARFWSQYVEDKFYESVKRAFFTEGEEQKAAV  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+EA++ LE EL GK+FF GE+IG++DLV GW+AH L + EEV  +
Sbjct  123  ESAVEALKPLEQELKGKKFFCGEEIGFVDLVAGWIAHWLEVVEEVLCI  170



>ref|XP_011040645.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+     W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSMKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ + IFEEV  L
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVVGL  173



>ref|XP_004307163.2| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=256

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  30   TVVIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKV  209
            + +I      +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H K+
Sbjct  24   SQLIQTKMAEVKLFSTWSSAFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKKI  83

Query  210  PVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC  389
            PVLVHNGK + ESL+ILEYI+ETWK NPLLP DP++RA ARFWA F + K+  P  +A  
Sbjct  84   PVLVHNGKSIAESLVILEYIEETWKQNPLLPEDPHDRAAARFWAKFGDDKVFPPIVDAFY  143

Query  390  SKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            S+GK+QE A+  A E ++ LE EL GK FFGG++IG+ D+ +GW+AH L + EE+A++
Sbjct  144  SEGKEQEEAIVKAKENLKYLEEELKGKNFFGGDQIGFADIALGWLAHYLKVLEEIANM  201



>gb|KJB44380.1| hypothetical protein B456_007G249200 [Gossypium raimondii]
Length=220

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LRV WAL++KG+ YE I+ED+ NK+ LL Q NPVH K+PVLVHNG 
Sbjct  3    EEVKLLKTWSSAFGLRVVWALKLKGIPYEAIDEDLSNKSALLLQYNPVHKKIPVLVHNGN  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP DP  RAR RFWA F + K+L   W A   +GK +E 
Sbjct  63   PISESLVILEYIDETWKQNPILPQDPLHRARERFWAKFNDEKLLPSVWGAFTKEGKDREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ + ME ++ +E EL GK+FF GEKIG +DLV GW+A+ + IFE V   
Sbjct  123  AMAATMENLKFVEEELKGKKFFSGEKIGLVDLVFGWLANLISIFEAVTGF  172



>ref|XP_002319750.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
 gb|EEE95673.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
Length=225

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED+ NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ TWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E ++ LE EL GKQFFGGE+IG +D+ +GW+A+ +P+FEE+ ++
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIALGWLANLVPVFEEIHAI  172



>gb|AAG34831.1|AF244688_1 glutathione S-transferase GST 23, partial [Zea mays]
Length=214

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  69   VGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPES  248
            +G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+GKP+ ES
Sbjct  1    LGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHDGKPVAES  60

Query  249  LLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNS  425
             +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ Q  AV+ 
Sbjct  61   TIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEAQRKAVHE  120

Query  426  ameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            A + ++ LE  L+GK+FFGG+ +GYLD+VVGW AH LP+ EEV  
Sbjct  121  AQQCLKTLETALDGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTG  165



>ref|XP_006489767.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=185

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SP V RV WAL++KG+E+E IEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             +S +ILEYID TW+H+PLLP DPYE A ARFWA FA  K+L+ A++A+ SKG++++  +
Sbjct  65   VDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEKQKTM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
                    +   EL GK F GG  IGYLDL +GW+++ LP++EE
Sbjct  125  KE-AIESLEKIEELRGKNFIGGNSIGYLDLAIGWISYWLPVWEE  167



>dbj|BAK02670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP V+RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMVIRVEWALRLKGVVYEYVDEDLASKSDALLRRNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADP++RA+ARFWA FA+ K     +    + GK 
Sbjct  62   GKPIVESTIIVEYIDEAWKDGYPIMPADPHDRAQARFWARFADDKCNAAIYPVFTATGKA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            Q   V  A   ++ LE  L GK+FFGG+ IGYLD+VVGW A+ LP+ EEV+
Sbjct  122  QREVVREAQRCLKTLETALEGKKFFGGDAIGYLDVVVGWYAYWLPVIEEVS  172



>ref|XP_006420236.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33476.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=227

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 131/169 (78%), Gaps = 8/169 (5%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPFV RV WAL++KG+E+EYIEED+FNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K       +  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEK-------STWTKGEEKEDAL  117

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASL  563
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + LPI+EE+AS+
Sbjct  118  KATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWINYLLPIWEEIASI  166



>ref|XP_009335025.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+   +FE++A +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYYESLFEDIAGM  171



>ref|XP_007029835.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
 gb|EOY10337.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
Length=252

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  30   TVVIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKV  209
             V I  +   +K+   W + F  RV WAL++KG++YE I+ED+ NK+ LL Q NPV+ KV
Sbjct  27   VVEIANSMAEVKLFKTWSTQFGARVVWALKLKGIQYEAIDEDLSNKSALLLQYNPVYKKV  86

Query  210  PVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC  389
            PVLVHNGKP+ ESL+ILEYI+ETWK NP+LP DP  +A ARFWA F + K+L   W A  
Sbjct  87   PVLVHNGKPISESLVILEYIEETWKQNPILPEDPLGKANARFWAKFNDEKLLPSIWSAFT  146

Query  390  SKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +GK++E A+ + +E+++ +E EL GK+FFGGEKIG  DLV GW+A+  P+FEEVA L
Sbjct  147  KEGKEREEAMGAVLESLKFVEEELKGKKFFGGEKIGLADLVFGWLANLAPVFEEVAGL  204



>gb|ADB11328.1| tau class glutathione transferase GSTU46 [Populus trichocarpa]
Length=223

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YERA A FWA F E K L   + A   +G+++E A
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTEEKCLMETFTAAYKEGEEKERA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
            + SA E+   LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +
Sbjct  124  IESAQESFAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGDM  173



>gb|ADB11367.1| putative tau class glutathione transferase GSTU41 [Populus trichocarpa]
Length=225

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED+ NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ TWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E ++ LE EL GKQFFGGE+IG +D+  GW+A+ +P+FEE+ ++
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIAFGWLANLVPVFEEIHAI  172



>ref|NP_001237959.1| uncharacterized protein LOC100305870 [Glycine max]
 gb|ACU13765.1| unknown [Glycine max]
Length=205

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+    W A+ + G +Q
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
            E A+  A E MEK+E E+ GK FFGG+ IGYLD+ +G
Sbjct  122  EEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIG  158



>ref|XP_008793318.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 125/174 (72%), Gaps = 0/174 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG++YEY+EEDI NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKLKGIKYEYVEEDISNKSGALVRYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+ILEYIDE WKH+P+LP DPYERA ARFWA ++E K  D       ++G 
Sbjct  61   HNGKPIVESLVILEYIDEVWKHHPILPKDPYERAMARFWAAYSEDKCRDAVRRVFFAEGG  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            ++  A+    E +  L+ EL GK+FFGGE IG+ DLV+GW+A  L + EEVAS 
Sbjct  121  ERAKAIECLEETLRALDGELEGKEFFGGENIGFSDLVLGWMAFWLGVSEEVASF  174



>ref|XP_010646030.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=231

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR+ WAL++KG+EYE I ED+ +K+P L Q NP H K+PVLVH+GK
Sbjct  3    EEVKLFRTWSSPFALRIVWALKIKGVEYETIFEDLSDKSPSLLQYNPAHKKIPVLVHSGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+L    W     +G +QE
Sbjct  63   PIAESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFIKEGNEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A+  AM+ +  LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA L
Sbjct  123  EAMVEAMKNLWLLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGL  173



>ref|XP_011086578.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=222

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 120/170 (71%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SP+ LRV  AL++KGL+YE I ED+ NK+  L + NP + KVPVLVHNGK
Sbjct  3    EELKLFRTWSSPYSLRVVHALKIKGLKYETILEDLKNKSASLLEYNPTYKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESLLILEYIDETWK +PL P DPY++A ARFWA F + K+L   W    S+GK+QE 
Sbjct  63   PICESLLILEYIDETWKQHPLFPQDPYQKAMARFWAKFGDDKVLPSIWSVFISQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A   ++ LE  L GK+FFGGE IGYLDL  GW+A+ + I EE+  L
Sbjct  123  AIAPAAGNLKFLEDLLKGKKFFGGETIGYLDLAFGWMANLISILEEIIDL  172



>ref|XP_006437357.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
 ref|XP_006484734.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
 gb|ESR50597.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
Length=222

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LRV WAL++KG++++ IEED+ NK+PLL Q NPV+ K+PVLVHNG+ +
Sbjct  4    VKLLKTWSSHFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQHNPVYKKIPVLVHNGRAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYE ARARFWA F++ K+    W     +GK+QE A 
Sbjct  64   SESLVILEYIDETWKQYPLLPDDPYESARARFWAKFSDDKVFPSIWGVFIKQGKEQEEAF  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
                E    LE EL GK+FFGGEKIGY DL +GW+A  +   EE+ 
Sbjct  124  AQVFENFSFLEEELKGKKFFGGEKIGYADLALGWIAERVFELEEIG  169



>gb|AFK35732.1| unknown [Lotus japonicus]
Length=222

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 2/175 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC-SKG  398
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+   +W AL  S G
Sbjct  60   HGHKPIAESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKLALGSWVALMRSSG  119

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +QE  V    E MEKLE E+ GK+FFGG+ IGYLDLV+GW+   LP++EEV S+
Sbjct  120  DEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSM  174



>ref|XP_010097693.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB70648.1| putative glutathione S-transferase [Morus notabilis]
Length=227

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
             +E +K+   W SP+ LR+ WAL++KG+EYE I E++ +K+ LL   NP+H KVPVLVHN
Sbjct  2    GDEEVKLFRTWSSPYALRIVWALKLKGVEYETIYEEVSHKSDLLIGYNPIHKKVPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETWK +PLL   P++RA ARFWA F + K+L   WEA   +GK+Q
Sbjct  62   GKPIAESLVILEYIDETWKQHPLLSDQPHQRALARFWAKFGDEKVLPAIWEAFTKQGKEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+++A+E ++ LE EL GK+ FGGE+IG +D+ +GW+A+ + +FEE+  L
Sbjct  122  EEALSTAVENLKYLEEELKGKKLFGGEEIGLVDIALGWLANLVSVFEEITGL  173



>gb|KDO57582.1| hypothetical protein CISIN_1g043218mg [Citrus sinensis]
Length=226

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SP V RV WAL++KG+E+E IEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             +S +ILEYID TW+H+PLLP DPYE A ARFWA FA  K+L+ A++A+ SKG++++  +
Sbjct  65   VDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEKQKTM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
                    +   EL GK F GG  IGYLDL +GW+++ LP++EE
Sbjct  125  KE-AIESLEKIEELRGKNFIGGNSIGYLDLAIGWISYWLPVWEE  167



>ref|XP_006373657.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
 gb|ERP51454.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
Length=225

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WAL++KG+E++ I ED+ NK+PLL Q NP+H KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSPFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L    W  L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L IFEE+  L
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLDIFEEILGL  173



>gb|KEH26957.1| glutathione S-transferase [Medicago truncatula]
Length=223

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  99   RVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEYIDET  278
            R++WALR+KG+EYEYI+ED+ NK+PLL + NPV+ KVPVL+H+GK + ESL+ILEYIDET
Sbjct  17   RIEWALRIKGVEYEYIQEDLLNKSPLLLESNPVYKKVPVLLHDGKSIAESLVILEYIDET  76

Query  279  WKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamekleae  458
            WK NPLLP DPYE+A ARFWA F + K +   W A  ++G+++  AV++A+E++  LE +
Sbjct  77   WKDNPLLPLDPYEKALARFWAKFIDEKCIFGVWGACVAQGEEKAKAVDAAIESLAFLEKQ  136

Query  459  lNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            + GK+FFGGEKIGYLD+V GW+++ L + EE+  +
Sbjct  137  IQGKKFFGGEKIGYLDIVAGWISYWLNVLEELGEM  171



>gb|AFK34634.1| unknown [Lotus japonicus]
Length=222

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 2/175 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC-SKG  398
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+   +W AL  S G
Sbjct  60   HGHKPIVESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKLALGSWVALMRSSG  119

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +QE  V    E MEKLE E+ GK+FFGG+ IGYLDLV+GW+   LP++EEV S+
Sbjct  120  DEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSM  174



>ref|XP_002321502.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
 gb|EEF05629.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
Length=223

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YERA A FWA F + K L   + A   +G+++E A
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTDEKCLMQTFTAAYKEGEEKERA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
            + SA E+   LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +
Sbjct  124  IESAQESFAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGDM  173



>emb|CDP19810.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSRYSLRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++    +   +  K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSISQLFIAHEKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A  +A+E ++ +E +L GK+FF GE IGYLDL  GW+A+ + I EE+ SL
Sbjct  123  AAVAALENLKIVEEQLKGKKFFHGETIGYLDLAFGWIANLVSILEEIMSL  172



>ref|XP_003578262.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Brachypodium 
distachyon]
Length=222

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP  +R++WALR+K + YEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRLEWALRLKSVVYEYVDEDLGNKSDALLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPVVESAIIVEYIDEAWKDGYPIMPADPYERAQARFWANFADEKCNAAVYPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            Q   V+ A + ++ LE  L GK+FFGG+ +GYLDLVVGW A+ LPI EEV+
Sbjct  122  QGKVVHEAQQCLKTLEKALEGKKFFGGDAVGYLDLVVGWYAYWLPIIEEVS  172



>ref|XP_011000484.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=223

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLEHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YER  A FWA F + K L   + A   +G+++E A
Sbjct  64   IPESLIILQYIDETWNDNNLLPQDSYERTMAHFWAKFTDEKCLMETFTAAYKEGEEKEKA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
            + SA E++  LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +
Sbjct  124  IESAQESLAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGGM  173



>ref|XP_006660720.1| PREDICTED: glutathione transferase GST 23-like [Oryza brachyantha]
Length=222

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++G+K+ G W SP  +R +WALR+KG++YEYI+ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    ADKGVKVFGMWASPMAIRAEWALRLKGVDYEYIDEDLANKSEALLRYNPVTEKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKPL ES +I+EYIDE WK   P++PADP+ERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPLAESTVIVEYIDEAWKDGYPIMPADPFERAQARFWARFAEEKCNAALYPIFMTTGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            Q   V  A + ++ LE  L GK FFGG+  GYLD+V GW A+ LPI EEV  +
Sbjct  122  QSKLVQEAQQCLKTLETALEGKTFFGGDAFGYLDIVTGWYAYWLPIIEEVTGV  174



>emb|CBI26438.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ+
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  122

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   
Sbjct  123  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  179



>ref|XP_004299656.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=227

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 125/169 (74%), Gaps = 0/169 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H  +PVLVHNGK
Sbjct  2    EEVKLFRTWTSSFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKAIPVLVHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWK NPLLP DP++RA ARF A F + K++    +A+ S+GK+QE 
Sbjct  62   PIAESLVILEYIEETWKQNPLLPQDPHDRATARFLAKFGDDKVMPSIVDAVFSEGKEQEE  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            A+  A E +  LEAEL GK++FGGE+IG+ D+  GW+AH+L + EEV +
Sbjct  122  AIAKAKENLNYLEAELKGKKYFGGERIGFADIAQGWLAHSLKVLEEVTN  170



>gb|EMT19525.1| hypothetical protein F775_31981 [Aegilops tauschii]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP  +RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRVEWALRLKGVGYEYVDEDLASKSDALLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADPY+RA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPIAESTIIVEYIDEAWKDGYPIMPADPYDRAQARFWARFADDKCNAAIFPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            Q   V  A   ++ LE  L GK+FFGG+ +GYLD+VVGW A+ LPI EEV+
Sbjct  122  QREVVREAQRCLKTLEKALEGKKFFGGDAVGYLDVVVGWYAYWLPIIEEVS  172



>ref|XP_002266994.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ+
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  184



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G WVSPF  R++ AL++KG+ +EY+EED+ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLYGTWVSPFSRRIELALKLKGVPFEYMEEDLSNKSPELLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK+NP+LP DPY+RA  RFWA F + KIL   W+A   +GK++E 
Sbjct  63   PIAESLVILEYIDETWKNNPILPQDPYQRAMVRFWAKFIDEKILATGWKANFGEGKEREV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+    E M+ LE ELNGK FF GE IG+LD+V   +A   P+ ++   +
Sbjct  123  AIEEFAEQMKFLENELNGKDFFEGETIGFLDIVANLIAFWFPVRQDALGI  172



>ref|XP_002268774.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
 emb|CBI26443.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPV+ KVPVL+HNG
Sbjct  9    EEQVKLLGSWYSPFVKRVEWALKFKGIEYEYVEEDLINKSSLLLTSNPVYKKVPVLLHNG  68

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ++L+I+EYIDETWKHNP+LP DP+ERA+ARFWA F E K+ D    AL ++G+QQE
Sbjct  69   NPIAQTLVIIEYIDETWKHNPILPQDPHERAKARFWADFIEVKLTDVVRTALITQGEQQE  128

Query  411  SAVNSameamek----leaelNGKQFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
             AV  A EAME            + FFGG   IGY+D+V+G +   + + EEV   
Sbjct  129  KAVKEAKEAMEVLEGEAAKLKGERVFFGGNNGIGYVDIVLGLMCGWVEVIEEVGGF  184



>gb|ADB11358.1| tau class glutathione transferase GSTU26 [Populus trichocarpa]
Length=225

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG+EYEY++EDI+NK+PLL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDIWNKSPLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FAE K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFAEEKCLMGAFAAFWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+   L + EE   +
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGM  172



>ref|XP_009335024.1| PREDICTED: probable glutathione S-transferase isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSRFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+   +FE++A +
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYYESLFEDIAGM  171



>emb|CAN73419.1| hypothetical protein VITISV_027346 [Vitis vinifera]
Length=236

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHXKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ 
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQX  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASL  563
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  184



>ref|NP_001237698.1| glutathione S-transferase GST 20 [Glycine max]
 gb|AAG34810.1|AF243375_1 glutathione S-transferase GST 20 [Glycine max]
 gb|KHN06424.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59655.1| tau class glutathione S-transferase [Glycine max]
Length=224

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 4/177 (2%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ FWVSPF  R++WAL++KG+EYEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFWVSPFGKRIEWALKLKGVEYEYIEEDIFNKSSLLLELNPVHKKVPVLV  59

Query  222  HNGKP-LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS--  392
            H  K  + ES +ILEYIDE WK   LLP  PY+RA ARFWA  AE       W AL S  
Sbjct  60   HAEKSIIAESFIILEYIDEKWKQYSLLPHHPYQRALARFWAATAEEMFRKVVWIALRSPT  119

Query  393  KGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             G ++E A+  + E ME++E E+ GK++FGG+ IGYLD+ +GW+++ LP+ EEV S+
Sbjct  120  SGDEREKALKESREVMERIEEEIRGKKYFGGDNIGYLDIALGWISYWLPVLEEVGSM  176



>ref|XP_006580178.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U1-like 
[Glycine max]
Length=206

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 130/186 (70%), Gaps = 15/186 (8%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG------------WV-AHNLPI  542
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +G            W+ AHN PI
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGXDLLLASCCGGSWIDAHNRPI  180

Query  543  FEEVAS  560
              E++S
Sbjct  181  --EISS  184



>ref|XP_010939723.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=222

 Score =   179 bits (455),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 126/174 (72%), Gaps = 2/174 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNK-TPLLSQLNPVHAKVPVLVH  224
            AE+G+K+ G W SP  LRV+WAL++KG+EYEY+EED+F+K +  L + NPV  K+PVLVH
Sbjct  2    AEKGVKLFGMWCSPIALRVEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKIPVLVH  61

Query  225  NGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            +GKPL ESL+I+EY+DE WK   P++P DPYERA+ARFWA FAE KI    +    + G+
Sbjct  62   DGKPLAESLVIVEYVDEVWKDGFPIMPKDPYERAQARFWAKFAEDKISPATFAVYSTTGE  121

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            QQ+ A+  A E  + LE  L GK+FFGGE IG++D+  GW+   + I EE+ S+
Sbjct  122  QQQKALQEAQELFKTLEEALKGKKFFGGETIGFVDIAAGWLPCWVRIIEEIVSV  175



>ref|XP_008812228.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=221

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G  +SP  LRV+WAL++KG+EYEY++ED+ +K+  L + NPV  K+PVLVH+
Sbjct  2    AEKGVKLFGMSLSPMALRVEWALKLKGVEYEYVDEDLLHKSEELLRYNPVTKKIPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ESL+I+EY+DE WK   P++P DPYERA+ARFWA F E KI    +   C+ G+Q
Sbjct  62   GKPMAESLVIIEYVDEVWKDGYPIMPKDPYERAQARFWAKFVEDKINPAIYAVFCTTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            Q+ A+  A E+   LE  L  K+FFGGE IG++D+V GW+ + L I EE+  +
Sbjct  122  QQKALQEAQESFMTLEVALKSKKFFGGEMIGFVDIVAGWLPYWLRIIEEIVGV  174



>emb|CDP11459.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 124/162 (77%), Gaps = 2/162 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ KVPVL+H 
Sbjct  2    AGEGVKLLGYWASPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQGNPVYKKVPVLLHK  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K + PA   + +K G++
Sbjct  62   GKSISESLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCV-PALVGVITKVGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAH  530
             E +   A E ++ LE+ L+GK+ FGG KIG+ D+ + W+A+
Sbjct  121  LEKSAREAREHLKTLESGLDGKRCFGGTKIGFADVAIAWIAY  162



>ref|XP_010663654.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  RV+WAL++KG+ YEY+EED+ NK+P+L Q NPVH KVPVLVH+G+P+
Sbjct  4    VKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVHDGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDE WK  PLLP DP ERA+ RFWA F + K +  AW A C+KG ++E A+
Sbjct  64   AESLVILEYIDEAWKGYPLLPEDPSERAKIRFWARFTDEKCVLGAWAACCAKGHEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
             SA E++  LE ++ GK+FFGGE +G LDLVVG + + +   EE
Sbjct  124  ESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEE  167



>ref|XP_007145574.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
 gb|ESW17568.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
Length=225

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  99   RVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEYIDET  278
            RV+WALR+KG+EYEY++E++ NK+PLL Q NPVH KVPV +HN  PLPESL+ILEYIDET
Sbjct  18   RVEWALRIKGVEYEYLQENLANKSPLLLQSNPVHKKVPVFLHNHNPLPESLVILEYIDET  77

Query  279  WKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamekleae  458
            WK NPLLP DPY+RA+ARFWA F + K+L   W A  ++G+++  AV++A+E++  LE E
Sbjct  78   WKDNPLLPLDPYQRAQARFWARFIDEKVLYGVWGATVAEGEEKGKAVDAALESLAFLEKE  137

Query  459  lNGKQFFGGEKIGYLDLVVGWVAHNLPI  542
            + GK++FGG+KIGYLD+  GW++H L +
Sbjct  138  IEGKKYFGGDKIGYLDIAAGWLSHWLSV  165



>gb|AFP20277.1| glutathione transferase 23 [Triticum aestivum]
Length=221

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP  +RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRVEWALRLKGVGYEYVDEDLASKSDALLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+E+IDE WK   P++PADPY+RA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPIAESTIIVEFIDEAWKDGYPIMPADPYDRAQARFWARFADDKCNAAIFPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            Q   V  A   ++ LE  L GK+FFGG+ +GYLD+VVGW A+ LPI EEV+ 
Sbjct  122  QREVVREAQRCLKTLEKALEGKKFFGGDAVGYLDVVVGWYAYWLPIIEEVSG  173



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 120/170 (71%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++G W SPF LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EGVKLLGHWASPFALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES +ILEYIDETWK NPLLP DPYERA+ARFWA F + K +   +      G++Q+ 
Sbjct  64   PIAESSVILEYIDETWKKNPLLPEDPYERAKARFWAKFIDDKCVPGIFRTFSKVGEEQQK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                A E ++ LE EL+ K+ FG  +IG++D+   W+     I EE+  +
Sbjct  124  IAKEARENLKLLEGELDKKRVFGDSRIGFIDVASAWIICWAQIVEEIVDI  173



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SP  LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EKVKLLGNWASPSALRVHWALKLKGIEYDYQEEDLRNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +   +      G++Q+ 
Sbjct  64   PIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEEQQK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                A E ++ LE EL  K FFG  KIG++D+   W+     I EE+  +
Sbjct  124  IAKEARENLKILEGELGKKHFFGDTKIGFMDVASAWIICWAQIVEEIVDI  173



>ref|XP_010469949.1| PREDICTED: glutathione S-transferase U1 [Camelina sativa]
Length=224

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EETVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQILTLGFRSLVKAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+      +  LE E+ GK FFGG+ +G+LD+V G
Sbjct  125  VAIGETQAMLMFLEKEVTGKDFFGGKTVGFLDMVAG  160



>ref|XP_009335026.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=218

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + ++    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYID-EVSPSIWESFTKEGKEQEEGI  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE+VA +
Sbjct  123  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDVAGM  170



>ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=223

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 122/172 (71%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + + ++G W SP  LR++WAL++KG+ YEYI+ED+ NK+  L   NPVH KVPVLVH 
Sbjct  2    ATDQVTLLGMWASPLSLRIEWALKIKGIHYEYIDEDLDNKSQRLLTCNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETW H+ +LP DPYERA ARFWA FA+ K            G++Q
Sbjct  62   GKPIAESLVILEYIDETWSHSRILPEDPYERAMARFWAKFADDKCWTTIHGVFTKTGQEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E+A + A+E+++ LE      +FFGG+ IG+LD+V GW+A+ +P+ EE+  +
Sbjct  122  ENAKSEAIESLKTLEKIPRESKFFGGDAIGFLDIVFGWMAYWVPLLEEITGI  173



>ref|XP_009343224.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=219

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  4    VKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE++  +
Sbjct  124  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDITGM  171



>ref|XP_009790678.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=224

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SPF LR  WAL +KG++Y+ I ED+  K+P L Q NPVH K+PVLVH GK
Sbjct  3    EELKLHRTWSSPFGLRAVWALHIKGIQYDTIYEDLSQKSPELLQHNPVHKKIPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DPYE+A  RFWA F E K+L   W     +G ++  
Sbjct  63   PICESLVILEYIDETWKEAPLLPQDPYEKATVRFWAKFGEEKLLPSIWSVFTGQGNEKNE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A++ +E  E +L  K+FFGGE+IGYLDL +GW+A+ L +FEEV  L
Sbjct  123  ALGPAVQNLELFEEQLKEKKFFGGEEIGYLDLSLGWLAYLLDVFEEVIDL  172



>ref|XP_004978487.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=231

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
             ++ +K+ GFW SP+VL+V WALR+KG+EY+YIEED+ NK+  L + NPVH KVPVLV+ 
Sbjct  7    GDKQVKLFGFWPSPYVLKVIWALRIKGVEYDYIEEDLSNKSDQLLEYNPVHKKVPVLVYQ  66

Query  228  GKPLPESLLILEYIDETWKH--NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            GKP+ ES +I+++IDE WK   +P+LP DPYERA ARFW  F + K+  P W+   ++G+
Sbjct  67   GKPIAESEVIIQFIDEAWKDRGDPILPEDPYERAMARFWVRFLQDKLSPPIWKWFTTQGQ  126

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            QQE A  +A++ +  LE EL+GK+FF GEKIG++DL +G +++ +PI+EE+  +
Sbjct  127  QQEDAHGAAIDQLLVLEKELDGKRFFAGEKIGFVDLSLGPLSYVIPIYEEITGV  180



>ref|XP_008240195.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=216

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  R++WAL+ KG+ YEYIEED+ NK+PLL Q NPVH K+PVLVH  KP+
Sbjct  4    VKVIGASLSLFCCRIEWALKHKGIAYEYIEEDLRNKSPLLLQYNPVHKKIPVLVHGEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLILEYIDETW  NP+LP DP+E+A ARFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLLILEYIDETWTENPMLPEDPFEKAMARFWAKYVDEKCVISAWTASRTKGHEQEKAL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA E+++ L   + GK+FFGGE +G+LD  VG + + L   EE   +
Sbjct  124  ESAQESLQLLNKLIEGKKFFGGETMGFLDFAVGSLPNWLKFLEEFQGI  171



>ref|XP_009343225.1| PREDICTED: probable glutathione S-transferase isoform X4 [Pyrus 
x bretschneideri]
Length=218

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLSTWSSPFPLRIIWALQLKGVPYETIHEDLSNKSPLLLQSNPVHKKVPVLLHNGNAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + ++    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYID-EVSPSIWESFTKEGKEQEEGI  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE++  +
Sbjct  123  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDITGM  170



>ref|XP_010510486.1| PREDICTED: glutathione S-transferase U1-like [Camelina sativa]
Length=225

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EETVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQILTLGFRSLVKAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ GK FFGG+ +G+LD+V G
Sbjct  125  VAIEETQEMLMFLEKEVTGKDFFGGKMVGFLDMVAG  160



>ref|XP_004504278.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=224

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K++ F +SP   RV+WAL++KG++YEYIEEDIFNK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLLNFLLSPVGRRVEWALKLKGVDYEYIEEDIFNKSNLLLELNPVHKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             K + ESL+ILEYIDETWK  PLLP  PY+RA ARFWA  ++   L  AW A+  +G ++
Sbjct  62   QKSMAESLIILEYIDETWKQYPLLPHHPYQRALARFWAKLSDELALG-AWRAMVRRGDER  120

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E  +  A+E MEK+E  + G +FFGG  IGYLDL  GW+   LP++EE+ S+
Sbjct  121  EKVLKEAIEVMEKIEQLIKGNKFFGGNNIGYLDLAFGWITCWLPVWEEIGSM  172



>ref|XP_002277759.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  RV+WAL++KG+ YEY+EED+ NK+P+L Q NPVH KVPVLV +G+P+
Sbjct  4    VKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVQDGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDE WK  PLLP DP ERA+ RFWA F + K +  AW A C+KG ++E A+
Sbjct  64   AESLVILEYIDEAWKGYPLLPEDPSERAKTRFWARFTDEKCVLGAWAACCAKGHEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
             SA E++  LE ++ GK+FFGGE +G LDLVVG + + +   EE
Sbjct  124  ESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEE  167



>ref|XP_010238250.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   177 bits (449),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 126/178 (71%), Gaps = 8/178 (4%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G W SP  +R++WALR+K + YEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRLEWALRLKSVVYEYVDEDLGNKSDALLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILD-------PAWEA  383
            GKP+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FA+ K L+         +  
Sbjct  62   GKPVVESAIIVEYIDEAWKDGYPIMPADPYERAQARFWANFADEKDLNGFVQCNAAVYPV  121

Query  384  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
              + G+ Q   V+ A + ++ LE  L GK+FFGG+ +GYLDLVVGW A+ LPI EEV+
Sbjct  122  FTATGEAQGKVVHEAQQCLKTLEKALEGKKFFGGDAVGYLDLVVGWYAYWLPIIEEVS  179



>ref|XP_002322571.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|EEF04332.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|ADB11390.1| tau class glutathione transferase GSTU24 [Populus trichocarpa]
Length=225

 Score =   177 bits (448),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LRV WAL++KG+E++ I ED+ NK+PLL Q NP+H KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSRFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L    W  L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L I EE+  L
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLDIIEEILGL  173



>ref|XP_006376726.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
 gb|ERP54523.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
Length=225

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG+EYEY++ED++NK+ LL + NPVH KVPVL+H+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLIHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FA+ K +  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCVMGAFVAFLKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+ H L   EE   +
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPHWLNAIEEAGGM  172



>ref|XP_010939722.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=237

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 126/179 (70%), Gaps = 2/179 (1%)
 Frame = +3

Query  33   VVIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNK-TPLLSQLNPVHAKV  209
            +V   AE+ +K+ G W SPF LR +WAL++KG+EYEY+EED+F+K +  L + NPV  KV
Sbjct  12   IVEAMAEKRVKLFGMWCSPFALRAEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKV  71

Query  210  PVLVHNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEAL  386
            PVLVH+GKP+ ESL+I+EY+DE WK   P+LP DPYERA+ARFWA FAE KI    +   
Sbjct  72   PVLVHDGKPIAESLVIIEYVDEVWKDGYPILPKDPYERAQARFWAKFAEDKINPATFAVY  131

Query  387  CSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             + G+QQ+ A+  A E  + LE  L GK+FFGGE IG++D+  GW+   + I EE+  +
Sbjct  132  STTGEQQQKALQDAQEVFKTLEEALKGKKFFGGETIGFVDIAAGWLPCWVRIIEEIVGI  190



>ref|NP_001234091.1| uncharacterized protein LOC543816 [Solanum lycopersicum]
 gb|AAG16759.1| putative glutathione S-transferase T4 [Solanum lycopersicum]
Length=226

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG++YEYI+ED+ NK+ LL + NPVH K+PVL+H+ KP+
Sbjct  4    VKLIGSSGSLFCTRVEWALKLKGVDYEYIQEDLLNKSELLIKSNPVHKKIPVLLHDDKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC--SKGKQQES  413
             ESLLILEYIDETWK  PLLP DP+ERA ARFWA F + K +  +WEA+    +G+ +  
Sbjct  64   VESLLILEYIDETWKGYPLLPQDPHERATARFWAKFVDDKCVIGSWEAMAMQDEGEAKTK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ S  E    +E ++ GK+FFGGE+IGYLDLV+GW    L   EEV ++
Sbjct  124  AIESIQELYAFIEKQIEGKKFFGGEQIGYLDLVMGWKTLWLSAMEEVGNV  173



>gb|KEH35720.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=223

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K + PA+ A  SK G++
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV-PAFIATFSKIGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            Q+ A   A E ++ LE+ L G+++FGGE IG+ D+ VG+    + + EE   +
Sbjct  121  QQEAAQEARENLKILESGLEGRRYFGGENIGFADIAVGFFGRWVRVVEETVGI  173



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 1/173 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNK-TPLLSQLNPVHAKVPVL  218
            MA    +K+ GFW SP+ LRV W L++K + Y+Y+EED+ NK + LL Q NPVH KVPVL
Sbjct  1    MADGGEVKLHGFWGSPYALRVIWTLKLKQVPYDYLEEDLPNKKSSLLLQYNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+GKP+PESL+ILEYIDETWK +PLLP DPYERAR RFWA FA+ K +       C++G
Sbjct  61   VHHGKPIPESLVILEYIDETWKQSPLLPQDPYERARVRFWAKFADEKCMPAMKAVFCTEG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            ++Q+ AV  A E ++ LE+ L GK FFGGE I + D+  G++     I EE+ 
Sbjct  121  EEQQKAVLEARETLKTLESGLEGKLFFGGETINFADVATGYIGCWARIVEEIT  173



>ref|NP_001234986.1| glutathione S-transferase GST 19 [Glycine max]
 gb|AAG34809.1|AF243374_1 glutathione S-transferase GST 19 [Glycine max]
 gb|ACU14422.1| unknown [Glycine max]
 gb|AFS51730.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN41696.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59650.1| tau class glutathione S-transferase [Glycine max]
Length=225

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++    S    RV+WALR+KG+EYEY++ED+ NK+ LL Q NPVH KVPVL+HN K
Sbjct  2    EEVKLIATHQSFPCARVEWALRIKGVEYEYLKEDLANKSSLLLQSNPVHKKVPVLLHNNK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NPLLP DPYERA+ARFWA F + K +   W A  ++G+++E 
Sbjct  62   PIAESLVILEYIDETWKKNPLLPLDPYERAQARFWARFIDEKCVLAVWGATVAQGEEKEK  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVA  527
            AV +A+E++  LE E+ GK++FGGEKIGYLD+  G ++
Sbjct  122  AVGAALESLALLEKEIQGKKYFGGEKIGYLDIAAGCMS  159



>gb|AFK37185.1| unknown [Medicago truncatula]
Length=223

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K + PA+ A  SK G++
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV-PAFIATFSKIGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            Q+ A   A E ++ LE+ L G+++FGGE IG+ D+ VG+    + + EE   +
Sbjct  121  QQEAAQEARENLKILESGLEGRRYFGGENIGFADIAVGFFGRWVRVVEETVGI  173



>gb|KJB28257.1| hypothetical protein B456_005G037700 [Gossypium raimondii]
Length=224

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWASPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F E K   P W+     G++Q+ A
Sbjct  64   IAESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIEEKT-QPMWDFFRKFGEEQQKA  122

Query  417  V-NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            + N+        E  L  K+FFGG++IG  DLV G V H L   EEV  
Sbjct  123  IENNYEILRTIEEHGLGDKKFFGGDQIGIADLVFGMVIHMLAPMEEVVG  171



>ref|XP_002881053.1| glutathione S-transferase 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57312.1| glutathione S-transferase 19 [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EESVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K L ES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KILLESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQILTLGFRSLVKAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ GK FFGG+ IG+LD++ G
Sbjct  125  VAIEETREMLTFLEKEVTGKDFFGGKTIGFLDMIAG  160



>emb|CDP11462.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +3

Query  66   MVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ K+PVL+HNGK + E
Sbjct  44   LLGYWGSPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQSNPVYKKIPVLLHNGKSISE  103

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQESAVN  422
            SL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K + PA     SK G++ E  V 
Sbjct  104  SLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCV-PALVGTISKVGEELEKGVR  162

Query  423  SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
             A E ++ LE+ L+GK+ FGG KIG+ D+ +GW+A+   I +E
Sbjct  163  EAREHLKTLESGLDGKRCFGGAKIGFADVAIGWIAYLARIEQE  205



>gb|EYU26814.1| hypothetical protein MIMGU_mgv1a013348mg [Erythranthe guttata]
Length=223

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 118/172 (69%), Gaps = 0/172 (0%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K+   W SPF +RV  AL++KGL+YE I ED+ NK+  L   NP+H K+PV VHN
Sbjct  2    AEEEMKLFRSWSSPFGMRVVHALKIKGLQYETILEDLSNKSASLLNYNPIHKKIPVFVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            G P+ ESL+ILEYIDETW  +PLLP DPY ++ ARFWA F + K++   W    S+G  +
Sbjct  62   GNPICESLVILEYIDETWTQSPLLPQDPYAKSTARFWAKFGDDKVMPSIWSVFTSQGDAR  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            E A+  A   +E LE E+ GK+FFGGE IGY+DL  GW+A+ + I EE+  L
Sbjct  122  EEAIVQAKTNLEFLEEEIKGKKFFGGEAIGYVDLAFGWMANLIGILEEIIDL  173



>gb|KHG20964.1| Glutathione S-transferase U7 -like protein [Gossypium arboreum]
Length=225

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWPSPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F E K   P WE     G++Q+ A
Sbjct  64   IAESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIEEKT-QPMWEFFRKFGEEQQKA  122

Query  417  V-NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            + N+        E  L  K+FFGG++IG  DLV G V H L   EEV  
Sbjct  123  IENNYEILRTIEEHGLGDKKFFGGDQIGVADLVFGMVIHMLAPMEEVVG  171



>ref|XP_010243655.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=230

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K++GFW SP+V RV WAL++KG+EYEYIEEDIFNK+ +L + NPVH KVPVLVHNGKP
Sbjct  13   GVKLIGFWSSPYVYRVIWALKLKGVEYEYIEEDIFNKSDILLKYNPVHKKVPVLVHNGKP  72

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ES+++LEYIDETW  +P+LP D  ERA ARFWA FAE K     W    S G++ E A
Sbjct  73   IVESMVVLEYIDETWPEHPVLPEDAQERATARFWAKFAEDK-GSCIWAMFRSSGEKVEKA  131

Query  417  VNSameamekleaelNG-KQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
               ++E +  +E    G K+FFGG+ IG+ DL  G +AH L + E+V  +
Sbjct  132  KKESLEMLRTIEEHGLGEKKFFGGDTIGFADLAFGGIAHWLGVMEDVVGV  181



>ref|XP_002318530.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
 gb|EEE96750.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
Length=225

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG+EYEY++ED++NK+ LL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FA+ K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCLMGAFAAFWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+   L + EE   +
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGM  172



>ref|XP_002520477.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41890.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  RV+ ALR+KG++YEY EED+ NK  LL + NPVH K+PVLVHNGK
Sbjct  3    EEVKLMGMWASPFSRRVEMALRLKGIQYEYTEEDLRNKGELLLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESL+ILEYIDETW+ NP +P DPY RA  RFW  F E KIL  A++   ++G+++E 
Sbjct  63   TVAESLVILEYIDETWQDNPNMPKDPYNRAMTRFWVNFVEEKILQAAYKTRTAEGEEREQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLV  512
             +    + ++ LE EL GK+FFGGEKIGY+D+V
Sbjct  123  LIQGVHQDLKLLENELKGKEFFGGEKIGYVDIV  155



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK+ G W SPF  R++ AL++KG+EYEY+EEDIF NK+ LL + NPVH K+PVLVHNG
Sbjct  3    EELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ES +ILEYIDETW  NP+LP DPY+RA ARFWA F + K +   W++L S G ++E
Sbjct  63   KPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPEKE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E +  LE EL GK+FFGGE +G++D+V  ++ H +   +E A  
Sbjct  123  KANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGF  173



>ref|XP_011039096.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG+EYEY+EED+ NK+PLL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLEEDLLNKSPLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL ILEYIDE WK+ PLLP DPYERA ARFWA FA+ K +  A+ A   +G+++E A+
Sbjct  64   AESLFILEYIDERWKNYPLLPEDPYERAMARFWAKFADEKCVMGAFAAFRKEGEEREKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA+E+   +E ++ GK+FF G + IGYLDLV+GW+   L   EE   +
Sbjct  124  ESALESFTFVEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNAMEEAGGM  172



>ref|XP_008346936.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=275

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  60   VKLLRSWSSPFGLRIVWALQLKGIPYEXIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  119

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + +  +    WE+   +GK+QE  +
Sbjct  120  VESLIILEYVDETWKENPLLPEDPLERATARFWARYCDETVSPSIWESFTKEGKEQEEGI  179

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A E ++ LE EL GK+FFGGEKIG +D+ +GW+ +   +FE++  +
Sbjct  180  VKAKENLKYLEEELKGKKFFGGEKIGIVDIALGWLXYYESLFEDIVGM  227



>ref|XP_010037776.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49511.1| hypothetical protein EUGRSUZ_K03034 [Eucalyptus grandis]
Length=226

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK+ G W SPF  R++ AL++KG+EYEY+EEDIF NK+ LL + NPVH K+PVLVHNG
Sbjct  3    EELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ES +ILEYIDETW  NP+LP DPY+RA ARFWA F + K +   W++L S G ++E
Sbjct  63   KPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPEKE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E +  LE EL GK+FFGGE +G++D+V  ++ H +   +E A  
Sbjct  123  KANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGF  173



>ref|XP_002520474.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41887.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++YEYIEED+ NK+PLL   NPVH K+PVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYEYIEEDLSNKSPLLLSTNPVHKKIPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW+ NP+LP DPY+RA ARFWA F + KIL  A +   +K +++  
Sbjct  63   PIAESLVILEYIEETWQSNPILPKDPYDRAVARFWAKFVDEKILQTASKFRSAKEEEKLQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                  + ++ LE EL G++FFGGE IG++D+V+ ++ H   + +EV  +
Sbjct  123  IFEELGQHLKVLENELRGREFFGGESIGFVDIVIFFIVHWFQLRQEVMQI  172



>gb|KJB19709.1| hypothetical protein B456_003G127600 [Gossypium raimondii]
Length=236

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  +E +K+ G W SP+  RV+ AL++KG+ YEYIEED+ NK+ LL Q NPVH K+PVLV
Sbjct  12   MGDDEEVKVFGMWASPYSRRVELALKLKGIPYEYIEEDLSNKSALLIQHNPVHQKIPVLV  71

Query  222  HNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            HNGK +PESL+ILEYIDETW++NP LL  DPY+RA ARFWA F + KIL    +   + G
Sbjct  72   HNGKSIPESLVILEYIDETWRNNPILLSQDPYDRAMARFWAKFIDEKILSTTRKVSFTTG  131

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVA  527
            K+QE A+    E ++ LE E+ GK +FGGE IGY+D+V  ++ 
Sbjct  132  KEQEHAIEEVTEQLKLLETEVKGKAYFGGEGIGYVDIVANFLV  174



>ref|XP_006294917.1| hypothetical protein CARUB_v10023969mg, partial [Capsella rubella]
 gb|EOA27815.1| hypothetical protein CARUB_v10023969mg, partial [Capsella rubella]
Length=237

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    EEQDRNITVVIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQL  188
            ++ +R +  V+   EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKT LL +L
Sbjct  3    KQTNRGVDPVMAEKEESVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTSLLLEL  62

Query  189  NPVHAKVPVLVHNGKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKIL  365
            NPVH KVPVLVHN K LPES LI+EYID+TWK +NP+LP DPY++A ARFWA F + +IL
Sbjct  63   NPVHKKVPVLVHNDKVLPESHLIIEYIDQTWKNNNPILPQDPYDKAMARFWAKFIDEQIL  122

Query  366  DPAWEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
               + +L    K +E A+    E +  LE ++ GK FFGG+ +G+LD+V G
Sbjct  123  TLGFRSLVKAEKGREVAIEETQEMLMFLEKQVTGKDFFGGKTVGFLDMVAG  173



>ref|XP_002277724.2| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
 emb|CBI32812.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A E + ++G W SP  LR++WAL+ KG+ Y+ I+ED+ NK+  L   NP+H K+PVL+H 
Sbjct  2    AREEVTLLGMWASPLALRIEWALKCKGIWYKCIDEDLLNKSQRLLTHNPIHKKIPVLLHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-----CS  392
            GK +PESL+ILEYIDETWK NPLLP DPYERA ARFWA F + K     W  +       
Sbjct  62   GKSIPESLVILEYIDETWKQNPLLPEDPYERAMARFWAKFVDEK----CWTTIPGVFGNE  117

Query  393  KGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +G +QE +   A+E +  LE +L GK+FFGGE +G+LD+V GW+A+ LP  E++  L
Sbjct  118  RGDEQEKSKEKAIEELRILEKQLEGKKFFGGESVGFLDIVCGWIAYWLPFIEDITGL  174



>ref|XP_007209589.1| hypothetical protein PRUPE_ppa011268mg [Prunus persica]
 gb|EMJ10788.1| hypothetical protein PRUPE_ppa011268mg [Prunus persica]
Length=216

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  +++WAL+ KG+ YEYIEED+ NK+PLL Q NPVH K+PVLVH  KP+
Sbjct  4    VKVIGASLSLFCCKIEWALKHKGIAYEYIEEDLRNKSPLLLQYNPVHKKIPVLVHGEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW  NP+LP DP+E+A ARFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLIILEYIDETWTENPMLPEDPFEKAMARFWARYVDEKCVISAWTASRTKGHEQEKAL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             SA E+++ L   + G +FFGGE +G+LD VVG + + L   EE   +
Sbjct  124  ESAQESLQLLNKLIEGNKFFGGETMGFLDFVVGSLPNWLKFLEEFQGI  171



>ref|XP_002520476.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41889.1| glutathione s-transferase, putative [Ricinus communis]
Length=230

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK++G W SPF  R++ AL++KG++Y+YIE+D+ NK+PLL   NPVH K+PVL+HN  
Sbjct  3    EELKLLGTWASPFSHRIRLALKLKGIQYQYIEQDLSNKSPLLLMSNPVHKKIPVLLHNDS  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYID+TWKH+PLLP DPY+RA ARFWA F + KIL  A +   + GK++E 
Sbjct  63   PIAESLVILEYIDQTWKHHPLLPKDPYDRAIARFWAKFVDEKILQTALKGSAATGKEKEQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLV  512
             +    + ++ L  EL    FFGGE IGYLD+V
Sbjct  123  VIEEVDQYLKLLVNELKDNDFFGGESIGYLDIV  155



>ref|XP_010542655.1| PREDICTED: glutathione S-transferase U1-like [Tarenaya hassleriana]
Length=223

 Score =   174 bits (442),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G+W SP+  R++ AL++KG+ YEY+EED+FNK+PLL QLNP+H  +PVLVHNGK
Sbjct  3    EEVKLLGYWASPYSRRIEMALKLKGVPYEYLEEDVFNKSPLLLQLNPIHKTIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESLLILEYIDETW  NP+LP DPYERA ARFWA F + +I    +++L    K +E+
Sbjct  63   TINESLLILEYIDETWTQNPILPQDPYERAIARFWAKFVDDQIFSVGFKSLIRADKGREA  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             +      M  LE EL GK FFGG+K G++D+V G
Sbjct  123  VIEETQRLMMFLEKELIGKDFFGGKKPGFVDVVAG  157



>ref|XP_007016281.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33900.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=261

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E+ +K+ G W SP+  RV+ AL++KG+ YEY+EED+ +K+ LL + NPVH K+PVLV
Sbjct  38   MADEDEVKLFGMWASPYSRRVELALKLKGIPYEYVEEDLSSKSCLLLKYNPVHQKIPVLV  97

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+ILEYIDETW +NP+LP DPY+RA ARFWA F + K+L    +A  + GK
Sbjct  98   HNGKPIAESLVILEYIDETWTNNPILPQDPYDRAMARFWAKFIDEKLLMTTRKASVASGK  157

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
            ++E A+    E ++ LE+EL GK++F G  IGYLD+V  
Sbjct  158  EKEQAIEEITEQLKLLESELQGKEYFSGPSIGYLDIVAS  196



>gb|KJB27950.1| hypothetical protein B456_005G038200 [Gossypium raimondii]
Length=225

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWASPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F + +   P WE     G++Q+ A
Sbjct  64   IVESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIQ-ENTQPMWEFFAKHGEEQQKA  122

Query  417  VNSameamekleaelNG-KQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
            +    E +  +E    G K+FFGG++IG  DLV G V H L   EEV  
Sbjct  123  IKDNYEILRTIEEHGLGDKKFFGGDQIGVADLVFGMVIHMLAPMEEVVG  171



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E ++++G W SPF  R + AL++KG++YEYIEED+ NK+PLL + NPV+ K+PVLVH GK
Sbjct  26   EEVQLIGMWASPFNCRAQLALKLKGVQYEYIEEDLSNKSPLLLKYNPVYKKIPVLVHKGK  85

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWK+NP++P D Y  A ARFWA FA+  IL  A ++  +KG+++E 
Sbjct  86   PISESLVILEYIEETWKNNPIMPQDSYSTAIARFWANFADENILQTAIKSSKAKGEEREK  145

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              +   + ++ LE ELNGKQFFGG+ IGYLD+V   + H   +  EV  +
Sbjct  146  LWDEVCQNLKLLENELNGKQFFGGKNIGYLDIVAFSLVHWFQVANEVTQM  195



>ref|XP_007016280.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33899.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=221

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  RV+ AL++KG+ YEYIEED+ NK+P L + NP+H KVP+LVH  K
Sbjct  3    EEVKLFGMWASPFSRRVELALKLKGIPYEYIEEDLSNKSPSLLKYNPIHKKVPLLVHKEK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            PL ESL+ILEY+DETWK+NP+LP DPYERA ARFWA F + K+L  A +   S GK+QE 
Sbjct  63   PLAESLVILEYLDETWKNNPILPQDPYERAMARFWAKFIDEKLLPTAAKVSHSTGKEQEQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVV  515
             V    + ++ LE EL GK+FF G+ IGYLD+V 
Sbjct  123  GVEEVHQQLKILENELKGKEFFAGQSIGYLDIVA  156



>ref|NP_180510.1| glutathione S-transferase tau 1 [Arabidopsis thaliana]
 sp|Q9ZW30.1|GSTU1_ARATH RecName: Full=Glutathione S-transferase U1; Short=AtGSTU1; AltName: 
Full=GST class-tau member 1; AltName: Full=Glutathione 
S-transferase 19 [Arabidopsis thaliana]
 gb|AAG30132.1|AF288183_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAL16155.1|AF428387_1 At2g29490/F16P2.13 [Arabidopsis thaliana]
 gb|AAC95189.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAQ22631.1| At2g29490/F16P2.13 [Arabidopsis thaliana]
 gb|AEC08260.1| glutathione S-transferase TAU1 [Arabidopsis thaliana]
Length=224

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EESVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K L ES LILEYID+TWK++P+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KILLESHLILEYIDQTWKNSPILPQDPYEKAMARFWAKFIDDQILTLGFRSLVKAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ GK FFGG+ IG+LD++ G
Sbjct  125  VAIEETRELLMFLEKEVTGKDFFGGKTIGFLDMIAG  160



>ref|XP_011010098.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LRV WAL++KG+E++ I ED+ NK+PLL Q NP++ KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSSFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIYKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L     + L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVGDVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L IFEE+  L
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLGIFEEILGL  173



>ref|XP_008363399.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
 ref|XP_008364890.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=216

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  R++WAL+ KG+ YEYIEED+ NK+ LL + NPVH KVPVLVH  KP+
Sbjct  4    VKVIGASLSLFCCRIEWALKHKGIAYEYIEEDLRNKSHLLLRYNPVHKKVPVLVHGEKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW+ NPLLP DP+E+A ARFWA + + K +  AW A  +KG +QE ++
Sbjct  64   AESLVILEYIDETWRENPLLPEDPFEKAXARFWAKYVDEKCVISAWTASRTKGHEQEKSL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
             +A E++E L   + GK+FFGGE IG+LDLVVG + + L   EE
Sbjct  124  EAARESLEVLNKLIEGKKFFGGEIIGFLDLVVGTLPNWLKFLEE  167



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+  L++KG+EYEY+EED+F NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIVLKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYIDETWK NP+LP DPYERA ARFWA F + K     W++  S G ++E
Sbjct  63   KPIAESLVILEYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E +  LE EL GK+FFGGE +G+LD+V  +V +   + +E   +
Sbjct  123  KAHEEAQELLSTLEGELEGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGV  173



>ref|XP_007026866.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07368.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=224

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFN---KTPLLSQLNPVHAKVPVLVH  224
            E +K+ G W SPF  RV+ AL +KG+ +EYIEE++ +   K+PLL + NP+H KVPVL+H
Sbjct  3    EEVKLFGAWGSPFSRRVEIALELKGIPFEYIEENVSDDKFKSPLLLKYNPIHKKVPVLLH  62

Query  225  NGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            NGKP+ ESL+ILEY+DETWK NP+LP DP+ER  ARFWA F + K + P W+AL   G++
Sbjct  63   NGKPVLESLIILEYVDETWKDNPILPEDPHERTMARFWARFIDEKCMPPVWKALLGTGEE  122

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            +E A+    E ++ LE  LNGK+FFGGE IG LD+   ++A  L + +EV+ L
Sbjct  123  REKALEEVRECLKTLEGVLNGKRFFGGETIGLLDIAANFIAFWLRVIQEVSGL  175



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+ AL++KG+EYEY+EED+F NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIALKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+IL+YIDETWK NP+LP DPYERA ARFWA F + K     W++  S G ++E
Sbjct  63   KPIAESLVILKYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             A   A E +  LE EL GK+FFGGE +G+LD+V  +V +   + +E   +
Sbjct  123  KAHEEAQELLSTLEGELKGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGV  173



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G WVS F LRV+ AL++KG++YEYIE D+ NK+PLL + NPVH KVPVL+HNGK
Sbjct  3    EEVKLIGMWVSSFSLRVEIALKLKGVQYEYIEVDLTNKSPLLLKSNPVHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP  PY+RA ARFWA + + K +   W+A   + K++E 
Sbjct  63   PIAESLVILEYIDETWKDNPILPQHPYDRAMARFWAKYIDEKCVPALWKACWCEEKEREK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVA  527
            AV  A   ++ LE EL  K+FFGGE +G++D+V  ++ 
Sbjct  123  AVEEACVCLKTLENELKDKKFFGGESVGFVDIVANFIG  160



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+ G W SPF +RV+ AL++KG+EYE++EED+ +K+  L++ NP+H KVPVL+H+GK 
Sbjct  2    GVKIYGTWASPFSMRVEIALQIKGIEYEFVEEDLLHKSDELAKYNPIHKKVPVLIHDGKV  61

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDETWK NP+LP D Y++A+ARFWA F + K+      AL S+G++ E A
Sbjct  62   MVESLVILEYIDETWKANPILPTDAYQKAQARFWAKFVDDKVTPLVRSALMSEGEESEKA  121

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV  554
            +    E ++ LE+E+ GKQFFGG+ IGYLD+V   V   +   +EV
Sbjct  122  IPQLDEVLQILESEIKGKQFFGGKSIGYLDIVASMVPFWITCLQEV  167



>ref|XP_002881054.1| glutathione-s-transferase 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57313.1| glutathione-s-transferase 9 [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  EE ++++GFW SPF  RVK AL++KG+ YEY+EED+ NK+PLL +LNPVH KVPVLV
Sbjct  1    MEKEEEVRLLGFWASPFTCRVKMALKLKGVPYEYLEEDLMNKSPLLLELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES LILEYID+TW +NP+LP DPY++A AR  A F + ++    + +L    K
Sbjct  61   HNGKPILESNLILEYIDQTWTNNPILPQDPYDKAMARLLAKFVDEQVAPAGFRSLVKAEK  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
              E A+  A E +  LE E+ GK F+GG+ IG+LD++VG
Sbjct  121  GIEVAIEEARELIMFLEKEVTGKDFYGGKTIGFLDMIVG  159



>gb|ABW81199.1| glutathione-S-transferase 9 [Arabidopsis cebennensis]
Length=228

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  EE ++++GFW SPF  RVK AL++KG+ YEY+EED+ NK+PLL +LNPVH KVPVLV
Sbjct  1    MEKEEEVRLLGFWASPFTCRVKMALKLKGVPYEYLEEDLLNKSPLLLELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES LILEYID+TW +NP+LP DPY++A ARF A F + ++    + +L     
Sbjct  61   HNGKPILESNLILEYIDQTWTNNPILPQDPYDKAMARFLAKFVDEQVAPAGFRSLVKAEN  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
              E A+  A E +  LE E+ G  FFGG+ IG+LD+VVG
Sbjct  121  GIEVAIEEARELIMFLEKEVTGNDFFGGKAIGFLDMVVG  159



>ref|XP_009141006.1| PREDICTED: glutathione S-transferase U2 [Brassica rapa]
Length=256

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW+SPF  RV+ AL++KG+ YEY+EED+  KTPLL +LNPVH KVPVLVHN 
Sbjct  5    EESVKLLGFWISPFSRRVEMALKLKGVPYEYLEEDLPKKTPLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K L ES +ILEYID+TW +NP+LP DPYE+A ARFWA F + +IL   +  L    K  E
Sbjct  65   KILSESHVILEYIDQTWSNNPILPQDPYEKAMARFWAKFVDEQILPAGFMPLVKPKKGIE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ GK FFGGE IG+LD+V G
Sbjct  125  VAIEETRELIMFLEKEVTGKDFFGGETIGFLDMVAG  160



>gb|KJB80746.1| hypothetical protein B456_013G113600 [Gossypium raimondii]
Length=226

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 1/176 (1%)
 Frame = +3

Query  39   IMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            +  A E LK++G   S F  RV WAL++KG+EYE+IEED+ +K+ LL  LNPVH KVPVL
Sbjct  1    MAGAAEDLKVLGTKQSMFTQRVVWALKLKGVEYEFIEEDLVHKSSLLLALNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+GKP+ ES +ILEY+DETWK  PLLP DP ERA  RFWA F + K+++ + +A  S G
Sbjct  61   VHDGKPIAESKIILEYLDETWKERPLLPEDPRERANVRFWAAFIDDKLMEASKKAFVSTG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASL  563
              +  A+ S ME ++ LE EL GK++F G E IGY D+V GW+A+ L   EE+   
Sbjct  121  DDRAKAMESTMEGLKLLEQELQGKKYFSGDEGIGYFDIVAGWIAYWLQFIEEIGGF  176



>gb|AFY26875.1| glutathione-S-transferase [Ipomoea batatas]
Length=224

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G   S F  RV+WALR+KG++YEYI+ED+ NK+ LL + NPV+ KVPVL+ N  
Sbjct  2    EEVKLIGSSPSLFCTRVEWALRLKGVKYEYIKEDLRNKSDLLLKSNPVYKKVPVLLINHN  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESL+ILEYID++WKH PLLP DP+ERA+ARFWA FA+ K L   W A  ++G+++  
Sbjct  62   SIAESLIILEYIDDSWKHYPLLPQDPFERAQARFWAKFADDKCLMGTWTACMAEGEEKVR  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+ S  E+   +E ++ GK+FFGGE+IG+LDL +GW+   L + EEV  +
Sbjct  122  AIESVQESFAFIEKQIEGKKFFGGEEIGFLDLGIGWICLWLNVMEEVGGM  171



>ref|XP_011092669.1| PREDICTED: glutathione S-transferase U7-like [Sesamum indicum]
Length=230

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 0/172 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M+  E +K++G  VSPF  R+ WAL+ KG+++E+IEED+ NK+PLLS+ NPV+  +PVL 
Sbjct  1    MSNNETVKLLGTGVSPFEWRIIWALKWKGIDFEFIEEDVSNKSPLLSEKNPVYKMIPVLF  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H    + ESL+ILEYIDETWK NP+LPADP ERA ARFWA F+E KIL+ +  A    G 
Sbjct  61   HAQNAVSESLIILEYIDETWKENPILPADPTERAYARFWAKFSEEKILEASRLAFHYTGN  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVA  557
            +Q   V    E++E LE E+ GK+FFGG+  GYLD+VVGW+A+ L   +E  
Sbjct  121  KQAEGVKLMSESLEILEGEIRGKKFFGGQTFGYLDIVVGWIAYWLHFTQEAG  172



>ref|XP_010414381.1| PREDICTED: glutathione S-transferase U1-like [Camelina sativa]
Length=224

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKT LL +LNP+H KVPVLVHN 
Sbjct  5    EECVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTSLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPHDPYEKAMARFWAKFIDEQILSLGFRSLVEAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ G+ FFGG+ IG+LD+V G
Sbjct  125  VAIEETQEMLMFLEKEVIGQDFFGGKTIGFLDMVAG  160



>ref|XP_004229525.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 4/176 (2%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SPF LR+ WAL +KG+EYE I ED+  K+P L Q NPVH K+PVLV
Sbjct  1    MADE--VKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLSQKSPQLLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETWK   PLLP DPYE+A ARFWA F E K+L   W     +G
Sbjct  59   HKGKPICESLVILEYIDETWKETAPLLPQDPYEKAMARFWAKFVEDKLLPSVWSIFTEQG  118

Query  399  -KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
               ++ A   A++ +E +E +L  K+FFGGE IGY+DLV+GW+A+ L +FEEV  L
Sbjct  119  YDAKKEAFVPAVQNLEIIEEQLKEKKFFGGESIGYVDLVLGWMAYLLDVFEEVLDL  174



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  R++ AL++KG+++EYIEE++ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLXNKSPALLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+   A + + SKG++Q++
Sbjct  63   PVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQKA  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVAS  560
             +    E ++ LE+EL  K+FFGGE +G++D     +A N+ +F  VA 
Sbjct  123  VIEEIQEQLKTLESELKEKKFFGGESLGFVD-----IAANIIVFLLVAQ  166



>gb|KDP34500.1| hypothetical protein JCGZ_11050 [Jatropha curcas]
Length=224

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 126/170 (74%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++Y YIEED+FNK+PLL Q NPVH KVPVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYHYIEEDLFNKSPLLLQSNPVHKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+IL+YI+ETW++NP+LP DPY+RA  RFWA F + KIL  A +   +KG++++ 
Sbjct  63   PISESLVILDYIEETWQNNPILPKDPYDRAVVRFWAKFIDEKILKIASKFKAAKGEEKKQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +    E ++ LE EL  K+FFGGE IGYLD+V  ++ +   + +EV  +
Sbjct  123  VLEELGEQLKILEKELEEKEFFGGETIGYLDIVAFFIVYWFQVRQEVLQI  172



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 121/170 (71%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G+WVSPF   V+ AL +KG++YEYIEED+ NK+P L Q NPV+ K+PVL+HNGK
Sbjct  2    EEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEEDLTNKSPQLLQYNPVYKKIPVLLHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES++ILEYIDETWK+NP+LP DP+E+ARARFWA F + K     W+ + S  +Q E 
Sbjct  62   PIVESMVILEYIDETWKNNPILPEDPFEKARARFWANFVDQKCFPALWKTIWSTSEQYEQ  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
                A+E ++ LE EL GK+FFGG+ IG +D+V  ++  +    +E   L
Sbjct  122  NKAEALERLKVLENELGGKRFFGGDSIGMVDIVANFIGFSFRTIQEALKL  171



>ref|XP_008806389.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +3

Query  48   AEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
             EEG+K+ G  +SPFVLRV+WAL++KG++YEY+ ED+ NK+P L Q NPVH  VPVLVHN
Sbjct  2    GEEGVKLYGNILSPFVLRVEWALQLKGIKYEYVNEDLLNKSPQLLQYNPVHKMVPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKH-NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP  ES++I+EYIDE W    PLLP++PY++A  RFWA F E K L  +++     G++
Sbjct  62   GKPTAESVVIVEYIDEAWSDLYPLLPSNPYQKANTRFWAKFVEEKCLHGSFDVFSKVGEE  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVA  527
            Q   V    E+++ LE  L GK+FFGGE IG++D++ GW+A
Sbjct  122  QLRGVKEMQESLKTLEGHLEGKKFFGGETIGFVDIIAGWMA  162



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYI+ED+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIDEDLANKSPLLLKYNPIHKKVPVLLHNGKTM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K +   W+ + SK  ++E A+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCMPAIWQIMLSKENEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              A++ ++ LE EL  K+FFGGE IG +D+V  ++   L   +E   +
Sbjct  124  EEAIQHLKTLENELKDKKFFGGETIGLVDIVANFIGFWLGAAQEATGM  171



>gb|KCW65098.1| hypothetical protein EUGRSUZ_G02603 [Eucalyptus grandis]
Length=213

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 121/170 (71%), Gaps = 11/170 (6%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SP+ LRV WAL++KG++YE + ED+  K+ L+ + NPV+ KVPVL+HNG+
Sbjct  3    EEVKLFRTWSSPYALRVVWALQLKGIQYESVLEDVSEKSDLVRRYNPVYKKVPVLLHNGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK +PLLP DPY R  ARFWA             A  S+GK+QE+
Sbjct  63   PISESLIILEYIDETWKQHPLLPRDPYARTMARFWAN-----------SATTSEGKEQEA  111

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A E ++KLE  L GK+FF G+ IGYLD+ +GW+A+ + +FEE+ SL
Sbjct  112  ALAEASEHLQKLEEVLRGKKFFSGDNIGYLDIALGWLANLIRVFEEICSL  161



>ref|XP_006849222.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
 gb|ERN10803.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
Length=226

 Score =   172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = +3

Query  39   IMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            + + E+ ++++G + SPFV RV+ AL++KG+EYEYIEED+ NK+PLL + NPVH K+PVL
Sbjct  1    MASKEQRVRLLGSFRSPFVHRVQLALKLKGIEYEYIEEDLKNKSPLLLKANPVHKKIPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +H  KP+ ES++ILEYI+ETW  NP+LP DPY+RA+ARFWA F + K+L   W A  ++G
Sbjct  61   IHGDKPVCESVVILEYIEETWPENPILPKDPYDRAQARFWAKFIDEKVLLACWTAYSTQG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             QQ  A+    E+++ LE  L GK FFGGE IG+LD+V  +++  + +  E A++
Sbjct  121  VQQAKALEEFQESLKTLERGLKGK-FFGGENIGFLDIVANFLSLWMGVLGEAANI  174



>emb|CDY51364.1| BnaA04g28580D [Brassica napus]
Length=224

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW+SPF  RV+ AL++KG+ YEY+EED+  KTPLL +LNPVH KVPVLVHN 
Sbjct  5    EECVKLLGFWISPFSRRVEMALKLKGVPYEYLEEDLPKKTPLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K L ES +ILEYID+TW +NP LP DPYE+A ARFWA F + +IL   +  L    K  E
Sbjct  65   KILSESHVILEYIDQTWSNNPFLPQDPYEKAMARFWAKFVDEQILAAGFMPLIKPKKGIE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+    E +  LE E+ GK FFGGE IG+LD+V G
Sbjct  125  VAIEETRELIMFLEKEVTGKDFFGGETIGFLDMVAG  160



>ref|XP_007029718.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY10220.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=233

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEE---DIFNKTPLLSQLNPVHAKVPVLVHNG  230
            +K+VG W SP+V RV W L++KG++YE++EE   D+  K+  L   NPV+ KVPVL+H+G
Sbjct  11   VKLVGAWYSPYVHRVAWVLKLKGIQYEFVEENLRDLNKKSSFLLDCNPVYKKVPVLLHHG  70

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL I+EYIDETWKHNP+ P DPY+RA ARFWA   +  +L+ +  ALC++G Q +
Sbjct  71   KPIVESLFIIEYIDETWKHNPIFPTDPYDRAMARFWARLMDEMLLEGSKRALCAEGDQLK  130

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              +    +AME LE    GK+FFGGE +G+LD+  GW    L   EEVA +
Sbjct  131  KEIEQVSDAMEVLEGMKKGKKFFGGETVGFLDVAFGWTTIWLEAIEEVAGV  181



>ref|NP_001238721.1| glutathione S-transferase GST 13 [Glycine max]
 gb|AAG34803.1|AF243368_1 glutathione S-transferase GST 13 [Glycine max]
 gb|KHN47445.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59653.1| tau class glutathione S-transferase [Glycine max]
Length=220

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE ++++G W SPF  RV  AL++KG+ Y+Y EED+ NK+  L + NPVH KVPVLVHNG
Sbjct  6    EEEVRLLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLKYNPVHKKVPVLVHNG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             PLPESL+I+EYIDETWK+NPLLP DPYERA ARFW+   + KIL   W A  S    +E
Sbjct  66   NPLPESLIIVEYIDETWKNNPLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENGRE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             AV  A+EA++ L+  L  K+FFGGE IG +D+   ++ + + I +E+A L
Sbjct  126  KAVEEALEALKILQETLKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGL  176



>ref|XP_009347672.1| PREDICTED: glutathione S-transferase U8-like [Pyrus x bretschneideri]
Length=224

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  57   GLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+     S F  R++WAL++KG+EYE+I ED+ NK+PLL + NP++ KVPVLVH    
Sbjct  3    GVKLFATKESLFSARIQWALKLKGVEYEFILEDLANKSPLLLKYNPIYKKVPVLVHGDNV  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYI+ETWK +PLLP D Y+RA ARFWA F + K++ P W A   +G+ QE A
Sbjct  63   IVESLVILEYIEETWKEHPLLPRDSYDRATARFWAKFNDEKLVPPVWTACTGEGEAQEKA  122

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEE  551
              S +E++  LE ++ GK+FFGGE+IGYLDLV+GW+++ +   EE
Sbjct  123  KESVLESLALLEKQIEGKKFFGGEQIGYLDLVLGWISYWISAVEE  167



>ref|XP_004301267.1| PREDICTED: glutathione S-transferase U7-like [Fragaria vesca 
subsp. vesca]
Length=216

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +S F  R++WAL+ K + YEYIEED+ NK+ LL + NPVH K+PVL+H  KP+
Sbjct  4    VKVLGASLSLFCCRIEWALKHKVITYEYIEEDLRNKSTLLLKSNPVHKKIPVLLHGDKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW+ NPLLP DP+E+A  RFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLVILEYIDETWRENPLLPDDPFEKAMVRFWAKYVDEKCVISAWTASRTKGHEQEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             S  E+++ L   + GK+FFGGE IG+LDLVVG + + +   EE   +
Sbjct  124  ESTQESLKLLNKLIEGKKFFGGETIGFLDLVVGSLPNWIKFIEEFVGI  171



>ref|XP_006354571.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354572.1| PREDICTED: glutathione transferase GST 23-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006354573.1| PREDICTED: glutathione transferase GST 23-like isoform X4 [Solanum 
tuberosum]
Length=223

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SP+ LR+ WA+ +KG+EYE + ED+  K+P L Q NPVH K+PVLV
Sbjct  1    MADE--VKLYRTWSSPYGLRIVWAMHIKGIEYENVFEDLSQKSPQLLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKH-NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETWK   PLLP DPYE+A ARFWA F + K+L   W     KG
Sbjct  59   HKGKPICESLVILEYIDETWKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVWSVFTEKG  118

Query  399  KQ-QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             + ++ A+  A++ +E +E +L  K+FFGGE IGY+DL +GWVA+ L +FEEV  L
Sbjct  119  YEAKKEALVPAVQNLEIIEEQLKEKKFFGGESIGYVDLALGWVAYLLDVFEEVIDL  174



>gb|KJB28236.1| hypothetical protein B456_005G036300 [Gossypium raimondii]
Length=247

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   QDRNITVVIMAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLN  191
            Q R+ T   M  E  +K+ GFW SPF LRV WAL++KG++YEYIEEDI  NK+ LL + N
Sbjct  15   QTRDQTSHTMDDE--VKLFGFWASPFSLRVIWALKLKGVDYEYIEEDIPHNKSELLLKYN  72

Query  192  PVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP  371
            PV+ K+PVLVH GKP+ ESL+ILEYIDE W H+PLLP D YER+ ARFWA F + KI  P
Sbjct  73   PVYKKIPVLVHGGKPIAESLVILEYIDEVWPHSPLLPKDAYERSVARFWAKFIDEKI-RP  131

Query  372  AWEALCSKGKQQESAV-NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFE  548
             WE     G++Q+ A+ N+        E  L  K+FFGG++IG  DL+ G V H     E
Sbjct  132  MWEFFHKFGEEQQKAIENNFKILRTIEEHGLGDKKFFGGDQIGIADLIFGMVIHYFAPME  191

Query  549  EVASL  563
            +V  +
Sbjct  192  DVMGV  196



>ref|XP_002518184.1| glutathione s-transferase, putative [Ricinus communis]
 pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family 
Member From Ricinus Communis, Target Efi-501866
 gb|EEF44317.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 120/173 (69%), Gaps = 4/173 (2%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+ G W SPF  RV WAL++KG+ YEY+EED+FNK+PLL Q NPVH K+PVLVH GK
Sbjct  3    EVLKLHGAWPSPFSCRVIWALKLKGIPYEYVEEDLFNKSPLLLQYNPVHKKIPVLVHGGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES +ILEY+DETW  NPLLP+DP+ERA ARFW  F E K     W    +KG++ E 
Sbjct  63   PICESTIILEYLDETWPENPLLPSDPHERAVARFWVKFIEDK-GTAIWNIFRTKGEELEK  121

Query  414  AVNSameamekleaelNG---KQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            AV + +E ++ +E    G    ++FGG+KIG +D+    +AH L + EEVA +
Sbjct  122  AVKNCLEVLKTIEEHAMGVSDDKYFGGDKIGIVDIAFCGIAHWLGVIEEVAGV  174



>gb|ADB11374.1| tau class glutathione transferase GSTU50 [Populus trichocarpa]
Length=219

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV WAL++KG+ YEYIEED+ NK+PLL Q NPVH K+PVL+H GK +
Sbjct  4    VKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY++ETW   PL+P DPYERARARFW  F E K +   W    S G++QE AV
Sbjct  64   CESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFYSSGEEQEKAV  122

Query  420  -NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +S        E  L  K+FF G+KI  +D+  GW+A  L + EEVA +
Sbjct  123  KDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLEVLEEVAGI  171



>gb|ACU15611.1| unknown [Glycine max]
Length=217

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = +3

Query  51   EEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE ++++G W SPF  RV  AL++KG+ Y+Y EED+ NK+  L + NPVH KVPVLVHNG
Sbjct  6    EEEVRLLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLKYNPVHKKVPVLVHNG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             PLPESL+I+EYIDETWK+NPLLP DPYERA ARFW+   + KIL   W A  S    +E
Sbjct  66   NPLPESLIIVEYIDETWKNNPLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENGRE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             AV  A+EA++ L+  L  K+FFGGE IG +D+    + + + I +E+A L
Sbjct  126  KAVEEALEALKILQETLKDKKFFGGESIGLVDIAANLIGYWVAILQEIAGL  176



>gb|ADB11377.1| putative tau class glutathione transferase GSTU53 [Populus trichocarpa]
Length=219

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +3

Query  60   LKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV WAL++KG+ YEYIEED+ NK+PLL Q NPVH K+PVL+H GK +
Sbjct  4    VKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY++ETW   PL+P DPYERARARFW  F E K +   W    S G++QE AV
Sbjct  64   CESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFHSSGEEQEKAV  122

Query  420  -NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
             +S        E  L  K+FF G+KI  +D+  GW+A  L + EEVA +
Sbjct  123  KDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLAVLEEVAGI  171



>ref|XP_010521903.1| PREDICTED: glutathione S-transferase U1-like [Tarenaya hassleriana]
 gb|ABW81097.1| GST20 [Cleome spinosa]
Length=221

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = +3

Query  42   MAAEEGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++  W  PF  RV+ AL++KG+ Y+Y+E+D+ NK+PLL Q+NPVH +VPV V
Sbjct  1    MAEKEEVKLLSLWALPFGHRVEIALKLKGVPYDYLEQDLRNKSPLLLQMNPVHKQVPVFV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNG+P+ ESL+ILEYIDETW   P+LP DPY+RA ARFWA F + KI+    +++    K
Sbjct  61   HNGRPIAESLVILEYIDETWTQYPILPRDPYDRAMARFWAKFVDEKIVSAGLKSVVKAEK  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             +E+A+    + M+ LE EL GK FFGGE++G+LDLV G
Sbjct  121  GREAAIEETQQLMKLLEKELVGKDFFGGERVGFLDLVAG  159



>ref|XP_006410006.1| hypothetical protein EUTSA_v10017660mg [Eutrema salsugineum]
 gb|ESQ51459.1| hypothetical protein EUTSA_v10017660mg [Eutrema salsugineum]
Length=223

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  42   MAAEEGL-KMVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPV  215
            MA  EG+ K++GFW SPF  RV+ AL++KG+ YEY+EED+  NK+PLL +LNPVH KVPV
Sbjct  1    MAENEGVVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNNKSPLLLELNPVHKKVPV  60

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVHNGK LPES LILEYID+TW+ NP+LP DPY+++ ARFWA F + +++   + +L   
Sbjct  61   LVHNGKILPESHLILEYIDKTWQSNPILPQDPYQKSMARFWAKFVDEQVITLGFRSLVKA  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWV  524
             K +E A+  A E +  LE E+ GK FFGG+ IG++D+V G +
Sbjct  121  EKGREVAIEEAREIIMFLEKEVTGKDFFGGKTIGFVDMVAGSI  163



>ref|XP_009606213.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=224

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = +3

Query  54   EGLKMVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SPF LR  WAL +KG++YE I ED+  K+P L Q NPVH K+PVLVH GK
Sbjct  3    EELKLHRTWSSPFGLRAVWALHIKGIQYETIFEDLSQKSPELLQHNPVHKKIPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DPYE+A ARFWA F E K+L   W     +G ++  
Sbjct  63   PICESLVILEYIDETWKEAPLLPQDPYEKAIARFWAKFGEDKLLPSIWSVFTGQGNEKNE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
            A+  A++ +E LE +L  K+FFGGEKIGYLDL +G +A+   +FEEV  L
Sbjct  123  ALGPAVQNLELLEEQLKEKKFFGGEKIGYLDLSLGLLAYLRDVFEEVIDL  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920