BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003A12 595 bp,:Filtered

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       150   1e-39   Glycine max [soybeans]
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2       148   1e-39   Nicotiana sylvestris
ref|XP_003589238.1|  Patatin-like protein                               150   1e-39   Medicago truncatula
gb|KHN12765.1|  Patatin group A-3                                       149   2e-39   Glycine soja [wild soybean]
ref|XP_003589236.1|  Patatin-like protein                               149   3e-39   Medicago truncatula
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       149   3e-39   Nicotiana sylvestris
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  148   5e-39   Nicotiana tomentosiformis
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  148   6e-39   Glycine max [soybeans]
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       147   7e-39   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  147   8e-39   Nicotiana sylvestris
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       147   9e-39   Nicotiana sylvestris
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       147   9e-39   Cicer arietinum [garbanzo]
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       147   1e-38   Nicotiana sylvestris
ref|XP_003527713.1|  PREDICTED: patatin-like                            147   1e-38   Glycine max [soybeans]
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       145   3e-38   Solanum lycopersicum
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                  146   3e-38   Fragaria vesca subsp. vesca
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  145   3e-38   
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       146   4e-38   Solanum lycopersicum
emb|CDP02483.1|  unnamed protein product                                145   5e-38   Coffea canephora [robusta coffee]
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       145   7e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  149   7e-38   Solanum lycopersicum
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  144   1e-37   Solanum tuberosum [potatoes]
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  144   1e-37   Nicotiana sylvestris
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  144   1e-37   Oryza brachyantha
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2       143   1e-37   Nelumbo nucifera [Indian lotus]
gb|KHN04516.1|  Patatin group A-3                                       144   1e-37   Glycine soja [wild soybean]
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         144   2e-37   Solanum tuberosum [potatoes]
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         144   2e-37   Solanum tuberosum [potatoes]
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             144   2e-37   Prunus persica
emb|CDP01332.1|  unnamed protein product                                144   2e-37   Coffea canephora [robusta coffee]
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       143   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  143   4e-37   Cucumis melo [Oriental melon]
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             143   5e-37   Phaseolus vulgaris [French bean]
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  142   7e-37   Eucalyptus grandis [rose gum]
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       142   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58445.1|  hypothetical protein B456_009G210500                    142   9e-37   Gossypium raimondii
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        142   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       142   1e-36   Nicotiana tomentosiformis
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  142   1e-36   Solanum lycopersicum
gb|EMT12540.1|  Patatin group A-3                                       141   1e-36   Aegilops tauschii
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  142   1e-36   Nicotiana sylvestris
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  142   1e-36   Prunus mume [ume]
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       141   2e-36   Malus domestica [apple tree]
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    141   2e-36   
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  141   2e-36   Nicotiana tomentosiformis
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  140   3e-36   Sesamum indicum [beniseed]
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  140   3e-36   Solanum tuberosum [potatoes]
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  140   3e-36   Nicotiana sylvestris
gb|AFK35290.1|  unknown                                                 140   4e-36   Medicago truncatula
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  140   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK18751.1|  patatin-like protein                                    140   4e-36   Vigna unguiculata
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       140   4e-36   Pyrus x bretschneideri [bai li]
gb|AGS13487.1|  PLP protein                                             140   5e-36   Chimonanthus praecox [wintersweet]
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    140   6e-36   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                  140   7e-36   Brachypodium distachyon [annual false brome]
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  139   8e-36   Solanum tuberosum [potatoes]
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       139   1e-35   Populus euphratica
ref|XP_004980604.1|  PREDICTED: patatin-3-Kuras 1-like                  139   1e-35   
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      139   1e-35   Theobroma cacao [chocolate]
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             139   1e-35   Phaseolus vulgaris [French bean]
ref|XP_002445641.1|  hypothetical protein SORBIDRAFT_07g023230          139   1e-35   Sorghum bicolor [broomcorn]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             139   1e-35   Phaseolus vulgaris [French bean]
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       139   1e-35   Populus euphratica
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   139   1e-35   Citrus sinensis [Valencia orange]
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             139   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             138   2e-35   Populus trichocarpa [western balsam poplar]
emb|CDP07844.1|  unnamed protein product                                138   2e-35   Coffea canephora [robusta coffee]
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  138   2e-35   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     138   2e-35   Eucalyptus grandis [rose gum]
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       138   3e-35   Populus euphratica
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  138   3e-35   Elaeis guineensis
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  138   3e-35   Eucalyptus grandis [rose gum]
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          138   3e-35   Sorghum bicolor [broomcorn]
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         138   3e-35   Solanum tuberosum [potatoes]
ref|XP_010089434.1|  Patatin group A-3                                  138   3e-35   Morus notabilis
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       138   3e-35   
ref|XP_002310732.1|  patatin family protein                             138   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       138   4e-35   Populus euphratica
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  137   4e-35   Eucalyptus grandis [rose gum]
gb|ACU24007.1|  unknown                                                 132   4e-35   Glycine max [soybeans]
ref|XP_010101003.1|  Patatin group A-3                                  137   4e-35   Morus notabilis
emb|CBI19558.3|  unnamed protein product                                137   6e-35   Vitis vinifera
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  137   6e-35   Populus euphratica
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  137   7e-35   Populus euphratica
ref|XP_010064131.1|  PREDICTED: patatin-like protein 2                  133   7e-35   Eucalyptus grandis [rose gum]
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       137   8e-35   Cicer arietinum [garbanzo]
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         137   8e-35   Glycine max [soybeans]
ref|XP_003603015.1|  Patatin-like protein                               137   8e-35   Medicago truncatula
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       137   8e-35   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                         136   8e-35   Jatropha curcas
emb|CAN68798.1|  hypothetical protein VITISV_008805                     137   9e-35   Vitis vinifera
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  137   1e-34   Cucumis sativus [cucumbers]
emb|CBI19549.3|  unnamed protein product                                136   1e-34   Vitis vinifera
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  136   1e-34   Tarenaya hassleriana [spider flower]
gb|EMT06740.1|  Patatin group A-3                                       136   1e-34   Aegilops tauschii
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  136   1e-34   Vitis vinifera
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  136   1e-34   Vitis vinifera
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             135   2e-34   Prunus persica
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       135   2e-34   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          136   2e-34   Amborella trichopoda
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  135   2e-34   Solanum lycopersicum
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  135   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         135   2e-34   Jatropha curcas
dbj|BAK02816.1|  predicted protein                                      136   2e-34   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004291132.1|  PREDICTED: patatin-like protein 2                  135   2e-34   Fragaria vesca subsp. vesca
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg             135   2e-34   Citrus clementina
emb|CBI21444.3|  unnamed protein product                                135   3e-34   Vitis vinifera
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  135   3e-34   Vitis vinifera
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  135   3e-34   Setaria italica
ref|XP_002510259.1|  Patatin T5 precursor, putative                     135   3e-34   Ricinus communis
gb|KJB29508.1|  hypothetical protein B456_005G104200                    135   3e-34   Gossypium raimondii
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  135   3e-34   Brassica rapa
ref|XP_008241848.1|  PREDICTED: patatin-like protein 2                  135   3e-34   Prunus mume [ume]
emb|CBI19560.3|  unnamed protein product                                136   3e-34   Vitis vinifera
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                  134   3e-34   Eucalyptus grandis [rose gum]
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  135   3e-34   Vitis vinifera
emb|CDY21469.1|  BnaC03g27280D                                          135   3e-34   Brassica napus [oilseed rape]
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg             135   3e-34   Citrus clementina
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  135   3e-34   Cucumis melo [Oriental melon]
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  135   4e-34   
ref|XP_003603014.1|  Patatin-like protein                               135   4e-34   Medicago truncatula
emb|CDP07842.1|  unnamed protein product                                135   4e-34   Coffea canephora [robusta coffee]
emb|CBI19553.3|  unnamed protein product                                135   4e-34   Vitis vinifera
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         135   4e-34   
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  135   4e-34   Prunus mume [ume]
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                  135   4e-34   Fragaria vesca subsp. vesca
gb|KCW66173.1|  hypothetical protein EUGRSUZ_F00009                     131   4e-34   Eucalyptus grandis [rose gum]
gb|KDO79284.1|  hypothetical protein CISIN_1g0425841mg                  133   5e-34   Citrus sinensis [Valencia orange]
emb|CDP04311.1|  unnamed protein product                                134   5e-34   Coffea canephora [robusta coffee]
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             134   5e-34   Prunus persica
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  134   5e-34   Eucalyptus grandis [rose gum]
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                  134   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       135   5e-34   
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  134   5e-34   Vitis vinifera
ref|XP_004169210.1|  PREDICTED: patatin group A-3-like                  132   6e-34   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             134   6e-34   Prunus persica
gb|EAZ07347.1|  hypothetical protein OsI_29596                          134   6e-34   Oryza sativa Indica Group [Indian rice]
emb|CDP02475.1|  unnamed protein product                                134   6e-34   Coffea canephora [robusta coffee]
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                  133   6e-34   Pyrus x bretschneideri [bai li]
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     134   6e-34   Eucalyptus grandis [rose gum]
gb|AAB08427.1|  patatin homolog                                         131   7e-34   Nicotiana tabacum [American tobacco]
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             134   7e-34   Prunus persica
ref|XP_010098699.1|  Patatin group A-3                                  134   8e-34   Morus notabilis
gb|EAZ07350.1|  hypothetical protein OsI_29600                          134   8e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006645174.1|  PREDICTED: patatin-2-Kuras 4-like                  134   8e-34   Oryza brachyantha
ref|XP_006829699.1|  hypothetical protein AMTR_s00126p00054960          130   9e-34   
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  134   9e-34   Cucumis sativus [cucumbers]
gb|KFK30330.1|  hypothetical protein AALP_AA7G247800                    134   9e-34   Arabis alpina [alpine rockcress]
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  134   1e-33   Vitis vinifera
ref|XP_010102581.1|  Patatin group A-3                                  134   1e-33   Morus notabilis
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  134   1e-33   Citrus sinensis [Valencia orange]
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             134   1e-33   Citrus clementina
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             134   1e-33   Citrus clementina
ref|XP_004973690.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       134   1e-33   Setaria italica
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     134   1e-33   Eucalyptus grandis [rose gum]
emb|CDX83197.1|  BnaA03g23090D                                          134   1e-33   Brassica napus [oilseed rape]
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       134   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             133   1e-33   Citrus clementina
gb|KJB58444.1|  hypothetical protein B456_009G210400                    134   1e-33   Gossypium raimondii
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  134   1e-33   Solanum tuberosum [potatoes]
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  134   1e-33   Solanum tuberosum [potatoes]
ref|XP_010269079.1|  PREDICTED: patatin-like protein 2 isoform X3       132   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  134   1e-33   Brassica rapa
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       133   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  133   1e-33   Phoenix dactylifera
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       133   1e-33   Prunus mume [ume]
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     133   2e-33   Eucalyptus grandis [rose gum]
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         133   2e-33   Citrus sinensis [Valencia orange]
ref|XP_009785774.1|  PREDICTED: patatin-17-like                         133   2e-33   Nicotiana sylvestris
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Phoenix dactylifera
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  133   2e-33   Vitis vinifera
gb|EEE53387.1|  hypothetical protein OsJ_36433                          137   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       133   2e-33   Eucalyptus grandis [rose gum]
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    137   2e-33   Vitis vinifera
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       133   2e-33   Eucalyptus grandis [rose gum]
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       133   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002301194.1|  patatin-like family protein                        133   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             133   2e-33   Capsella rubella
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    133   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Nicotiana sylvestris
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010269072.1|  PREDICTED: patatin-like protein 2 isoform X2       132   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Eucalyptus grandis [rose gum]
gb|EMT28251.1|  Patatin group A-3                                       133   2e-33   Aegilops tauschii
gb|EAZ06806.1|  hypothetical protein OsI_29050                          133   2e-33   Oryza sativa Indica Group [Indian rice]
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        133   2e-33   Nicotiana tabacum [American tobacco]
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  133   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010101004.1|  Patatin group A-3                                  133   3e-33   Morus notabilis
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  133   3e-33   Nicotiana tomentosiformis
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         132   3e-33   Glycine max [soybeans]
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  132   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_003544453.1|  PREDICTED: patatin-05                              132   3e-33   Glycine max [soybeans]
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       133   3e-33   Vitis vinifera
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       132   3e-33   Tarenaya hassleriana [spider flower]
ref|NP_001061678.1|  Os08g0376500                                       133   3e-33   
emb|CDX69271.1|  BnaC01g01820D                                          132   3e-33   Brassica napus [oilseed rape]
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             132   3e-33   Phaseolus vulgaris [French bean]
emb|CDY42720.1|  BnaA03g53730D                                          132   3e-33   Brassica napus [oilseed rape]
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  132   3e-33   
ref|NP_001151190.1|  LOC100284823                                       132   3e-33   Zea mays [maize]
ref|XP_010548412.1|  PREDICTED: patatin-like protein 3 isoform X3       132   3e-33   Tarenaya hassleriana [spider flower]
gb|EEC84713.1|  hypothetical protein OsI_31673                          132   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       132   3e-33   Tarenaya hassleriana [spider flower]
gb|ACN25198.1|  unknown                                                 132   3e-33   Zea mays [maize]
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  132   3e-33   Setaria italica
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             132   3e-33   Prunus persica
ref|XP_010548410.1|  PREDICTED: patatin-like protein 3 isoform X1       132   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             132   4e-33   Citrus clementina
ref|XP_006380722.1|  hypothetical protein POPTR_0007s11370g             132   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337             132   4e-33   Arabidopsis lyrata subsp. lyrata
emb|CDX75621.1|  BnaA01g00810D                                          132   4e-33   Brassica napus [oilseed rape]
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  132   4e-33   Eucalyptus grandis [rose gum]
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  132   4e-33   Brassica rapa
gb|ACG31156.1|  patatin T5 precursor                                    132   4e-33   Zea mays [maize]
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  132   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    132   4e-33   
gb|KJB58442.1|  hypothetical protein B456_009G210300                    132   4e-33   Gossypium raimondii
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  132   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                  131   4e-33   Eucalyptus grandis [rose gum]
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  132   4e-33   Eucalyptus grandis [rose gum]
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         132   4e-33   Citrus sinensis [Valencia orange]
ref|XP_010548411.1|  PREDICTED: patatin-like protein 3 isoform X2       132   5e-33   Tarenaya hassleriana [spider flower]
ref|NP_001063402.2|  Os09g0462400                                       132   5e-33   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             132   5e-33   Prunus persica
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  132   5e-33   Fragaria vesca subsp. vesca
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  132   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            132   5e-33   Theobroma cacao [chocolate]
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  132   5e-33   Prunus mume [ume]
gb|KJB40252.1|  hypothetical protein B456_007G053800                    132   5e-33   Gossypium raimondii
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  132   5e-33   Pyrus x bretschneideri [bai li]
gb|EMT18762.1|  Patatin group A-3                                       132   5e-33   Aegilops tauschii
ref|XP_004962815.1|  PREDICTED: patatin-T5-like                         132   5e-33   Setaria italica
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            132   5e-33   Theobroma cacao [chocolate]
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  132   5e-33   Malus domestica [apple tree]
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  132   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          132   6e-33   Sorghum bicolor [broomcorn]
gb|AAB08428.1|  patatin homolog                                         131   6e-33   Nicotiana tabacum [American tobacco]
ref|XP_006829696.1|  hypothetical protein AMTR_s00126p00051390          128   6e-33   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  131   6e-33   
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       132   7e-33   Eucalyptus grandis [rose gum]
ref|NP_001149326.1|  patatin class 1                                    132   7e-33   Zea mays [maize]
tpg|DAA48471.1|  TPA: patatin class 1                                   132   7e-33   Zea mays [maize]
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                  131   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    132   7e-33   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  131   7e-33   Malus domestica [apple tree]
gb|AAF98370.1|AF158254_1  patatin-like protein 2                        127   7e-33   Nicotiana tabacum [American tobacco]
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  131   7e-33   Sesamum indicum [beniseed]
dbj|BAK06341.1|  predicted protein                                      132   7e-33   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  131   8e-33   Eucalyptus grandis [rose gum]
ref|XP_002523558.1|  Patatin precursor, putative                        131   8e-33   Ricinus communis
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                  131   8e-33   Brachypodium distachyon [annual false brome]
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             131   8e-33   Citrus clementina
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       131   8e-33   Vitis vinifera
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  131   8e-33   Zea mays [maize]
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  132   9e-33   Zea mays [maize]
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  131   9e-33   Vitis vinifera
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    134   1e-32   Setaria italica
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  131   1e-32   Eucalyptus grandis [rose gum]
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  131   1e-32   Phoenix dactylifera
ref|XP_002510255.1|  Patatin precursor, putative                        131   1e-32   Ricinus communis
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  131   1e-32   
emb|CDX72620.1|  BnaC07g46420D                                          131   1e-32   Brassica napus [oilseed rape]
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  131   1e-32   Nicotiana sylvestris
ref|NP_001062043.1|  Os08g0477100                                       131   1e-32   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  131   1e-32   Eucalyptus grandis [rose gum]
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             131   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       131   1e-32   Populus euphratica
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       130   1e-32   Populus euphratica
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  130   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  131   1e-32   Nicotiana tomentosiformis
ref|XP_004288050.1|  PREDICTED: patatin-like protein 1                  130   2e-32   Fragaria vesca subsp. vesca
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 130   2e-32   Theobroma cacao [chocolate]
ref|XP_009366776.1|  PREDICTED: patatin-like protein 2                  130   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    130   2e-32   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             130   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002445640.1|  hypothetical protein SORBIDRAFT_07g023220          131   2e-32   Sorghum bicolor [broomcorn]
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             130   2e-32   
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  130   2e-32   
gb|KJB58441.1|  hypothetical protein B456_009G210000                    130   2e-32   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     130   2e-32   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  130   2e-32   
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       130   2e-32   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       130   2e-32   
gb|EMS45954.1|  Patatin group A-3                                       130   2e-32   
ref|XP_008813727.1|  PREDICTED: patatin-like protein 2                  130   2e-32   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  130   2e-32   
ref|XP_004148466.1|  PREDICTED: patatin group A-3-like                  130   2e-32   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             130   2e-32   
emb|CBI19557.3|  unnamed protein product                                133   2e-32   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  130   2e-32   
ref|XP_008671929.1|  PREDICTED: patatin-like protein 1                  130   2e-32   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  130   2e-32   
emb|CBI25857.3|  unnamed protein product                                126   2e-32   
gb|KHG27256.1|  Patatin group M-3                                       130   3e-32   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            130   3e-32   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             130   3e-32   
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      130   3e-32   
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  130   3e-32   
gb|ACN33435.1|  unknown                                                 130   3e-32   
emb|CAN71270.1|  hypothetical protein VITISV_001906                     128   3e-32   
ref|XP_002310157.1|  hypothetical protein POPTR_0007s11360g             129   3e-32   
gb|ABK24853.1|  unknown                                                 130   3e-32   
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       129   3e-32   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  130   3e-32   
gb|AFK45431.1|  unknown                                                 130   3e-32   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  130   3e-32   
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  130   3e-32   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             129   3e-32   
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         129   3e-32   
tpg|DAA42306.1|  TPA: patatin T5                                        129   3e-32   
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                  130   4e-32   
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          129   4e-32   
ref|XP_009606859.1|  PREDICTED: patatin-like protein 2                  124   4e-32   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  129   4e-32   
gb|EMS66123.1|  Patatin group A-3                                       129   4e-32   
emb|CDM80597.1|  unnamed protein product                                130   4e-32   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     129   4e-32   
ref|XP_008220197.1|  PREDICTED: patatin-like protein 2 isoform X2       128   5e-32   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  129   5e-32   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  129   5e-32   
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          129   6e-32   
gb|KDP31895.1|  hypothetical protein JCGZ_12356                         129   6e-32   
ref|XP_011085657.1|  PREDICTED: patatin-like protein 2                  127   6e-32   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             129   6e-32   
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       129   6e-32   
ref|XP_009605254.1|  PREDICTED: patatin-2-Kuras 1-like                  129   6e-32   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     129   6e-32   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  129   6e-32   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  128   6e-32   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    129   6e-32   
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  129   6e-32   
ref|XP_010102583.1|  Patatin group A-3                                  129   7e-32   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  129   7e-32   
gb|AAX99411.1|  patatin-like protein                                    129   7e-32   
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          129   7e-32   
ref|XP_004289234.1|  PREDICTED: patatin-like protein 2                  128   8e-32   
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  129   8e-32   
sp|Q3YJT5.1|PAT05_SOLTU  RecName: Full=Patatin-05; AltName: Full=...    128   8e-32   
emb|CBI19554.3|  unnamed protein product                                128   9e-32   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              129   9e-32   
gb|AEF30538.1|  patatin-like phospholipase 1                            129   9e-32   
sp|Q2MY48.1|PAT03_SOLTU  RecName: Full=Patatin-03; Flags: Precursor     128   1e-31   
ref|XP_011039207.1|  PREDICTED: patatin-like protein 2                  128   1e-31   
dbj|BAJ98020.1|  predicted protein                                      129   1e-31   
gb|EMS54202.1|  Patatin group A-3                                       129   1e-31   
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  128   1e-31   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    128   1e-31   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  128   1e-31   
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  128   1e-31   
ref|XP_007160831.1|  hypothetical protein PHAVU_001G020200g             128   1e-31   
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             128   1e-31   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                  128   1e-31   
emb|CBI21441.3|  unnamed protein product                                131   1e-31   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  128   1e-31   
ref|XP_002523555.1|  Patatin precursor, putative                        128   1e-31   
emb|CBI19552.3|  unnamed protein product                                128   1e-31   
gb|EMT13605.1|  Patatin group A-3                                       128   1e-31   
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       128   1e-31   
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  128   1e-31   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       127   2e-31   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  128   2e-31   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  128   2e-31   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       128   2e-31   
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  128   2e-31   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             127   2e-31   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       127   2e-31   
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    127   2e-31   
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       127   2e-31   
ref|XP_003611771.1|  Patatin-like protein                               127   2e-31   
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       127   2e-31   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  128   2e-31   
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|XP_010101001.1|  Patatin group A-3                                  127   2e-31   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  127   2e-31   
ref|XP_008245283.1|  PREDICTED: patatin-like protein 2                  125   2e-31   
gb|KCW54995.1|  hypothetical protein EUGRSUZ_I00969                     125   2e-31   
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1       127   2e-31   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       127   2e-31   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       127   2e-31   
ref|XP_008776250.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     127   2e-31   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|NP_001151996.1|  patatin T5                                         127   2e-31   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  127   2e-31   
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_004288059.1|  PREDICTED: patatin-like protein 1                  127   3e-31   
ref|XP_002510258.1|  Patatin T5 precursor, putative                     127   3e-31   
ref|XP_009613240.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             127   3e-31   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
emb|CDP01335.1|  unnamed protein product                                127   3e-31   
ref|XP_002510260.1|  Patatin T5 precursor, putative                     127   3e-31   
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  127   3e-31   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_003611772.1|  Patatin-like protein                               127   3e-31   
emb|CAA73328.1|  patatin-like protein                                   127   3e-31   
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                  127   3e-31   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  127   3e-31   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             127   3e-31   
ref|XP_002523557.1|  Patatin class 1 precursor, putative                127   4e-31   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             127   4e-31   
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             127   4e-31   
gb|ABA99477.1|  Patatin-like phospholipase family protein               127   4e-31   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  127   4e-31   
gb|ACR34670.1|  unknown                                                 124   4e-31   
ref|XP_010680489.1|  PREDICTED: patatin-like protein 1                  127   4e-31   
ref|XP_002456787.1|  hypothetical protein SORBIDRAFT_03g042730          127   4e-31   
sp|Q2MY44.1|PAT07_SOLTU  RecName: Full=Patatin-07; Flags: Precursor     126   4e-31   
emb|CDP11080.1|  unnamed protein product                                126   4e-31   
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             126   4e-31   
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    127   4e-31   
gb|EPS59074.1|  hypothetical protein M569_15736                         126   5e-31   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          126   5e-31   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         126   5e-31   
gb|EEE53389.1|  hypothetical protein OsJ_36436                          127   5e-31   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  126   5e-31   
emb|CBI19544.3|  unnamed protein product                                127   5e-31   
ref|XP_009626816.1|  PREDICTED: patatin-like protein 3                  126   5e-31   
ref|XP_009799856.1|  PREDICTED: patatin-like protein 2                  126   5e-31   
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  126   5e-31   
emb|CAN80453.1|  hypothetical protein VITISV_028107                     126   6e-31   
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          126   6e-31   
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  126   6e-31   
ref|XP_011458944.1|  PREDICTED: patatin-like protein 2                  124   6e-31   
ref|NP_195422.3|  PATATIN-like protein 4                                126   6e-31   
ref|XP_006829698.1|  hypothetical protein AMTR_s00126p00052810          125   6e-31   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  126   6e-31   
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             126   7e-31   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis       126   7e-31   
ref|NP_180224.1|  phospholipase A 2A                                    126   7e-31   
ref|XP_010942709.1|  PREDICTED: patatin-like protein 2                  124   7e-31   
ref|XP_004291130.1|  PREDICTED: patatin-like protein 2                  126   8e-31   
emb|CDP01337.1|  unnamed protein product                                126   8e-31   
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  126   8e-31   
emb|CDP01333.1|  unnamed protein product                                125   8e-31   
ref|XP_010028280.1|  PREDICTED: patatin-like protein 2 isoform X3       124   8e-31   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  126   9e-31   
ref|NP_568015.1|  patatin-related phospholipase A                       125   9e-31   
gb|AAM64566.1|  patatin-like protein                                    125   1e-30   
gb|KHN42072.1|  Patatin group A-3                                       126   1e-30   
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2       125   1e-30   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                  124   1e-30   
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  125   1e-30   
ref|XP_007047219.1|  Acyl transferase/acyl hydrolase/lysophosphol...    125   1e-30   
emb|CAA05628.1|  patatin-like protein                                   125   1e-30   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       125   1e-30   
ref|XP_009138467.1|  PREDICTED: patatin-like protein 1 isoform X2       125   1e-30   
ref|NP_849511.1|  patatin-related phospholipase A                       125   1e-30   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       125   1e-30   
ref|NP_001062042.1|  Os08g0476900                                       125   1e-30   
sp|Q2MY43.1|PAT08_SOLTU  RecName: Full=Patatin-08; AltName: Full=...    125   1e-30   
sp|Q2MY55.1|PATD3_SOLTU  RecName: Full=Patatin group D-3; Flags: ...    125   1e-30   
sp|Q2MY56.1|PATD2_SOLTU  RecName: Full=Patatin group D-2; Flags: ...    125   1e-30   
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       125   1e-30   
gb|EEE68866.1|  hypothetical protein OsJ_27669                          125   1e-30   
emb|CDX72619.1|  BnaC07g46410D                                          125   1e-30   
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       125   1e-30   
ref|XP_009138466.1|  PREDICTED: patatin-like protein 1 isoform X1       125   1e-30   
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       125   2e-30   
ref|NP_195423.1|  PATATIN-like protein 5                                125   2e-30   
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2       124   2e-30   
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     125   2e-30   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1       125   2e-30   
gb|KFK30332.1|  hypothetical protein AALP_AA7G248200                    127   2e-30   
ref|NP_001275345.1|  patatin-05-like precursor                          125   2e-30   
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  125   2e-30   
ref|XP_004173475.1|  PREDICTED: patatin group A-3-like                  125   2e-30   
gb|EEC69467.1|  hypothetical protein OsI_38663                          125   2e-30   
gb|EMS48649.1|  Patatin group A-3                                       125   2e-30   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1       125   2e-30   
gb|EAY83441.1|  hypothetical protein OsI_38653                          125   2e-30   
gb|ABG22550.1|  Patatin-like phospholipase family protein, expressed    122   2e-30   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494              124   2e-30   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       124   2e-30   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         124   3e-30   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  124   3e-30   
ref|XP_002869007.1|  PLA IVA/PLP1                                       124   3e-30   
gb|EAZ07346.1|  hypothetical protein OsI_29595                          124   3e-30   
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      124   3e-30   
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  124   3e-30   
gb|KFK30335.1|  hypothetical protein AALP_AA7G248500                    124   3e-30   
gb|EMT32376.1|  Patatin group A-3                                       124   3e-30   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  124   3e-30   
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  124   3e-30   
sp|Q2MY50.1|PAT01_SOLTU  RecName: Full=Patatin-01; Flags: Precursor     124   4e-30   
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  124   4e-30   
sp|Q2MY60.1|PAT02_SOLTU  RecName: Full=Patatin-02; AltName: Full=...    124   4e-30   
ref|XP_004148462.1|  PREDICTED: patatin group A-3-like                  124   4e-30   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             124   4e-30   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  124   4e-30   
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          124   4e-30   



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 127/185 (69%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DGPDAR+ADYFDVI+GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYDGKY  136
            T M+ APD N RPL+A KDI PFY +H P IFP ++           +++L GPKYDGKY
Sbjct  73   TAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKY  132

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSA  16
            LH V++  LGD RL +TLT+V                     +SP  +AKLSDICI+TSA
Sbjct  133  LHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDICISTSA  192

Query  15   APTYL  1
            APTYL
Sbjct  193  APTYL  197



>ref|XP_009797489.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=333

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 26/192 (14%)
 Frame = -2

Query  498  PATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVI  319
            P++G +          +TILSIDGGGIRG+IPGTI+ Y E QLQ  DG DAR+ADYFDVI
Sbjct  6    PSSGSFKHQPPTCGNFITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVI  65

Query  318  AgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAG  157
            AGTSTGGL+T ML AP+K+KRPL+A KDI PFY EHGP IFP NT  W  +      + G
Sbjct  66   AGTSTGGLVTAMLTAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVTG  125

Query  156  PKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSD  37
            PKY GKYLH+V+K  LG+T L +TLT+V                     ++P  +AKLSD
Sbjct  126  PKYGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSD  185

Query  36   ICIATSAAPTYL  1
            ICI+TSAAPTYL
Sbjct  186  ICISTSAAPTYL  197



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 124/182 (68%), Gaps = 27/182 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP  I+ +LE  LQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T MLAAPDKN RPL+A KDI PFY EH P IFP +      +LA       GPKYDGKYL
Sbjct  74   TAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV------------------NDSPEKNAKLSDICIATSAAPT  7
            HQV++  LGD RL +TLT++                    SP  +AKLSDICI+TSAAPT
Sbjct  134  HQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQRSPCLDAKLSDICISTSAAPT  193

Query  6    YL  1
            YL
Sbjct  194  YL  195



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 127/185 (69%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DGPDAR+ADYFDVI+GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYDGKY  136
            T M+ APD N RPL+A KDI PFY +H P IFP ++           +++L GPKYDGKY
Sbjct  73   TAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKY  132

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSA  16
            LH V++  LGD RL +TLT+V                     +SP  +AKLSDICI+TSA
Sbjct  133  LHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDICISTSA  192

Query  15   APTYL  1
            APTYL
Sbjct  193  APTYL  197



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 124/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP  I+ +LE  LQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T MLAAPDKN RPL+A KDI PFY EH P IFP +      +LA       GPKYDGKYL
Sbjct  74   TAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV++  LGD RL +TLT++                      SP  +AKLSDICI+TSAA
Sbjct  134  HQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDICISTSAA  193

Query  12   PTYL  1
            PTYL
Sbjct  194  PTYL  197



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 26/192 (14%)
 Frame = -2

Query  498  PATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVI  319
            P++G +          +TILSIDGGGIRG+IPGTI+ Y E QLQ  DG DAR+ADYFDVI
Sbjct  6    PSSGSFKHQPPTCGNFITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVI  65

Query  318  AgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAG  157
            AGTSTGGL+T ML AP+K+KRPL+A KDI PFY EHGP IFP NT  W  +      + G
Sbjct  66   AGTSTGGLVTAMLTAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVTG  125

Query  156  PKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSD  37
            PKY GKYLH+V+K  LG+T L +TLT+V                     ++P  +AKLSD
Sbjct  126  PKYGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSD  185

Query  36   ICIATSAAPTYL  1
            ICI+TSAAPTYL
Sbjct  186  ICISTSAAPTYL  197



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 129/195 (66%), Gaps = 29/195 (15%)
 Frame = -2

Query  498  PATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVI  319
            P++G +         ++TILSIDGGGIRG+IPGTI+ +LE QLQ  DG DAR+ADYFDVI
Sbjct  6    PSSGSFKHQPPTCGNLITILSIDGGGIRGLIPGTILEFLESQLQALDGVDARLADYFDVI  65

Query  318  AgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---------QNM  166
            AGTSTGGL+T MLAAP+K+KRPL+A KDI PFY EHGP IFP NT  W           +
Sbjct  66   AGTSTGGLVTAMLAAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTMNWFGIGTITNMWKL  125

Query  165  LAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAK  46
              GPKY GKYLH+V+K  LG T L +TLT+V                      +P  +AK
Sbjct  126  ATGPKYAGKYLHKVIKEKLGGTHLHETLTNVVIPTFDIKNMQPTIFSSYEARKNPLMDAK  185

Query  45   LSDICIATSAAPTYL  1
            LSDICI+TSAAPTYL
Sbjct  186  LSDICISTSAAPTYL  200



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 126/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DGP+AR+ADYFDVI+GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYFDVISGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T M+ APD N RPL+A KDI PFY +H P IFP ++     +LA       GPKYDGKYL
Sbjct  73   TAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLGGPKYDGKYL  132

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V+K  LGD RL +TLT+V                      SP  +AKLSDICI+TSAA
Sbjct  133  HEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYKLKISPCMDAKLSDICISTSAA  192

Query  12   PTYL  1
            PTYL
Sbjct  193  PTYL  196



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 125/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP TI+ +LE QLQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T M+AAPDKN RPL+A KDI PFY EH P IFP +      MLA       GPKYDGKYL
Sbjct  74   TAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H V++  LGD RL +T+T++                      SP  +AKLSDICI+TSAA
Sbjct  134  HDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICISTSAA  193

Query  12   PTYL  1
            PTYL
Sbjct  194  PTYL  197



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 122/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VTILSIDGGGIRGIIP TI+ YLE QLQ  DG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   LVTILSIDGGGIRGIIPATILEYLESQLQELDGKDARLADYFDVIAGTSTGGLVTAMLTA  79

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNN  112
            PDK  RPL+A KDIVPFY EHGP IFP      G+       L  PKYDGKYLH+V+K  
Sbjct  80   PDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKSLVRPKYDGKYLHKVIKEK  139

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LG+TRL +TLT++                     ++   +A+L+DICI+TSAAPTYL
Sbjct  140  LGETRLHETLTNIVIPTFDIKNLQPTVFTTFEAKENSLMDARLTDICISTSAAPTYL  196



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML APDK+KRPL+A KDI PFY EHGP IFP     + ++      L GPKY+GKYLH
Sbjct  75   TAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLH  134

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            QV++  LG+T L +TLT+V                       P  +AKLSDICI+TSAAP
Sbjct  135  QVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAAP  194

Query  9    TYL  1
            TYL
Sbjct  195  TYL  197



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 125/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP TI+ +LE QLQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T M+AAPDKN RPL+A KDI PFY EH P IFP +      MLA       GPKYDGKYL
Sbjct  74   TAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H V++  LGD RL +T+T++                      SP  +AKLSDICI+TSAA
Sbjct  134  HDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICISTSAA  193

Query  12   PTYL  1
            PTYL
Sbjct  194  PTYL  197



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML APDK+KRPL+A KDI PFY EHGP IFP     + ++      L GPKY+GKYLH
Sbjct  75   TAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLH  134

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            QV++  LG+T L +TLT+V                       P  +AKLSDICI+TSAAP
Sbjct  135  QVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAAP  194

Query  9    TYL  1
            TYL
Sbjct  195  TYL  197



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE QLQ  DG DAR+ADYFDVIAGTSTGG++
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML+AP+ N+RPL+A KDI PFY EH P IFP ++  W ++      L GPKYDGKYL 
Sbjct  73   TAMLSAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDGKYLK  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +V++  LG TRL +TLT+                    +  SP  +A+LSDICI+TSAAP
Sbjct  133  EVVREKLGQTRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 124/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP  I+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  16   PPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  75

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYL  133
            T ML AP+K+KRP++A KDI PFY EHGP IFP       G+       L GPKY+GKYL
Sbjct  76   TAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYL  135

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV+K  LG+T L +TLT+V                     + P  +AKLSDICI+TS A
Sbjct  136  HQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSGA  195

Query  12   PTYL  1
            PTYL
Sbjct  196  PTYL  199



>ref|XP_004288052.1| PREDICTED: patatin-like protein 1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP    ++T+LSIDGGGIRGIIPG ++ YLE QLQ  DG DARIADYFDVI+GTSTGGL+
Sbjct  14   PPRYGNLITVLSIDGGGIRGIIPGVLLTYLESQLQHLDGEDARIADYFDVISGTSTGGLI  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T MLAAPD+N RPL+A KDIVPFY ++ P IFP         +    +L GPKYDGKYLH
Sbjct  74   TAMLAAPDENNRPLFAAKDIVPFYLDNCPKIFPQSRGLCATVTDLVKVLIGPKYDGKYLH  133

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++++ +GD RLSQTLT+                    V   P KNAKLSDICI TSAAP
Sbjct  134  KLIRSIVGDKRLSQTLTNVIIPTFDIKTLLPVIFSTYQVASYPVKNAKLSDICIGTSAAP  193

Query  9    TYL  1
            TY 
Sbjct  194  TYF  196



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 126/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  12   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYL  133
            T ML AP+K+KRP++A KDI PFY EHGP IFP       G+       L GPKY+GKYL
Sbjct  72   TAMLTAPNKDKRPMFAAKDIKPFYLEHGPKIFPQKGMLFFGSIVKTLKSLIGPKYNGKYL  131

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV+K  LG+T + +TLT+V                     + P  +AKLSDICI+TSAA
Sbjct  132  HQVIKEKLGETYIHETLTNVVIPTFDIKNLQPTIFSTFEAREKPLMDAKLSDICISTSAA  191

Query  12   PTYL  1
            PTYL
Sbjct  192  PTYL  195



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 124/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP  I+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  16   PPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  75

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYL  133
            T ML AP+K+KRP++A KDI PFY EHGP IFP       G+       L GPKY+GKYL
Sbjct  76   TAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYL  135

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV+K  LG+T L +TLT+V                     + P  +AKLSDICI+TS A
Sbjct  136  HQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSGA  195

Query  12   PTYL  1
            PTYL
Sbjct  196  PTYL  199



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 129/184 (70%), Gaps = 30/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIPG I+AYLE QLQ  DG +ARIADYFDVIAGTSTGGL+
Sbjct  15   PPNCGNLVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVIAGTSTGGLI  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYL  133
            T MLAAP++N RPLYA KDIVPFY E+ P IFP       G  +A++ ++ GP YDGKY+
Sbjct  75   TAMLAAPNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLI-GPGYDGKYV  133

Query  132  HQVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAA  13
             Q++K+NLG TRL QTLT                     V D+P  +A LSDICI TSAA
Sbjct  134  QQLIKSNLGSTRLHQTLTSIVVPTFDIKILQPVIFSSYQVTDNPVVDALLSDICIGTSAA  193

Query  12   PTYL  1
            PT+L
Sbjct  194  PTFL  197



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 133/202 (66%), Gaps = 31/202 (15%)
 Frame = -2

Query  519  SQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDA  346
            S  TP  PAT     ++ PPS    VT+L IDGGG+RG+IP TI+A+LE +LQ  DGP+A
Sbjct  3    SDQTP--PATADAPISTPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEA  60

Query  345  RIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-  169
            RIADYFDVIAGTSTGGL+T ML AP+K KRPL+A KDIV FY ++ P IFP   +   N 
Sbjct  61   RIADYFDVIAGTSTGGLVTAMLTAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKNAGLFNS  120

Query  168  ------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------ND  67
                   ++GPKYDGKYLH +++  LGDTRLSQTLT+V                      
Sbjct  121  ALNLVGAVSGPKYDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKS  180

Query  66   SPEKNAKLSDICIATSAAPTYL  1
            +P K+A LSDICI TSAAPTYL
Sbjct  181  TPLKDALLSDICIGTSAAPTYL  202



>ref|XP_004233636.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=816

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 127/190 (67%), Gaps = 32/190 (17%)
 Frame = -2

Query  474  ASIPP---SGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
             ++PP     ++TIL+IDGGGIRGIIPG I+AYLE QLQ  DG DARIADYFD+IAGTST
Sbjct  12   VAMPPPNTGKLITILTIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTST  71

Query  303  gglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSA---------WQNMLAGPK  151
            GGL+T MLAAP+K+KRPLYA KDI PFY EH P IFP  +              M+ GPK
Sbjct  72   GGLVTAMLAAPNKDKRPLYAAKDITPFYIEHSPKIFPQISCCSGLFAGAINLAKMINGPK  131

Query  150  YDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDIC  31
            YDGKYLH+++K  LG TRL  TLT V                    N  PE NA+L+DIC
Sbjct  132  YDGKYLHELIKRLLGGTRLHDTLTAVVIPTFDIKTLQPVIFSSYEANSKPELNAELADIC  191

Query  30   IATSAAPTYL  1
            I+TSAAPT+L
Sbjct  192  ISTSAAPTFL  201


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 122/189 (65%), Gaps = 29/189 (15%)
 Frame = -2

Query  480  IAASIPP---SGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            +  ++PP     ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DARIADYFD+IAGT
Sbjct  421  VGVAMPPPNKGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGT  480

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKY  148
            STGGL+T MLAAP+K KRPLYA KDI PFY EH P IF       G       ML  PKY
Sbjct  481  STGGLVTAMLAAPNKAKRPLYAAKDITPFYLEHSPKIFHQIGGPFGGAINLTKMLNRPKY  540

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            DGKYLH ++K  LG TRL  TLT V                       P  +A+L+DICI
Sbjct  541  DGKYLHTLIKGLLGGTRLHDTLTAVVIPTFDIKELQPVIFSSYETKSKPVLDAELADICI  600

Query  27   ATSAAPTYL  1
            +TSAAPT+L
Sbjct  601  STSAAPTFL  609



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 120/178 (67%), Gaps = 29/178 (16%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRG+IP TI+ YLE QLQ  DG DAR+ADYFD+I GTSTGGL+T ML AP
Sbjct  18   ITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIITGTSTGGLVTAMLTAP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYDGKYLHQVLKN  115
            +K+ RPL+A KDI PFY EHGP IFP N           W   L GPKY+GKYLHQV+K 
Sbjct  78   NKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGW-TFLTGPKYNGKYLHQVIKE  136

Query  114  NLGDTRLSQTLTHV--------NDSPE------------KNAKLSDICIATSAAPTYL  1
             LG+T+L +TLT+V        N  P              NAKLSDICI TSAAPTYL
Sbjct  137  KLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKHSIMNAKLSDICIGTSAAPTYL  194



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 125/185 (68%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLV  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKY  136
            T ML AP K+KRPL+A KDI PFY EHGP IFP        G+       L GPKY+GKY
Sbjct  75   TAMLTAPHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKYNGKY  134

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSA  16
            LHQV++  LG+T+L +TLT+V                     + P  +AKLSDIC +TSA
Sbjct  135  LHQVIEEKLGETQLHETLTNVVIPTFDIKNLQPKVFSTFEAREKPLMDAKLSDICASTSA  194

Query  15   APTYL  1
            APTYL
Sbjct  195  APTYL  199



>ref|XP_006660213.1| PREDICTED: patatin-3-Kuras 1-like, partial [Oryza brachyantha]
Length=412

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 132/194 (68%), Gaps = 29/194 (15%)
 Frame = -2

Query  507  PSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIAD  334
            PSSP T      S PPS   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DGP+ARIAD
Sbjct  14   PSSPCT----PRSPPPSYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEARIAD  69

Query  333  YFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNML  163
            YFDV+AGTSTGG++T ML APD   RPL+A K I  FY EH P IFP    N    ++++
Sbjct  70   YFDVVAGTSTGGVVTAMLTAPDDQGRPLFAAKGINDFYLEHSPKIFPPRRSNLGLIKSLM  129

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
            +GPKYDGKYLH V++  LGD R++QTLT+V                     +   KNA L
Sbjct  130  SGPKYDGKYLHSVVQKLLGDKRVNQTLTNVVIPTFDIKLLQPITFSRFDAQNDESKNALL  189

Query  42   SDICIATSAAPTYL  1
            SD+CI+TSAAPTYL
Sbjct  190  SDVCISTSAAPTYL  203



>ref|XP_010269002.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIPGTI+A+LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++N RPL+A KDIVPFY E  P IFP      G+      ++ GPKYDGKYLH
Sbjct  72   TAMLTAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +++  LG+TRL QTLT+                    V  S   +A+LSDICI+TSAAP
Sbjct  132  SLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDICISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 128/183 (70%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE QLQ  DG DAR+ADYFDVIAGTSTGG++
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML AP+ N+RPL+A KDI PFY EH P IFP ++  W ++      L GPKY+GKYL 
Sbjct  73   TAMLTAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGKYLQ  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +V++  +G+TRL +TLT+                    +  SP  +A+LSDICI+TSAAP
Sbjct  133  EVVREKVGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 124/189 (66%), Gaps = 27/189 (14%)
 Frame = -2

Query  486  GYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            G +A   P +G ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DARIADYFD+IAGT
Sbjct  7    GRVAMPPPTTGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGT  66

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKY  148
            STGGL+T MLAAP+K KRPLYA KDI PFY EH P IF       G       ML GPKY
Sbjct  67   STGGLVTAMLAAPNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKY  126

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            DGKYLH ++K  LG TRL  TLT V                       P  +A+L+DICI
Sbjct  127  DGKYLHTLIKGLLGGTRLHDTLTAVVIPTFDIKELQPVIFSSYETKSKPVSDAELADICI  186

Query  27   ATSAAPTYL  1
            +TSAAPT+L
Sbjct  187  STSAAPTFL  195



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 29/186 (16%)
 Frame = -2

Query  471  SIPP---SGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++PP     ++TIL+IDGGGIRGIIPG I+AYLE QLQ  DG +ARIADYFDVIAGTSTG
Sbjct  13   AMPPPNTGKLITILAIDGGGIRGIIPGVILAYLESQLQELDGENARIADYFDVIAGTSTG  72

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW------QNMLAGPKYDGK  139
            GL+T MLAAP+K+KRPLYA KDI PFY EH P IFP  +  +        M+ GPKYDGK
Sbjct  73   GLVTAMLAAPNKDKRPLYAAKDITPFYIEHSPKIFPQISGLFAGVINLTKMMNGPKYDGK  132

Query  138  YLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATS  19
            YLH + K  LG TRL  TLT V                    N  P+ +A+L+DICI+TS
Sbjct  133  YLHALTKRLLGGTRLHDTLTAVVIPTFDIKTLQPVIFSSYEANSKPDLDAELADICISTS  192

Query  18   AAPTYL  1
            AAPT+L
Sbjct  193  AAPTFL  198



>ref|XP_007202991.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
 gb|EMJ04190.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
Length=407

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP    ++T+LSIDGGGIRGIIPG ++AYLE QLQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  13   PPKYGNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGGLI  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
             TMLAAP+ N RPLYA KDIVPFY ++ P IFP ++           +L GPKYDGKYLH
Sbjct  73   ATMLAAPNDNNRPLYAAKDIVPFYLDNCPKIFPQSSGLCAAVVDLVKVLTGPKYDGKYLH  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            ++++N +GD RL QTLT+                    V   P  NAKLSDICI TSAAP
Sbjct  133  KLIRNIVGDKRLDQTLTNVVIPTFDVKKLLPVIFSSYQVTSRPVLNAKLSDICIGTSAAP  192

Query  9    TYL  1
            T L
Sbjct  193  TLL  195



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 127/177 (72%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++TILSIDGGGIRG+IPG I+ YLE QLQ  DG DAR+ADYFDVIAGTSTGGL+T+MLAA
Sbjct  19   LITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVIAGTSTGGLITSMLAA  78

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNMLA---GPKYDGKYLHQVLKNN  112
            PD+NKRPL+A KDI PFY E+GP IFP   G  ++ ++ L    GPKYDG+YLHQV++  
Sbjct  79   PDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDGRYLHQVVREK  138

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LG+ RL +TLT++                     +    +A+LSD+CI+TSAAPTYL
Sbjct  139  LGEIRLHETLTNIVVPTFDIKNLHPTIFSTYEAKEKKSMDARLSDLCISTSAAPTYL  195



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIPGTI+A+LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++N RPL+A KDIVPFY E  P IFP      G+      ++ GPKYDGKYLH
Sbjct  72   TAMLTAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +++  LG+TRL QTLT+                    V  S   +A+LSDICI+TSAAP
Sbjct  132  SLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDICISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 128/182 (70%), Gaps = 28/182 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIPGTI+ +LE +LQ  DG + R+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-----QNMLAGPKYDGKYLHQ  127
            T M+AAPD+N RPL++ KDI  FY +H P IFP N + W       +L+GPKYDGKYLH+
Sbjct  70   TAMIAAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRT-WPLGRIVKLLSGPKYDGKYLHK  128

Query  126  VLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPT  7
            ++K  LGDT+L QTLT+V                     ++P  NA LSDICI+TSAAPT
Sbjct  129  LVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLNAYLSDICISTSAAPT  188

Query  6    YL  1
            YL
Sbjct  189  YL  190



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 123/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DGP+AR+ADYFDVI+GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYFDVISGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T ML APD N RPL+A KDI PFY EHGP IFP ++     ++A       GPKYDGKYL
Sbjct  73   TAMLTAPDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVRSLGGPKYDGKYL  132

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V++  LG+ RL  TLT+V                          +AKLSDICI TSAA
Sbjct  133  HEVVREKLGEIRLHDTLTNVVIPTFDIKSMQPILFSSYQMKKCSYMDAKLSDICIGTSAA  192

Query  12   PTYL  1
            PTYL
Sbjct  193  PTYL  196



>ref|XP_010061769.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW68764.1| hypothetical protein EUGRSUZ_F02363 [Eucalyptus grandis]
Length=395

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 120/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmt  289
            P SG +VTILSIDGGGIRGIIPG I+ +LE +LQ  DG DARIADYFDVI+GTSTGGL+ 
Sbjct  4    PASGNLVTILSIDGGGIRGIIPGIILGFLESELQKLDGEDARIADYFDVISGTSTGGLIA  63

Query  288  tmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKYL  133
             MLAAPDK  RPLY GKDI  FY EH P IFP         N       + GP+Y GKYL
Sbjct  64   AMLAAPDKKNRPLYGGKDIKAFYLEHSPKIFPQLRCPSIIANAVRTIKAMVGPQYSGKYL  123

Query  132  HQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAA  13
            H+++K  LGDTRL QTLT+                    VN +P  +A +SDICI TSAA
Sbjct  124  HRLIKEKLGDTRLHQTLTNVIIPTFDVKQLQPTIFSSFQVNKNPSLDALVSDICIGTSAA  183

Query  12   PTYL  1
            PTYL
Sbjct  184  PTYL  187



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 135/206 (66%), Gaps = 35/206 (17%)
 Frame = -2

Query  519  SQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDA  346
            S  TP  PAT     ++ PPS    VT+L IDGGG+RG+IP TI+A+LE +LQ  DGP+A
Sbjct  3    SDQTP--PATADAPISTPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEA  60

Query  345  RIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSA  178
            RIADYFDVIAGTSTGGL+T ML AP+K KRPL+A KDIV FY ++ P IFP    G ++ 
Sbjct  61   RIADYFDVIAGTSTGGLVTAMLTAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKKFGCSAG  120

Query  177  WQN-------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV------------------  73
              N        ++GPKYDGKYLH +++  LGDTRLSQTLT+V                  
Sbjct  121  LFNSALNLVGAVSGPKYDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTY  180

Query  72   --NDSPEKNAKLSDICIATSAAPTYL  1
                +P K+A LSDICI TSAAPTYL
Sbjct  181  QTKSTPLKDALLSDICIGTSAAPTYL  206



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 123/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++TILSIDGGGIRGIIPGTI+A+LE QLQ  DG +AR+ADYFD+IAGTSTGGL+T M+ A
Sbjct  11   IITILSIDGGGIRGIIPGTILAFLEAQLQKLDGEEARLADYFDIIAGTSTGGLVTAMITA  70

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS------AWQNMLAGPKYDGKYLHQVLKNN  112
            P++  RPL+A KDI  FY  H P IFP +TS      +    +AGPKYDGKYLH++L+  
Sbjct  71   PNEKNRPLFAAKDIKDFYLGHCPKIFPQDTSPFAAAASLMKTMAGPKYDGKYLHKLLREK  130

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LGD RLSQTLT+V                      +P K+A LSDICI TSAAPTYL
Sbjct  131  LGDARLSQTLTNVVIPTFDIKQLQPKIFSTYELKINPWKDALLSDICIGTSAAPTYL  187



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 126/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  16   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLV  75

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNM---LAGPKYDGKYL  133
            T ML APD+N RPLYA KDI PFY EH P IFP    G  +   NM   + GPKYDGKYL
Sbjct  76   TAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYL  135

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V+K  L DTRLS T+T+V                      S   +AKLSDICI+TSAA
Sbjct  136  HEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAA  195

Query  12   PTYL  1
            PTYL
Sbjct  196  PTYL  199



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 126/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  16   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLV  75

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNM---LAGPKYDGKYL  133
            T ML APD+N RPLYA KDI PFY EH P IFP    G  +   NM   + GPKYDGKYL
Sbjct  76   TAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYL  135

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V+K  L DTRLS T+T+V                      S   +AKLSDICI+TSAA
Sbjct  136  HEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAA  195

Query  12   PTYL  1
            PTYL
Sbjct  196  PTYL  199



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-------QNMLAGPKYDGKYL  133
            T ML APD+N RPLYA KDI PFY EH P IFP                L GPKYDGKYL
Sbjct  70   TAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGPKYDGKYL  129

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV+K  L DTRLS T+T+V                      +   +AKLSDICI+TSAA
Sbjct  130  HQVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICISTSAA  189

Query  12   PTYL  1
            PTYL
Sbjct  190  PTYL  193



>gb|EMT12540.1| Patatin group A-3 [Aegilops tauschii]
Length=390

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 123/189 (65%), Gaps = 26/189 (14%)
 Frame = -2

Query  489  GGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            GG  AA    S VVTILSIDGGG+RGIIP T++A+LE++LQ  DGPDARIADYFDV+AGT
Sbjct  3    GGGSAAEGDKSKVVTILSIDGGGVRGIIPATVLAFLEKELQKLDGPDARIADYFDVVAGT  62

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN------MLAGPKY  148
            STGGL+T MLAAPDK+ RPL+  KD+  FY +  P IFP   S +        +  GPKY
Sbjct  63   STGGLLTVMLAAPDKDGRPLFDAKDLAKFYIDESPKIFPQKGSIFSKIGSALALATGPKY  122

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            DGKYLH +L+ +LGDT+L   LTHV                     + P KNA LSDI I
Sbjct  123  DGKYLHSLLRRHLGDTKLDGALTHVVIPAFDIAYLQPTIFSSFQLENQPAKNALLSDIAI  182

Query  27   ATSAAPTYL  1
             TSAAPT+ 
Sbjct  183  GTSAAPTFF  191



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 126/184 (68%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNM---LAGPKYDGKYL  133
            T ML APD+N RPLYA KDI PFY EH P IFP    G  +   NM   + GPKYDGKYL
Sbjct  70   TAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYL  129

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V+K  L DTRLS T+T+V                      S   +AKLSDICI+TSAA
Sbjct  130  HEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICISTSAA  189

Query  12   PTYL  1
            PTYL
Sbjct  190  PTYL  193



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 121/181 (67%), Gaps = 28/181 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP    ++T+LSIDGGGIRGIIPG ++AYLE QLQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  13   PPKYGNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGGLI  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
             TMLAAP+ N RPLYA KDIVPFY ++ P IFP              +L GPKYDGKYLH
Sbjct  73   ATMLAAPNDNNRPLYAAKDIVPFYLDNCPKIFPQPRGLCAQIVELVKVLTGPKYDGKYLH  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            ++++N +GD RL QTLT+                    V   P  NAKLSDICI TSAAP
Sbjct  133  KLIRNIVGDKRLDQTLTNVVIPTFDVKKLLPVIFSSYQVTSRPVLNAKLSDICIGTSAAP  192

Query  9    T  7
            T
Sbjct  193  T  193



>ref|XP_008339923.1| PREDICTED: patatin-like protein 1 isoform X1 [Malus domestica]
Length=379

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 126/185 (68%), Gaps = 27/185 (15%)
 Frame = -2

Query  474  ASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgg  298
            +S P  G ++TILSIDGGGIRGIIPG ++AYLE +LQ  DG DAR+ADYFDVI+GTSTGG
Sbjct  5    SSXPRHGNLITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGG  64

Query  297  lmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKY  136
            L+ TML AP++N RPL+A KDIVPFY  + P IFP ++     +      L GPKYDGKY
Sbjct  65   LIATMLVAPNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDGKY  124

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH++++  +GD RL QTLT+                    V+  P  NA+LSDICI TSA
Sbjct  125  LHKLVREIIGDKRLDQTLTNLVVPTFDIKKLLPVIFSSYQVSSRPVLNARLSDICIGTSA  184

Query  15   APTYL  1
            APTYL
Sbjct  185  APTYL  189



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 122/177 (69%), Gaps = 27/177 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +T+LSIDGGGIRGIIP TI+++LE QLQ FDG DAR+A+YFDVIAGTSTGGL+T ML AP
Sbjct  17   ITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVIAGTSTGGLVTAMLTAP  76

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNT----SAWQNM---LAGPKYDGKYLHQVLKNN  112
            D+N RP YA KDI PFY EH P IFP N     ++ + M   L GPKYDGKYLH+V+K  
Sbjct  77   DENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALIGPKYDGKYLHEVIKEK  136

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L D+ LS T+T+V                      S   +AKLSDICI+TSAAPTYL
Sbjct  137  LKDSLLSNTITNVVIPTFDIKKLQPTIFSTYETKRSARYDAKLSDICISTSAAPTYL  193



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 132/193 (68%), Gaps = 28/193 (15%)
 Frame = -2

Query  495  ATGGYIAASIPPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDV  322
            A G    A  PP+   ++TIL+IDGGGIRGIIPG I++YLE QLQ  DG DARIADYFD+
Sbjct  5    AAGSSRVAMPPPNTGTLITILAIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDL  64

Query  321  IAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNM---LA  160
            IAGTSTGGL+T MLAAP+K+KRPLYA KDI PFY EH P IFP   G  +   N+   + 
Sbjct  65   IAGTSTGGLVTAMLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMG  124

Query  159  GPKYDGKYLHQVLKNNLGDTRLSQTLTHV---------------ND-----SPEKNAKLS  40
            GPKYDGKYLH+++K+ LG TRL  TLT V               N       P+ +A+L+
Sbjct  125  GPKYDGKYLHKLIKDILGGTRLHDTLTAVVIPTFDIKKLQPVIFNSYEAILKPDLDAELA  184

Query  39   DICIATSAAPTYL  1
            DICI+TSAAPT+L
Sbjct  185  DICISTSAAPTFL  197



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGG+RGIIP  ++AYLE QLQ  DG D RIADYFDVIAGTSTGGL+
Sbjct  14   PPNKGNLITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVIAGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA------GPKYDGKYLH  130
            TTML APD N RPLYA KDIVPFY EH P IFP     +  +++      GPKYDGKYLH
Sbjct  74   TTMLTAPDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRGFHGPKYDGKYLH  133

Query  129  QVLKNNLGDTRLSQTLTHVN-----------------DSPEK---NAKLSDICIATSAAP  10
             + +  LG+TRL QTLT+V                   +PE    +A LSDICI+TSAAP
Sbjct  134  SLTREMLGNTRLHQTLTNVVLTTFDIKKLQPAIFSSYTAPEDSTMDALLSDICISTSAAP  193

Query  9    TYL  1
            T+L
Sbjct  194  TFL  196



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 120/178 (67%), Gaps = 29/178 (16%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRG+IP TI+ YLE QLQ  DG DAR+ADYFD+IAGTSTGGL+T ML AP
Sbjct  18   ITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTAP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYDGKYLHQVLKN  115
            +K+ RPL+A KDI PFY EHGP IFP N           W+  L GPKYDGKYL +V+K 
Sbjct  78   NKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWR-FLTGPKYDGKYLREVIKE  136

Query  114  NLGDTRLSQTLTHV--------NDSP------------EKNAKLSDICIATSAAPTYL  1
             LG+T+L +TLT+V        N  P              +AKL DICI TSAAPTYL
Sbjct  137  KLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKYSRMDAKLFDICIGTSAAPTYL  194



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 36/203 (18%)
 Frame = -2

Query  531  EMGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            E G+S+     P TG           ++TIL+IDGGGIRGIIPG I++YLE QLQ  DG 
Sbjct  4    EAGSSRVAMPPPNTGT----------LITILTIDGGGIRGIIPGVILSYLESQLQELDGK  53

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTS  181
            DARIADYFD+IAGTSTGGL+T MLAAP+K+KRPLYA KDI PFY EH P IFP   G  +
Sbjct  54   DARIADYFDLIAGTSTGGLVTAMLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLA  113

Query  180  AWQNM---LAGPKYDGKYLHQVLKNNLGDTRLSQTLTHVND-------------------  67
               N+   + GPKYDGKYLH+++K  LG TRL  TLT V                     
Sbjct  114  GIINLTKAMGGPKYDGKYLHKLIKGILGGTRLHDTLTAVVIPTFDIKKLQPVIFSSYEAI  173

Query  66   -SPEKNAKLSDICIATSAAPTYL  1
              P+ +A+L+DICI+TSAAPT+L
Sbjct  174  LKPDLDAELADICISTSAAPTFL  196



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP  I+ +LE  LQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T MLAAPDKN RPL+A KDI PF  EH P IFP +      +LA       GPKYDGKYL
Sbjct  74   TAMLAAPDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRSLGGPKYDGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            HQV++  LGD RL +TLT++                      SP  +AKLSDI I+TSAA
Sbjct  134  HQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIRISTSAA  193

Query  12   PTYL  1
            PTYL
Sbjct  194  PTYL  197



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 131/194 (68%), Gaps = 29/194 (15%)
 Frame = -2

Query  495  ATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDV  322
            AT G ++A+ PP+   +VT+LSIDGGG+RG+IP T++A+LE +LQ  DG DARIADYFDV
Sbjct  2    ATTGDLSANPPPALGKLVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDV  61

Query  321  IAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNML-------  163
            IAGTSTGGL+T ML APDK+KRPL+  K I+ FY ++ P IFP   +   N L       
Sbjct  62   IAGTSTGGLVTAMLTAPDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAV  121

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
             GPKYDGKYLH  ++  LGDT+LSQTLT+V                      +P K+A L
Sbjct  122  TGPKYDGKYLHSKVQQLLGDTKLSQTLTNVVIPTFDIKFLQPIIFSTFETKSTPLKDALL  181

Query  42   SDICIATSAAPTYL  1
            SD+C++TSAAPTYL
Sbjct  182  SDVCVSTSAAPTYL  195



>gb|AAK18751.1| patatin-like protein [Vigna unguiculata]
 gb|AAK27797.1| patatin-like protein [Vigna unguiculata]
Length=400

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 127/194 (65%), Gaps = 35/194 (18%)
 Frame = -2

Query  480  IAASIPPSGV-----VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIA  316
            +AA+  PS V     +T+LSIDGGGIRGIIPG ++A+LE +LQ  DG DAR+ADYFDVIA
Sbjct  1    MAATQTPSKVDDGALITVLSIDGGGIRGIIPGILLAFLESELQKLDGADARLADYFDVIA  60

Query  315  gtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------NML  163
            GTSTGGL+T ML AP++N RPLYA KDI  FY EH P IFP  +S+W            L
Sbjct  61   GTSTGGLVTAMLTAPNENNRPLYAAKDIKDFYLEHTPKIFP-QSSSWNLIATAMKKGRSL  119

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKL  43
             GP+YDGKYLH++++  LG+T+L  TLT+                    V   P  NA L
Sbjct  120  MGPQYDGKYLHKLVREKLGNTKLEHTLTNVVIPAFDIKNLQPAIFSSFQVKKRPYLNAAL  179

Query  42   SDICIATSAAPTYL  1
            SDICI+TSAAPTYL
Sbjct  180  SDICISTSAAPTYL  193



>ref|XP_009366942.1| PREDICTED: patatin-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=379

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 125/185 (68%), Gaps = 27/185 (15%)
 Frame = -2

Query  474  ASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgg  298
            +S P  G +VTILSIDGGGIRGIIPG ++ YLE +LQ  DG DAR+ADYFDVI+GTSTGG
Sbjct  5    SSTPRYGNLVTILSIDGGGIRGIIPGVLLTYLESELQKLDGEDARLADYFDVISGTSTGG  64

Query  297  lmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKY  136
            L+ TML AP++N RPL+A KDIVPFY  + P IFP ++     +      L GPKYDGKY
Sbjct  65   LIATMLVAPNENNRPLFAAKDIVPFYHSNCPKIFPQSSGLCATVKDLVKALTGPKYDGKY  124

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH++++  +GD RL QTLT+                    V+  P  NA+LSDICI TSA
Sbjct  125  LHKLVREIIGDKRLDQTLTNLVVPTFDIKILLPVIFSSYQVSSRPVLNARLSDICIGTSA  184

Query  15   APTYL  1
            APTYL
Sbjct  185  APTYL  189



>gb|AGS13487.1| PLP protein [Chimonanthus praecox]
Length=376

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 118/179 (66%), Gaps = 24/179 (13%)
 Frame = -2

Query  465  PPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmt  289
            PP+G + TILSIDGGG+RGIIPG I+ +LE QLQ  DG DAR+ADYFDVI+GTSTGGL+T
Sbjct  3    PPNGNLTTILSIDGGGVRGIIPGKILEFLESQLQKLDGQDARLADYFDVISGTSTGGLVT  62

Query  288  tmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---NMLAGPKYDGKYLHQVLK  118
             ML+APD + RP++A  DIVPFYK++   IFP     WQ    +   P+YDG YLH ++ 
Sbjct  63   AMLSAPDDSGRPIFAADDIVPFYKQNCASIFPQEEHNWQWYLKIFVNPRYDGTYLHNLIN  122

Query  117  NNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
              LG+TRLSQ LTHV                       P  NAKLSDICI TSAAPTY 
Sbjct  123  EKLGETRLSQALTHVVIPTFDIKLLQPAVFSSYKIETKPSMNAKLSDICIGTSAAPTYF  181



>ref|XP_008354710.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 1 [Malus 
domestica]
Length=463

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 126/186 (68%), Gaps = 28/186 (15%)
 Frame = -2

Query  474  ASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgg  298
            +S P  G ++TILSIDGGGIRGIIPG ++AYLE +LQ  DG DAR+ADYFDVI+GTSTGG
Sbjct  5    SSXPRHGNLITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGG  64

Query  297  lmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKY  136
            L+ TML AP++N RPL+A KDIVPFY  + P IFP ++     +      L GPKYDGKY
Sbjct  65   LIATMLVAPNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDGKY  124

Query  135  LHQVLKNNLGDTRLSQTLTH---------------------VNDSPEKNAKLSDICIATS  19
            LH++++  +GD RL QTLT+                     V+  P  NA+LSDICI TS
Sbjct  125  LHKLVREIIGDKRLDQTLTNLVVPTFDIKKLLPVIFSSYQXVSSRPVLNARLSDICIGTS  184

Query  18   AAPTYL  1
            AAPTYL
Sbjct  185  AAPTYL  190



>ref|XP_010235203.1| PREDICTED: patatin-like protein 2 [Brachypodium distachyon]
Length=425

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 33/199 (17%)
 Frame = -2

Query  501  SPATGGYIAASI------PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDA  346
            +P  GG  ++S+      PPS   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DGP+A
Sbjct  19   NPVLGGVASSSLLTPRSPPPSYGNIVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEA  78

Query  345  RIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS----A  178
            RIADYFDVIAGTSTGGL+T ML AP+K+ RPL+A KDI  FY +H P IFP  +S     
Sbjct  79   RIADYFDVIAGTSTGGLVTAMLTAPNKDGRPLFAAKDINKFYLDHCPKIFPAASSWPFGL  138

Query  177  WQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPE  58
            W+ M  GPKYDG+YLH ++K  LG TR+SQ L ++                     +   
Sbjct  139  WKTM-TGPKYDGQYLHSIVKELLGGTRVSQALQNIVVPTFDIKLLQPTIFSKYDAQNDVS  197

Query  57   KNAKLSDICIATSAAPTYL  1
            K+A LSD+CI+TSAAPTYL
Sbjct  198  KDALLSDVCISTSAAPTYL  216



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDV+AGTSTGGL+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---QNM---LAGPKYDGKYLH  130
            T ML APD+N RPLYA KDI PFY EH P IFP  +  +   +N+   L G KYDGKYLH
Sbjct  70   TAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIGSKYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +V+K  L DTRLS T+T+V                      +   +AKLSDICI TSAAP
Sbjct  130  EVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICIGTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 35/203 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGV-VTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            M N QT P SP         +P  G  +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DGP
Sbjct  1    MANMQT-PRSPL-------QLPTRGNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGP  52

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ  172
            DAR+ADYFDVI+GTSTGGL+T MLAAP+K  RPL+A KDI  FY E+ P IFP ++S + 
Sbjct  53   DARLADYFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFA  112

Query  171  N------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VN  70
            +       L GPKYDGK+LH ++K  LGDT L QTLT+                    V 
Sbjct  113  SAANLVKTLRGPKYDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVK  172

Query  69   DSPEKNAKLSDICIATSAAPTYL  1
            ++P  +  LSDICI TSAAPTYL
Sbjct  173  NNPSTDVLLSDICIGTSAAPTYL  195



>ref|XP_004980604.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=397

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 125/188 (66%), Gaps = 31/188 (16%)
 Frame = -2

Query  471  SIPPS---GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            S+PP+    V+T+LSIDGGGIRG+IP TI+A LE QLQ  DGPDARIADYFDVIAGTSTG
Sbjct  2    SLPPAQQGRVLTVLSIDGGGIRGLIPATILARLEAQLQENDGPDARIADYFDVIAGTSTG  61

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN--------TSAWQNMLAGPKYD  145
            GL+ +MLAAP K+ RPL+A KDI  FY+E+GP IFP            AW  +  GPKYD
Sbjct  62   GLIASMLAAPGKDNRPLFAAKDISKFYRENGPKIFPQKGGWVPSLVQEAWNKLRGGPKYD  121

Query  144  GKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIA  25
            GK+LH  + + LGDT+ + TL+++                         KNA+L+D+CIA
Sbjct  122  GKFLHDKIGSLLGDTKAADTLSNLVVPAFDVKRMQPILLNSFEAEREAHKNARLADVCIA  181

Query  24   TSAAPTYL  1
            TSAAPTYL
Sbjct  182  TSAAPTYL  189



>ref|XP_007017310.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14535.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=404

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 120/177 (68%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIPG I+++LE +LQ  DG  ARIADYFDV+AGTSTGGL+TTML A
Sbjct  16   LITVLSIDGGGIRGIIPGVILSFLESELQKLDGEQARIADYFDVVAGTSTGGLLTTMLTA  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNMLA---GPKYDGKYLHQVLKNN  112
            P++  RPL+A ++I  FY EHGP IFP N    S   NM+    GPKYDGKYLH VLK  
Sbjct  76   PNEKNRPLFAAQEIKAFYFEHGPRIFPQNRFPFSGVTNMIKRVLGPKYDGKYLHGVLKER  135

Query  111  LGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
            LG TRL QTLT+                    V  SP  NA LSDICI TSAAPTYL
Sbjct  136  LGYTRLHQTLTNVVIPTFDIKKLQPVIFSSYEVKKSPSLNALLSDICIGTSAAPTYL  192



>ref|XP_007160830.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
 gb|ESW32824.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
Length=407

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 117/180 (65%), Gaps = 30/180 (17%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPG I+ +LE +LQ  DG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   MVTLLSIDGGGIRGIIPGVILGFLESELQKLDGDDARLADYFDVIAGTSTGGLVTAMLTA  79

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------NMLAGPKYDGKYLHQVL  121
            P++N RPLYA KDI  FY EH P IFP N   W            L GP+YDGKYLH ++
Sbjct  80   PNENNRPLYAAKDIKDFYLEHTPKIFPQN-KGWNLISSVMKLSRTLLGPQYDGKYLHNLV  138

Query  120  KNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
            +  LGD +L QTLT+                    V   P  N KLSDICI+TSAAPTYL
Sbjct  139  REKLGDIKLHQTLTNVVIPAFDIKHLQPTIFSSFQVKKRPHLNGKLSDICISTSAAPTYL  198



>ref|XP_002445641.1| hypothetical protein SORBIDRAFT_07g023230 [Sorghum bicolor]
 gb|EES15136.1| hypothetical protein SORBIDRAFT_07g023230 [Sorghum bicolor]
Length=382

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 7/158 (4%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGG+RGIIP TI+A+LEE+LQ  DGPDARIADYFDV+AGTSTGGL+T ML A
Sbjct  20   LVTVLSIDGGGVRGIIPATILAFLEEKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  79

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNN  112
            PD+N RPL+  K++  FY +H P IFP         ++   M+ GPKYDGKYLH +L+  
Sbjct  80   PDQNGRPLFDAKNLAQFYIDHSPKIFPQKNWILSKIASTLRMVRGPKYDGKYLHSLLRQY  139

Query  111  LGDTRLSQTLTHV-NDSPEKNAKLSDICIATSAAPTYL  1
            LGD RL + LT+V    P KNA L+DI I+TSAAPT+ 
Sbjct  140  LGDMRLDKALTNVLKHRPSKNALLADITISTSAAPTFF  177



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIR IIP TI+A+LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRAIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---QNM---LAGPKYDGKYLH  130
            T ML+AP+ ++RPL+A KDI PFY +H P IFP  +S W   Q +   L GPKYD KYL 
Sbjct  73   TAMLSAPNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRSLGGPKYDAKYLQ  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             V++  LG+TRL +TLT+                    +  SP  +A LSDICI+TSAAP
Sbjct  133  GVVREKLGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPYLDAPLSDICISTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 123/176 (70%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN------MLAGPKYDGKYLHQVLKNNL  109
            +K  RPL+A KDI  FY E+ P IFP ++S + +       L GPKYDGK+LH ++K  L
Sbjct  80   NKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHGIVKEKL  139

Query  108  GDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAPTYL  1
            GDT L QTLT                    +V ++P  +A LSDICI TSAAPTYL
Sbjct  140  GDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDICIGTSAAPTYL  195



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 123/187 (66%), Gaps = 29/187 (16%)
 Frame = -2

Query  474  ASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            A+ PP+   ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DAR+ADYFDVIAGTSTG
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVIAGTSTG  67

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYDG  142
            GL+T ML AP +  RP+YA KDIVPFY  HGP IFP       N        L G KYDG
Sbjct  68   GLLTAMLTAPSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGMLANSVVNLVRALMGTKYDG  127

Query  141  KYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIAT  22
            KYLH+V+K NL DT+L QTLT+                    V  SP+ +A+L+DI I T
Sbjct  128  KYLHKVIKENLKDTKLHQTLTNVAIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGT  187

Query  21   SAAPTYL  1
            SAAPTY 
Sbjct  188  SAAPTYF  194



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 35/203 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            M N QT P SP         +P  G  +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG 
Sbjct  1    MANMQT-PRSPL-------QLPTRGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGA  52

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ  172
            DAR+ADYFDVI+GTSTGGL+T MLAAP+K  RPL+A KDI  FY E+ P IFP ++S + 
Sbjct  53   DARLADYFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFA  112

Query  171  N------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLT--------------------HVN  70
            +       L GPKYDGK+LH ++K  LGDT L QTLT                    +V 
Sbjct  113  SAANLVKTLGGPKYDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVK  172

Query  69   DSPEKNAKLSDICIATSAAPTYL  1
            ++P  +A LSDICI TSAAPTYL
Sbjct  173  NNPSTDALLSDICIGTSAAPTYL  195



>ref|XP_006388385.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
 gb|ERP47299.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
Length=390

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 35/203 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            M N QT P SP         +P  G  +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG 
Sbjct  1    MANMQT-PRSPL-------QLPTRGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGA  52

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ  172
            DAR+ADYFDVI+GTSTGGL+T MLAAP+K  RPL+A KDI  FY E+ P IFP ++S + 
Sbjct  53   DARLADYFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFA  112

Query  171  N------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLT--------------------HVN  70
            +       L GPKYDGK+LH ++K  LGDT L QTLT                    +V 
Sbjct  113  SAANLVKTLGGPKYDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVK  172

Query  69   DSPEKNAKLSDICIATSAAPTYL  1
            ++P  +A LSDICI TSAAPTYL
Sbjct  173  NNPSTDALLSDICIGTSAAPTYL  195



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 120/184 (65%), Gaps = 28/184 (15%)
 Frame = -2

Query  468  IPPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstggl  295
            +PP+   ++TILSIDGGGIRGIIP  I+ +LE QLQ  DG DARIADYFDVIAGTSTGGL
Sbjct  12   LPPTNGNLITILSIDGGGIRGIIPAAILDFLESQLQELDGEDARIADYFDVIAGTSTGGL  71

Query  294  mttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYL  133
            +T ML AP++  RPLYA K+I PFY  +GP IFP      G     QN + GP YDGKYL
Sbjct  72   ITAMLTAPNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYDGKYL  131

Query  132  HQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAA  13
            H++LK  LG TRL QTLT+                    V  SP  +A LSDICI TSAA
Sbjct  132  HKILKEKLGQTRLRQTLTNVVIPTFDVKYLQPTIFSTYEVKASPLLDALLSDICIGTSAA  191

Query  12   PTYL  1
            PTY 
Sbjct  192  PTYF  195



>ref|XP_006372536.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
 gb|ERP50333.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
Length=368

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 35/203 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            M N QT P SP         +P  G  +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG 
Sbjct  1    MANMQT-PRSPL-------QLPTQGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGA  52

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ  172
            DAR+ADYFDVI+GTSTGGL+T MLAAP+K  RPL+A KDI  FY E+ P IFP ++S + 
Sbjct  53   DARLADYFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFA  112

Query  171  N------MLAGPKYDGKYLHQVLKNNLGDTRLSQTLT--------------------HVN  70
            +       L GPKYDGK+LH ++K  LGDT L QTLT                    +V 
Sbjct  113  SAANLVKTLRGPKYDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSCNVK  172

Query  69   DSPEKNAKLSDICIATSAAPTYL  1
            ++P  +A LSDICI TSAAPTYL
Sbjct  173  NNPSTDALLSDICIGTSAAPTYL  195



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 120/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDV+AGTSTG L+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGSLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-------QNMLAGPKYDGKYL  133
            T ML APD+N RPLYA KDI PFY EH P IFP                L G KYDGKYL
Sbjct  70   TAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGSKYDGKYL  129

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H+V+K  L DTRLS T+T+V                      +   +AKLSDICI+TSAA
Sbjct  130  HEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICISTSAA  189

Query  12   PTYL  1
            PTYL
Sbjct  190  PTYL  193



>gb|KCW66471.1| hypothetical protein EUGRSUZ_F00268 [Eucalyptus grandis]
Length=390

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 123/188 (65%), Gaps = 28/188 (15%)
 Frame = -2

Query  480  IAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgts  307
            +A   PP+   ++TILSIDGGGIRGIIP TI+A+LE +LQ  DG DAR+ADYFDVIAGTS
Sbjct  4    LAKVQPPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTS  63

Query  306  tgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---QNM---LAGPKYD  145
            TGGL+T ML AP++  R L+A KDI  FY EH P IFP     W   +N+   L GPKYD
Sbjct  64   TGGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYD  123

Query  144  GKYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIA  25
            GKYLH +++  LG+ RL  TLTH                    V  SP  +A+LSDICI 
Sbjct  124  GKYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIFSSYEVVRSPYLDARLSDICIG  183

Query  24   TSAAPTYL  1
            TSAAPTYL
Sbjct  184  TSAAPTYL  191



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 131/204 (64%), Gaps = 36/204 (18%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGV-VTILSidgggirgiipgtIVAYLEEQLQTFDGP  352
            M N QT P SP         +P  G  +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DGP
Sbjct  1    MANMQT-PRSPL-------QLPTRGNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGP  52

Query  351  DARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSA--  178
            DAR+ADYFDVI+GTSTGGL+T MLAAP+K  RPL+A KDI  FY E+ P IFP ++S+  
Sbjct  53   DARLADYFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSSKF  112

Query  177  -----WQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------V  73
                     L GPKYDGK+LH ++K  LGDT L QTLT+                    V
Sbjct  113  ASAANLVKTLRGPKYDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKV  172

Query  72   NDSPEKNAKLSDICIATSAAPTYL  1
             ++P  +  LSDICI TSAAPTYL
Sbjct  173  KNNPSTDVLLSDICIGTSAAPTYL  196



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 122/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            VVTILSIDGGG+RGIIPGTI+ +LE +LQ  DGPDARIADYFD+IAGTSTGGL+TTML A
Sbjct  18   VVTILSIDGGGVRGIIPGTILEFLEAKLQELDGPDARIADYFDIIAGTSTGGLVTTMLTA  77

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNML------AGPKYDGKYLHQVLKNN  112
            P+K+ RPL++ KDI+ FY E+ P IFP  T      L      +GPKYDGK+LH  +K  
Sbjct  78   PNKDNRPLFSAKDIIQFYLENCPKIFPQRTGLLAGALNLFGAVSGPKYDGKFLHSKVKEL  137

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LGDT+L QTLT++                       P K+A LSDICI+TSAAPTYL
Sbjct  138  LGDTKLHQTLTNIVIPAFDIKLLQPVIFSTFETKTDPSKDALLSDICISTSAAPTYL  194



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 123/188 (65%), Gaps = 28/188 (15%)
 Frame = -2

Query  480  IAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgts  307
            +A   PP+   ++TILSIDGGGIRGIIP TI+A+LE +LQ  DG DAR+ADYFDVIAGTS
Sbjct  4    LAKVQPPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTS  63

Query  306  tgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---QNM---LAGPKYD  145
            TGGL+T ML AP++  R L+A KDI  FY EH P IFP     W   +N+   L GPKYD
Sbjct  64   TGGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYD  123

Query  144  GKYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIA  25
            GKYLH +++  LG+ RL  TLTH                    V  SP  +A+LSDICI 
Sbjct  124  GKYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIFSSYEVVRSPYLDARLSDICIG  183

Query  24   TSAAPTYL  1
            TSAAPTYL
Sbjct  184  TSAAPTYL  191



>ref|XP_002445638.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
 gb|EES15133.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
Length=438

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 138/210 (66%), Gaps = 35/210 (17%)
 Frame = -2

Query  549  ISYQSFEMGNSQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEE  376
            ++ ++   G S +T  +P        S PP+   +VT+LSIDGGG+RGIIPGTI+ +LEE
Sbjct  24   VARRALSRGASTSTLGTPK-------SPPPAYGSIVTVLSIDGGGVRGIIPGTILGFLEE  76

Query  375  QLQTFDGPDARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIF  196
            +LQ  DGPDAR+ADYFDVIAGTSTGGL+T ML AP+K+ RPL+A KDI  FY EH P IF
Sbjct  77   KLQELDGPDARLADYFDVIAGTSTGGLVTAMLTAPNKDGRPLFAAKDINDFYLEHCPKIF  136

Query  195  PGNTSA-----WQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------  73
            P  +S      +++M AGPKYDGKYLH +++  LG+TR+SQ L ++              
Sbjct  137  PSGSSGGPLGLFKSM-AGPKYDGKYLHSIVRELLGETRVSQALQNIVIPTFDIKLLQPTV  195

Query  72   ------NDSPEKNAKLSDICIATSAAPTYL  1
                       K+A LSD+CI+TSAAPTYL
Sbjct  196  FSRYDAMSDVSKDALLSDVCISTSAAPTYL  225



>ref|XP_006360248.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=411

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 120/185 (65%), Gaps = 25/185 (14%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            IA        VTILSIDGGGIRGIIPGTI+A+LE +LQ  DGP+ARIADYFDV+AGTSTG
Sbjct  21   IACVATKRKTVTILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTG  80

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT-----SAWQNMLAGPKYDGKY  136
            GL+TTML AP+K+ RPLY  KDI  FY EHGP IFP N+         N+  GPKYDGKY
Sbjct  81   GLVTTMLTAPNKDNRPLYVAKDINNFYMEHGPKIFPQNSRNNFMKKMLNLFGGPKYDGKY  140

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSA  16
            L  ++++ LG+  + QTLTH                       S  KNA+LSD+ + TSA
Sbjct  141  LRSLVRSELGNLTMKQTLTHTLIPTFDIKRLQPIIFTTTDARASESKNARLSDVSLGTSA  200

Query  15   APTYL  1
            APTY 
Sbjct  201  APTYF  205



>ref|XP_010089434.1| Patatin group A-3 [Morus notabilis]
 gb|EXB37800.1| Patatin group A-3 [Morus notabilis]
Length=399

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 120/184 (65%), Gaps = 28/184 (15%)
 Frame = -2

Query  468  IPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstggl  295
            +PP    V+TILSIDGGGIRGIIPG I+ +LE  LQ  DG D R+ADYFDVI GTSTGGL
Sbjct  11   LPPKYGNVITILSIDGGGIRGIIPGVILNFLESHLQELDGEDVRLADYFDVITGTSTGGL  70

Query  294  mttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYL  133
            +T MLAAPD N RPL++ KDIVPFY EHGP IFP     + ++      L GPKY+GKYL
Sbjct  71   VTAMLAAPDANNRPLFSAKDIVPFYIEHGPKIFPQTRGPFASVVDFVKELIGPKYNGKYL  130

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
             ++++  LG T L QTLT+V                      S E  AKLSDICI+TSAA
Sbjct  131  RKLVREKLGQTGLQQTLTNVVIPTFDLKKLQPTIFSSYQTRSSTESEAKLSDICISTSAA  190

Query  12   PTYL  1
            PTY 
Sbjct  191  PTYF  194



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 123/177 (69%), Gaps = 23/177 (13%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ YLE QLQ  DG  AR+ADYFDVI GTSTGGL+
Sbjct  15   PPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVITGTSTGGLV  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVLKNN  112
            T ML AP+ N+RPL+A KDI PFY EH P IFP +   +++ LAGPKYDGKYLH +++  
Sbjct  75   TAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKYLFRS-LAGPKYDGKYLHDMVREK  133

Query  111  LGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
            LG+ R+ +TLT+                    V  +P  +A+LSDICI TSAAPTYL
Sbjct  134  LGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSDICIGTSAAPTYL  190



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 125/177 (71%), Gaps = 28/177 (16%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGI+PG I+AYLE QLQ  DG DARIADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGN-------TSAWQNMLAGPKYDGKYLHQVLKNN  112
            ++ +RPL+  KDIVPFY  + P IFP         T+ W+  ++GPKYDGKYLH+++++ 
Sbjct  79   NEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWK-AISGPKYDGKYLHKLVRDI  137

Query  111  LGDTRLSQTLTHVN--------------------DSPEKNAKLSDICIATSAAPTYL  1
            L DTRL QTLT+V                     ++P K+A LSDICIATSAAPTY 
Sbjct  138  LKDTRLHQTLTNVVIPTFDIKKIQPVIFSSYQVPNNPIKDALLSDICIATSAAPTYF  194



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 122/177 (69%), Gaps = 27/177 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +T+LSIDGGGIRGIIPGTI+A+LE +LQ  DGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSA-------WQNMLAGPKYDGKYLHQVLKNN  112
            +K  RPL+A KDI  FY E+ P IFP ++S+           L GPKYDGK+LH ++K  
Sbjct  80   NKQNRPLFAAKDINEFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDGKFLHGIVKEK  139

Query  111  LGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAPTYL  1
            LGDT L QTLT                    +V ++P  +A LSDICI TSAAPTYL
Sbjct  140  LGDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTDALLSDICIGTSAAPTYL  196



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 118/183 (64%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGG+RGII  TI+A LE +L+  DG DAR+ADYFDVI GTSTGGL+
Sbjct  9    PPTDGNIITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVIGGTSTGGLV  68

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY EH P IFP     W  +      L GPKYDGKYLH
Sbjct  69   TAMLTAPNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYLH  128

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++K+ LG+ RL  TLTH                    V  SP  +A+LSDICI TSAAP
Sbjct  129  GLIKDKLGEARLHDTLTHVIIPTFDIERLQPTIFSSYEVVRSPCLDARLSDICIGTSAAP  188

Query  9    TYL  1
            TYL
Sbjct  189  TYL  191



>gb|ACU24007.1| unknown [Glycine max]
Length=188

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 118/176 (67%), Gaps = 30/176 (17%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE +LQ  DGPDAR+ADYFDVI+GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESRLQELDGPDARLADYFDVISGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYDGKY  136
            T M+ APD N RPL+A KDI PFY +H P IFP ++           +++L GPKYDGKY
Sbjct  73   TAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKY  132

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            LH V++  LGD RL +TLT+V                     +SP  +AKLSDICI
Sbjct  133  LHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDICI  188



>ref|XP_010101003.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86651.1| Patatin group A-3 [Morus notabilis]
Length=411

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 117/178 (66%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            V+T+LSIDGGGIRGIIP  ++ +LE +LQ  DG DARIADYFDVIAGTSTGGL+T MLAA
Sbjct  16   VITVLSIDGGGIRGIIPAIVLGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYLHQVLKN  115
            P++  RPL+A KDI  FY +H P IFP       G  +     L GPKYDGKYLH++LK 
Sbjct  76   PNEKNRPLFAAKDIKNFYLQHCPKIFPQDSIPLAGRATEIIKSLTGPKYDGKYLHKLLKE  135

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LGD +L QTLT+                    V  +P  +A LSDICI TSAAPTYL
Sbjct  136  KLGDLKLHQTLTNVIIPTFDIKRLQPIIFSSYEVKRNPSLDALLSDICIGTSAAPTYL  193



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 120/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML APD  KRPL+A K+I+PFY EHGP IFP      G   +    L GPKYDGKYL 
Sbjct  71   TAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLK  130

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
            +++K  LG TRL +TLT                     V  SP  +A L+DICI +SAAP
Sbjct  131  RIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAP  190

Query  9    TYL  1
            TY 
Sbjct  191  TYF  193



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 126/176 (72%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGI+PG I+AYLE QLQ  DG DARIADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTS--AW-QNM---LAGPKYDGKYLHQVLKNNL  109
            ++ +RPL+  KDIVPFY  + P IFP  +   AW +N+   ++GPKYDGKYLH+++++ L
Sbjct  79   NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  108  GDTRLSQTLTHVN--------------------DSPEKNAKLSDICIATSAAPTYL  1
             DTRL QTLT+V                     +SP  +A LSDICIATSAAPTY 
Sbjct  139  KDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPTYF  194



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 126/176 (72%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGI+PG I+AYLE QLQ  DG DARIADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTS--AW-QNM---LAGPKYDGKYLHQVLKNNL  109
            ++ +RPL+  KDIVPFY  + P IFP  +   AW +N+   ++GPKYDGKYLH+++++ L
Sbjct  79   NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  108  GDTRLSQTLTHVN--------------------DSPEKNAKLSDICIATSAAPTYL  1
             DTRL QTLT+V                     +SP  +A LSDICIATSAAPTY 
Sbjct  139  KDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPTYF  194



>ref|XP_010064131.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66170.1| hypothetical protein EUGRSUZ_F00006 [Eucalyptus grandis]
Length=238

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 128/202 (63%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  + + P  P T G          ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG D
Sbjct  1    MERAMSLPLQPPTYG---------NLITILSIDGGGIRGLIPGTILAFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ-  172
            ARIADYFDVIAGTSTGGL+T ML +PD+N RPL+A KDI  FY ++ P IFP ++  +  
Sbjct  52   ARIADYFDVIAGTSTGGLVTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAP  111

Query  171  -----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
                   + GPKYDGKYLH+++K  LG+ RL QTLT+                    V  
Sbjct  112  ATKMIKAVTGPKYDGKYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKR  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  NA LSDICI+TSAAPTYL
Sbjct  172  KPSINALLSDICISTSAAPTYL  193



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ YLE QLQ  DG  AR+ADYFDVI GTSTGGL+
Sbjct  15   PPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVITGTSTGGLV  74

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP+ N+RPL+A KDI PFY EH P IFP      G+ +     LAGPKYDGKYLH
Sbjct  75   TAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRSLAGPKYDGKYLH  134

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +++  LG+ R+ +TLT+                    V  +P  +A+LSDICI TSAAP
Sbjct  135  DMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDARLSDICIGTSAAP  194

Query  9    TYL  1
            TYL
Sbjct  195  TYL  197



>ref|XP_006601293.1| PREDICTED: patatin-11-like [Glycine max]
 gb|KHN12763.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 126/194 (65%), Gaps = 29/194 (15%)
 Frame = -2

Query  495  ATGGYIA---ASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFD  325
            AT G+++          +VT+LSIDGGGIRGIIPG I+ +LE +LQ  DG   R+ADYFD
Sbjct  3    ATKGFVSPTSCKCDDGHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFD  62

Query  324  VIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-----  160
            VIAGTSTGGL+T ML APD+N RPLYA KDI  FY +H P IFP N + +  +L      
Sbjct  63   VIAGTSTGGLVTAMLTAPDENNRPLYAAKDIKDFYLDHTPKIFPQNNNLFSPILKLGRTL  122

Query  159  -GPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
             GP+Y+GKYLH++++  LGDT+L QTLT+V                       P+ NA L
Sbjct  123  FGPQYNGKYLHKLIREKLGDTKLHQTLTNVVIPAFDIKHLQPAIFSSFQLKKRPDLNASL  182

Query  42   SDICIATSAAPTYL  1
            SDICI+TSAAPTYL
Sbjct  183  SDICISTSAAPTYL  196



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DG  AR+ADYFDVI GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVITGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML+AP+  KRPL+A KDI PFY EH P IFP      G+       L GPKYDGKYLH
Sbjct  73   TAMLSAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSFGKLFRSLVGPKYDGKYLH  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +V++  LG+ R+ +TLT+                    +  +P  +A+LSDICI+TSAAP
Sbjct  133  EVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKIKKTPCMDARLSDICISTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>ref|XP_004973688.1| PREDICTED: patatin-2-Kuras 1-like isoform X2 [Setaria italica]
Length=432

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 39/199 (20%)
 Frame = -2

Query  513  TTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARI  340
            +TP SP          PP+   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DG DARI
Sbjct  35   STPMSP----------PPAFGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGTDARI  84

Query  339  ADYFDVIAgtstgglmttmLAAPDKN--KRPLYAGKDIVPFYKEHGPYIFP---GNTSAW  175
            ADYFDVIAGTSTGGL+T ML AP+K   KRPL+A KDI  FY EH P IFP   G    +
Sbjct  85   ADYFDVIAGTSTGGLVTAMLTAPNKENPKRPLFAAKDINKFYLEHCPKIFPCSGGPLGLF  144

Query  174  QNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH---------------------VNDSPE  58
            +++++GPKYDGKYLH +++  LG+T++S  LT+                     VND   
Sbjct  145  KSIMSGPKYDGKYLHSIVRELLGETKVSDVLTNIVIPTFDIKLLQPTIFSRYDAVNDV-S  203

Query  57   KNAKLSDICIATSAAPTYL  1
            KNA LSD+CI+TSAAPTYL
Sbjct  204  KNALLSDVCISTSAAPTYL  222



>gb|KDP38381.1| hypothetical protein JCGZ_04306 [Jatropha curcas]
Length=377

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 126/199 (63%), Gaps = 36/199 (18%)
 Frame = -2

Query  513  TTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARI  340
            +TP SP          PP+   ++TILSIDGGGIRG+IP TI+++LE +LQ  DG +AR+
Sbjct  4    STPRSPLQ--------PPTFGKLITILSIDGGGIRGLIPATILSFLESELQKLDGEEARL  55

Query  339  ADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ----  172
            ADYFDVI GTSTGGL+T ML AP++  +PL+A KDI  FY EH P IF  +TS +     
Sbjct  56   ADYFDVITGTSTGGLVTAMLTAPNEQNKPLFAAKDIKDFYTEHCPKIFHQDTSPFAPAAN  115

Query  171  --NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPE  58
                L GPKYDGKYLH ++K  LGD R+ QTLTHV                      +P 
Sbjct  116  LVKSLTGPKYDGKYLHNIVKEKLGDIRIDQTLTHVVIPTFDIKHLQPTIFSSYEAKKNPS  175

Query  57   KNAKLSDICIATSAAPTYL  1
             NA LSDICIATSAAPTYL
Sbjct  176  MNALLSDICIATSAAPTYL  194



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 121/186 (65%), Gaps = 28/186 (15%)
 Frame = -2

Query  474  ASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++ PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTG
Sbjct  2    SNTPPTYGSLVTILSIDGGGIRGIIPATILALLESQLQXLDGDDARIADYFDVIAGTSTG  61

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGK  139
            GL+T ML APD  KRPL+A K+I+PFY EHGP IFP      G   +    L GPKYDGK
Sbjct  62   GLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDGK  121

Query  138  YLHQVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATS  19
            YL ++ K  LG TRL +TLT                     V  SP  +A L+DICI +S
Sbjct  122  YLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  181

Query  18   AAPTYL  1
            AAPTY 
Sbjct  182  AAPTYF  187



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 126/182 (69%), Gaps = 28/182 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIPGTI+ +LE +LQ  DG + R+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-----QNMLAGPKYDGKYLHQ  127
            T M++APD+N RPL++ KDI  FY +H P IFP N   W       +L+GPKYDGKYL +
Sbjct  70   TAMISAPDQNNRPLFSAKDINQFYLDHCPKIFPQN-RIWPIGRIVKLLSGPKYDGKYLRK  128

Query  126  VLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPT  7
            ++K  LGDT+L QTLT+V                     ++P  +A LSDICI+TSAAPT
Sbjct  129  LVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLDAYLSDICISTSAAPT  188

Query  6    YL  1
            YL
Sbjct  189  YL  190



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 118/183 (64%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDG GIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLVTILSIDGRGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS--AW-QNM---LAGPKYDGKYLH  130
            T ML AP+  KRPL+A KDI PFY EHGP IFP       W  N+   + GP YDGKYLH
Sbjct  71   TAMLTAPNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
             ++K  LG TRL QTLT                     V  SP  +A L+DICI +SAAP
Sbjct  131  NLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAP  190

Query  9    TYL  1
            TY 
Sbjct  191  TYF  193



>ref|XP_010547841.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=407

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 129/183 (70%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+A+LE ++Q  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGKLITILSIDGGGIRGIIPATILAFLEAEIQKLDGEEARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+AG +I  FY EH P IFP +    S+ +N+   L+GPKYDGKYLH
Sbjct  70   TAMLTAPNKKGRPLFAGNEIKDFYLEHCPKIFPQDHFPFSSAKNLVKTLSGPKYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++K  LGDTRL+QTLT+                    V ++  KNA L+DI I+TSAAP
Sbjct  130  QLVKEKLGDTRLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNSLKNATLADISISTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>gb|EMT06740.1| Patatin group A-3 [Aegilops tauschii]
Length=412

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 129/187 (69%), Gaps = 25/187 (13%)
 Frame = -2

Query  519  SQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDA  346
            S  TP SP          PP+   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ FDGPDA
Sbjct  27   SLATPKSP----------PPAYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEFDGPDA  76

Query  345  RIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSA  178
            RI+DYFDV+AGTSTGGL+T ML AP+ + RPL+A KDI  FY EH P IFP    G +  
Sbjct  77   RISDYFDVMAGTSTGGLVTAMLTAPNADGRPLFAAKDINDFYMEHCPNIFPPVSKGPSGL  136

Query  177  WQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHVN--------DSPEKNAKLSDICIAT  22
            +++M  GPKYDG +L  V+K  LGDTR+ QTL+++             KNA LSD+CI T
Sbjct  137  FKSM-TGPKYDGDHLRSVVKELLGDTRVDQTLSNIAIPTFDNAMKDVSKNALLSDVCIGT  195

Query  21   SAAPTYL  1
            S APTYL
Sbjct  196  STAPTYL  202



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 121/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGG+RGIIPG I+A+LE +LQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  14   PPARGNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLI  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPLYA   I PFY E+ P IFP      G       +L GPKYDGKYLH
Sbjct  74   TAMLTAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLH  133

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +LKN LGD RL QTLT+                    V  +P  +AKLSDICI TSAAP
Sbjct  134  NLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAP  193

Query  9    TYL  1
            TYL
Sbjct  194  TYL  196



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 119/183 (65%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  16   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLV  75

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML APD  KRPL+A K+I+PFY EHGP IFP      G   +    L GPKYDGKYL 
Sbjct  76   TAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLK  135

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
            ++ K  LG TRL +TLT                     V  SP  +A L+DICI +SAAP
Sbjct  136  RITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAP  195

Query  9    TYL  1
            TY 
Sbjct  196  TYF  198



>ref|XP_007203278.1| hypothetical protein PRUPE_ppa025529mg [Prunus persica]
 gb|EMJ04477.1| hypothetical protein PRUPE_ppa025529mg [Prunus persica]
Length=374

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 121/180 (67%), Gaps = 22/180 (12%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++  +    +VT+LSIDGGGIRGIIP  ++A+LE +LQ  DGP+ARIADYFD+I+GTSTG
Sbjct  1    MSTGLTKRSMVTMLSIDGGGIRGIIPSILLAFLESKLQELDGPNARIADYFDIISGTSTG  60

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVL  121
            GL+TTML AP+K+ RPLY  KDI+ FY +H P IFP N+      + GPKYDGKYL +V+
Sbjct  61   GLVTTMLTAPNKDNRPLYEAKDIITFYLDHSPKIFPQNSMV--RAVIGPKYDGKYLRKVI  118

Query  120  KNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
               L D  L QTLT +                     +S  KNAKLSDICI+TSAAPTYL
Sbjct  119  NGLLSDLTLKQTLTTMIIPTFDIKYLQPVIFSTTDAKESALKNAKLSDICISTSAAPTYL  178



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 98/151 (65%), Gaps = 27/151 (18%)
 Frame = -2

Query  372  LQTFDGPDARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP  193
            +Q  DG DAR+ADYFDVI+GTSTGGL+T M+AAPDKN RPL+A KDI PFY EH P IFP
Sbjct  1    MQELDGEDARLADYFDVISGTSTGGLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFP  60

Query  192  GNTSAWQNMLA-------GPKYDGKYLHQVLKNNLGDTRLSQTLTHV-------------  73
             +      MLA       GPKYDGKYLH V++  LGD RL +T+T++             
Sbjct  61   QHRGLGGIMLAKVVRSLGGPKYDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPI  120

Query  72   -------NDSPEKNAKLSDICIATSAAPTYL  1
                     SP  +AKLSDICI+TSAAPTYL
Sbjct  121  IFSSYQLEKSPCLDAKLSDICISTSAAPTYL  151



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 125/191 (65%), Gaps = 28/191 (15%)
 Frame = -2

Query  489  GGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIA  316
            GG  + + PP+   ++TILSIDGGGIRG IP TI+++LE QLQ  DG D RIADYFDVIA
Sbjct  5    GGRWSMNQPPTYGEMITILSIDGGGIRGTIPATILSFLEHQLQILDGEDVRIADYFDVIA  64

Query  315  gtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGP  154
            GTSTGGL+T MLA P K+ RPLYA KDI  FY EH P IFP       +T+    +++ P
Sbjct  65   GTSTGGLVTAMLATPGKDNRPLYAAKDIPTFYLEHCPKIFPQSSGVLASTTKLWGVVSRP  124

Query  153  KYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDI  34
            KYDGKYLH +++  LGD +L QTLT++                     D   K+A LSDI
Sbjct  125  KYDGKYLHDLIRRELGDKKLHQTLTNIVVPTFDIRIMQPAVFSTYQLRDYSIKDALLSDI  184

Query  33   CIATSAAPTYL  1
            CI+TSAAPTYL
Sbjct  185  CISTSAAPTYL  195



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 114/177 (64%), Gaps = 27/177 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGIIP TI+ +LE QLQ  DG +ARIADYFDVIAGTSTGGL+  ML AP
Sbjct  17   ITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVIAGTSTGGLVAAMLTAP  76

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSA-------WQNMLAGPKYDGKYLHQVLKNN  112
            D+N RPLYA KDI PFY EH P IFP                L GPKYDGKYLH+V+K  
Sbjct  77   DENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHEVVKEK  136

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L D  +S T+T+V                      S   +AKLSDICI+TSAAPTYL
Sbjct  137  LKDICISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLSDICISTSAAPTYL  193



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 120/179 (67%), Gaps = 30/179 (17%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++TILSIDGGGI+GIIP TI+A+LE +LQ  DG DAR+ADYFD +AGTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAMAGTSTGGLVTAMLTA  77

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW--------QNMLAGPKYDGKYLHQVLK  118
            P+   RPLYA KDI  FY  H P IFP   S+W           + GP+YDGKYLH++++
Sbjct  78   PNMQNRPLYAAKDIKEFYLNHSPKIFP--QSSWPFNTAAKVIRAIIGPRYDGKYLHELIR  135

Query  117  NNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             NLG+TRL QTLT+                    V ++P  +A+LSDICI TSAAPTYL
Sbjct  136  RNLGETRLHQTLTNVVIPTFDIKRLQPTIFSSYKVKNNPLLDARLSDICIGTSAAPTYL  194



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 128/192 (67%), Gaps = 29/192 (15%)
 Frame = -2

Query  489  GGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIA  316
            G   AA  PP+   ++T+LSIDGGGIRGIIPGTI+++LE QLQ  DG DARIADYFDVIA
Sbjct  3    GANAAALQPPTYGNLITVLSIDGGGIRGIIPGTILSFLESQLQKLDGEDARIADYFDVIA  62

Query  315  gtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-------QNMLAG  157
            GTSTGGL+T MLAAP++  RP++A KDI  FY    P IFP  + A           ++G
Sbjct  63   GTSTGGLVTAMLAAPNEKNRPVFAAKDIKDFYLNECPKIFPQRSCALFPQTTKVIKAISG  122

Query  156  PKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSD  37
            PKYDGKYLH+++K  LG+TRL+QTLT+                    V + P  +A LSD
Sbjct  123  PKYDGKYLHRLVKEKLGNTRLNQTLTNVVIPTFDIKRLQPTIFSSYQVKNKPCLDALLSD  182

Query  36   ICIATSAAPTYL  1
            ICI+TSAAPTYL
Sbjct  183  ICISTSAAPTYL  194



>dbj|BAK02816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 126/199 (63%), Gaps = 35/199 (18%)
 Frame = -2

Query  522  NSQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            +S  TP SP          PPS   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DGPD
Sbjct  36   SSALTPRSP----------PPSYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGPD  85

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSA  178
             RIADYFDVIAGTSTGGL+T ML APD   RPL+A KDI  FY EH P IFP   G    
Sbjct  86   VRIADYFDVIAGTSTGGLVTAMLTAPDAKGRPLFAAKDINNFYLEHCPKIFPAVYGGPLG  145

Query  177  WQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPE  58
                + GPKYDG+YLH V+K  LG+TR+ + L ++                     +   
Sbjct  146  LLRSVRGPKYDGQYLHSVVKQLLGETRIGEALQNIVIPTFDIKLLQPTIFSRYDARNDVS  205

Query  57   KNAKLSDICIATSAAPTYL  1
            KNA LSD+CI+TSAAPTYL
Sbjct  206  KNALLSDVCISTSAAPTYL  224



>ref|XP_004291132.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 124/185 (67%), Gaps = 31/185 (17%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  11   PPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ--------NMLAGPKYDGKY  136
            T ML AP++N RPL++ KDI  FY  H P IFP   S W           LAGPKYDGKY
Sbjct  71   TAMLTAPNENNRPLFSAKDIKDFYLTHSPKIFP-QKSGWLFPRARKIIKALAGPKYDGKY  129

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH +++  LGD +L+QTLT+                    V + P  +A LSDICIATSA
Sbjct  130  LHGLVREKLGDKKLNQTLTNVVIPAFDIKSLQPAIFSSFEVKNKPTFDALLSDICIATSA  189

Query  15   APTYL  1
            APTYL
Sbjct  190  APTYL  194



>ref|XP_006425860.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
 gb|ESR39100.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
Length=386

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 122/187 (65%), Gaps = 29/187 (16%)
 Frame = -2

Query  474  ASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            A+ PP+   ++TILSIDGGGIRGIIPG I+A LE QLQ  DG DAR+ADYFDVIAGTSTG
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILACLESQLQELDGQDARLADYFDVIAGTSTG  67

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYDG  142
            GL+T ML AP +  RP+YA KDIVPFY  HGP IFP       N        L G KYDG
Sbjct  68   GLITAMLTAPSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGILANSVVNLVRALMGTKYDG  127

Query  141  KYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIAT  22
            KYLH+V+K NL DT+L QTLT+                    V  SP+ +A+L+DI I T
Sbjct  128  KYLHKVIKENLKDTKLHQTLTNVAIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGT  187

Query  21   SAAPTYL  1
            SAAPTY 
Sbjct  188  SAAPTYF  194



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 121/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGG+RGIIPG I+A+LE +LQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  14   PPARGNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLI  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPLYA   I PFY E+ P IFP      G       +L GPKYDGKYLH
Sbjct  74   TAMLTAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLH  133

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +LKN LGD RL QTLT+                    V  +P  +AKLSDICI TSAAP
Sbjct  134  NLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAP  193

Query  9    TYL  1
            TYL
Sbjct  194  TYL  196



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++TILSIDGGG+RGII G I+A LE +LQ  DG DAR++DYFDVIAGTS+GGL+
Sbjct  13   PPSRGSLITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFDVIAGTSSGGLI  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            TTMLAAP++N RPLYA  +I PF  EH P IFP      G+   +  +L GPKYDGKYLH
Sbjct  73   TTMLAAPNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDGKYLH  132

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
              +   LG+T+L QTLT+V                      +P  +AKLSDICI TSAAP
Sbjct  133  SQINKLLGNTKLDQTLTNVVIPTFDIKNLQPTIFSSYQMAATPSLDAKLSDICIGTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++T+LSIDGGGIRG+IP TI+A LE +LQ  DGPDARIADYFDVIAGTSTG L+
Sbjct  17   PPSQGRLITVLSIDGGGIRGLIPATIIACLEAKLQELDGPDARIADYFDVIAGTSTGALL  76

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW----QNM---LAGPKYDGKYL  133
            T+MLAAPD+NKRPLYA KD+  FY E+GP IFP     W     N+   + GPKYDG +L
Sbjct  77   TSMLAAPDENKRPLYAAKDLTTFYLENGPKIFPQRKLGWLTSAMNLVGTMRGPKYDGVFL  136

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H  +K+   D R++ T+T+V                       P KNA LSDICI+TSAA
Sbjct  137  HDKIKSLTHDVRVADTVTNVVVPAFDVKFLQPVIFTTYEAKADPLKNAHLSDICISTSAA  196

Query  12   PTYL  1
            PTY 
Sbjct  197  PTYF  200



>ref|XP_002510259.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52446.1| Patatin T5 precursor, putative [Ricinus communis]
Length=405

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 126/191 (66%), Gaps = 30/191 (16%)
 Frame = -2

Query  489  GGYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAg  313
            G Y     P  G +VTILSIDGGGIRGIIPGTI+++LE +LQ  DG DARIADYFDVI G
Sbjct  3    GTYAPLQAPTYGNLVTILSIDGGGIRGIIPGTILSFLESELQKLDGEDARIADYFDVITG  62

Query  312  tstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ-------NMLAGP  154
            TSTGGL+T MLA+P++  RP++A KDI  FY    P IFP +   WQ         +AGP
Sbjct  63   TSTGGLVTAMLASPNEKNRPVFAAKDIKDFYLNECPKIFPQH--CWQPQVSKVIKAIAGP  120

Query  153  KYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDI  34
            KYDGKYLH ++K  LG+TRL+QTLT+                    V ++P  NA LSDI
Sbjct  121  KYDGKYLHNLVKEKLGNTRLNQTLTNIVIPTFDVKKLQPTIFSSFQVKNNPSINALLSDI  180

Query  33   CIATSAAPTYL  1
            CI+TSAAPTYL
Sbjct  181  CISTSAAPTYL  191



>gb|KJB29508.1| hypothetical protein B456_005G104200 [Gossypium raimondii]
Length=401

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 122/178 (69%), Gaps = 28/178 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIPG I+++LE +LQ  D  +ARIADYFDVIAGTSTGGL+TTML +
Sbjct  17   LITVLSIDGGGIRGIIPGIILSFLESELQKLDSEEARIADYFDVIAGTSTGGLLTTMLTS  76

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYLHQVLKN  115
            P++  RPL+A KDI  FY EHGP IFP       G T   Q+++ GPKYDGKYLH VLK 
Sbjct  77   PNEKNRPLFAAKDIKAFYFEHGPKIFPQRRFPFSGVTKIIQSVM-GPKYDGKYLHGVLKE  135

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LG+TRL+QTLT+                    V  S   NA +SDICI TSAAPTYL
Sbjct  136  RLGNTRLNQTLTNVVIPTFDIKKLQPIIFSSYEVKKSAGLNALMSDICIGTSAAPTYL  193



>ref|XP_009133998.1| PREDICTED: patatin-like protein 2 [Brassica rapa]
Length=407

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE +LQ  DG +AR+ADYFDV+AGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+A  +I  FY EH P IFP N    SA +N+   L GPKYDG+YLH
Sbjct  72   TAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++   LGDTRL QTLT+                    V  +P KNA L+DI I+TSAAP
Sbjct  132  QLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADITISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_008241848.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=384

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 119/180 (66%), Gaps = 32/180 (18%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VT+LSIDGGGIRGIIP  ++A+LE + Q  DGP+ARIADYFD+IAGTSTGGL+TTML AP
Sbjct  11   VTVLSIDGGGIRGIIPSILLAFLESKFQELDGPNARIADYFDIIAGTSTGGLVTTMLTAP  70

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA----------GPKYDGKYLHQVL  121
            +K+ RPLY  KDIV FY +H P IFP N++   N+L           GPKYDGKYL +V+
Sbjct  71   NKDNRPLYEAKDIVTFYLDHSPKIFPQNSA--NNLLTSITSVVRAVIGPKYDGKYLRKVI  128

Query  120  KNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
               L D  L QTLT V                     +S  KNAKLSDICI+TSAAPTYL
Sbjct  129  NGLLSDLTLKQTLTTVIIPTFDIKYLQPVIFSTTDAKESALKNAKLSDICISTSAAPTYL  188



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 117/179 (65%), Gaps = 26/179 (15%)
 Frame = -2

Query  459  SGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmL  280
            S +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+T ML
Sbjct  46   SYLVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAML  105

Query  279  AAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLK  118
             APD  KRPL+A K+I+PFY EHGP IFP      G   +    L GPKYDGKYL ++ K
Sbjct  106  TAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITK  165

Query  117  NNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAPTYL  1
              LG TRL +TLT                     V  SP  +A L+DICI +SAAPTY 
Sbjct  166  EKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYF  224



>ref|XP_010059758.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=324

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
            T ML +PD+N RPL+A KDI  FY ++ P IFP ++  +         + GPKYDGKYLH
Sbjct  71   TAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++K  LG+ RL QTLT+                    V   P  NA LSDICI+TSAAP
Sbjct  131  KLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGI+GIIPG I+ +LE +LQ  DG DAR+ADYFDV++GTSTGGL+
Sbjct  7    PPAQGNLITVLSIDGGGIKGIIPGIILDFLESELQKLDGEDARLADYFDVVSGTSTGGLI  66

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNM---LAGPKYDGKYLH  130
             TML AP++N RPLYA   I PFY E+GP IFP   G  ++ +N+     GPKYDGKYLH
Sbjct  67   ATMLTAPNENNRPLYAASGIKPFYLENGPKIFPQKSGILASVENLFKAFTGPKYDGKYLH  126

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +LK+ L DTRL QTLT+                    V  +P  +AKL+DICI+TSAAP
Sbjct  127  SLLKDKLRDTRLHQTLTNVVIPTFDIKELQPTIFSSYQVTTTPSLDAKLADICISTSAAP  186

Query  9    TYL  1
            T+L
Sbjct  187  TFL  189



>emb|CDY21469.1| BnaC03g27280D [Brassica napus]
Length=407

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE +LQ  DG +AR+ADYFDV+AGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+A  +I  FY EH P IFP N    SA +N+   L GPKYDG+YLH
Sbjct  72   TAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++   LGDTRL QTLT+                    V  +P KNA L+DI I+TSAAP
Sbjct  132  QLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADITISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_006425859.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
 gb|ESR39099.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
Length=385

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 120/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  11   PPTHANLITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLI  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYDGKYL  133
            T ML AP +  RP+ A KDIVPFY  HGP IFP       N        L G KYDGKYL
Sbjct  71   TAMLTAPKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYDGKYL  130

Query  132  HQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAA  13
            H+V+K NL DT+L QTLT+                    V  SP+ +A+L+DI I TSAA
Sbjct  131  HKVIKENLKDTKLHQTLTNVVIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSAA  190

Query  12   PTYL  1
            PTY 
Sbjct  191  PTYF  194



>ref|XP_008457873.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=392

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 121/186 (65%), Gaps = 26/186 (14%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            +AA       +TILSIDGGGIRGIIPGTI+A+LE +LQ  DGPDARIADYFDVIAGTSTG
Sbjct  1    MAAKYEKGEKITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARIADYFDVIAGTSTG  60

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNMLA---GPKYDGK  139
            GL+T+ML AP++N RPLYA KD+  FY EHGP IFP      S+  NM     GPKYDGK
Sbjct  61   GLVTSMLTAPNENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSMVNMFGKVMGPKYDGK  120

Query  138  YLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATS  19
            YL  ++   LGD  L QTLT V                         KN KL+D+CI+TS
Sbjct  121  YLRSLINRLLGDITLKQTLTEVIIPAFDIKLLQPVIFSTLDAKWDALKNPKLADVCISTS  180

Query  18   AAPTYL  1
            AAPT+L
Sbjct  181  AAPTFL  186



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 126/187 (67%), Gaps = 27/187 (14%)
 Frame = -2

Query  480  IAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
            IA S P  G +VT+LSIDGGG+RGIIPGTI+A+LE +L   DG DARIADYFDV+AGTST
Sbjct  83   IANSPPSKGSLVTVLSIDGGGVRGIIPGTILAFLESKLHDLDGEDARIADYFDVVAGTST  142

Query  303  gglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN------MLAGPKYDG  142
            GGL+T ML AP+KN RPL+A  DI  FY E+ P IFP  T  + +      ++ GPKYDG
Sbjct  143  GGLVTAMLTAPNKNNRPLFAADDITKFYLENSPKIFPQKTGIFSSTCNLFTVVTGPKYDG  202

Query  141  KYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIAT  22
            KYLH +++  LG+TRL Q LT++                      +P K++ LSDICI+T
Sbjct  203  KYLHSIIRELLGETRLHQALTNIVIPTFDIKLLQPTIFSTFEARHAPLKDSLLSDICIST  262

Query  21   SAAPTYL  1
            SAAPTYL
Sbjct  263  SAAPTYL  269



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+ +LE QLQ  DG  AR+ADYFDVI GTSTGGL+
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVITGTSTGGLV  72

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML+AP+  +RPL+A KDI PFY EH P IFP      G+       LAGPKYDG YLH
Sbjct  73   TAMLSAPNDKQRPLFAAKDIKPFYLEHCPKIFPQQKHMLGSVGKLFKSLAGPKYDGNYLH  132

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             V++  LG+ R+ +TLT+                    + ++P  +A+LSDICI+TSAAP
Sbjct  133  SVVREKLGEIRVHETLTNIVIPTFDIKTSQPIIFSSYKIKNAPCMDARLSDICISTSAAP  192

Query  9    TYL  1
            TYL
Sbjct  193  TYL  195



>emb|CDP07842.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 125/194 (64%), Gaps = 37/194 (19%)
 Frame = -2

Query  471  SIPP--SGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgg  298
            ++PP    +VTILSIDGGGIRGIIP TI+ +LE +LQ  DG +ARIADYFDVIAGTSTGG
Sbjct  10   NLPPVNENLVTILSIDGGGIRGIIPATILDFLESELQELDGQEARIADYFDVIAGTSTGG  69

Query  297  lmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------------NML  163
            L+ TML AP++  RPL+A KDI PFY EHGP IFP  +   +               N  
Sbjct  70   LIATMLTAPNEKDRPLFAAKDIKPFYMEHGPKIFPQRSGFRRMIKFCGIQKMIKFVLNFF  129

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV------------------NDS--PEKNAKL  43
             GP YDGKYLH++LK  LG+TRL +TLT+V                   D+  P  +A+L
Sbjct  130  PGPVYDGKYLHKILKEKLGETRLRKTLTNVVIPTFDVKCLQPIIFSTFEDAKYPLLDARL  189

Query  42   SDICIATSAAPTYL  1
            SDICI+TSAAPTY 
Sbjct  190  SDICISTSAAPTYF  203



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 119/183 (65%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  57   PPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLV  116

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS--AW-QNM---LAGPKYDGKYLH  130
            T ML AP+  KRPL+A KDI PFY +HGP IFP       W  N+   + GP YDGKYLH
Sbjct  117  TAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRGIFGWIMNIFRSIVGPNYDGKYLH  176

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
             ++K  LG TRL QTLT                     V  SP  +A L+DICI +SAAP
Sbjct  177  NLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAAP  236

Query  9    TYL  1
            TY 
Sbjct  237  TYF  239



>ref|XP_006466737.1| PREDICTED: patatin-14-like [Citrus sinensis]
Length=402

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 120/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  11   PPTHANLITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLI  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYDGKYL  133
            T ML AP +  RP+ A KDIVPFY  HGP IFP       N        L G KYDGKYL
Sbjct  71   TAMLTAPKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYDGKYL  130

Query  132  HQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAA  13
            H+V+K NL DT+L QTLT+                    V  SP+ +A+L+DI I TSAA
Sbjct  131  HKVIKENLKDTKLHQTLTNVVIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSAA  190

Query  12   PTYL  1
            PTY 
Sbjct  191  PTYF  194



>ref|XP_008220192.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=417

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 120/179 (67%), Gaps = 28/179 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+ +LE +LQ  DG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  82

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKYLHQVLK  118
            PD+N RPL+A KDI  FY EH P IFP        G+       ++GPKYDGKYLH+++K
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGDAMDMVKAVSGPKYDGKYLHKIVK  142

Query  117  NNLGDTRLSQTLTHV---------------NDSPEK-----NAKLSDICIATSAAPTYL  1
              LGD RLS TLT+V               +   EK     NA LSDICI TSAAPTYL
Sbjct  143  EILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLSDICIGTSAAPTYL  201



>ref|XP_004310193.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 124/185 (67%), Gaps = 31/185 (17%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG +AR+ADYFDVI+GTSTGGL+
Sbjct  11   PPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQMLDGENARLADYFDVISGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ--------NMLAGPKYDGKY  136
            T ML AP++N RPL+A KDI  FY  H P IFP   S W           LAGPKYDGKY
Sbjct  71   TAMLTAPNENNRPLFAAKDIKDFYLTHSPKIFP-QKSGWLFPRARKIIKALAGPKYDGKY  129

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH +++  LGD +L+QTLT+                    V + P  +A LSDICIATSA
Sbjct  130  LHGLVREKLGDKKLNQTLTNVVIPAFDIKNLQPAIFSSFEVKNKPTFDALLSDICIATSA  189

Query  15   APTYL  1
            APTYL
Sbjct  190  APTYL  194



>gb|KCW66173.1| hypothetical protein EUGRSUZ_F00009 [Eucalyptus grandis]
Length=224

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRG+IPGTI+ +LE +LQ  DG DAR+ADYFDVI+GTSTGGL+T ML  P
Sbjct  18   ITILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTTP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLKNNL  109
            ++N RP++A KDI  FY  H P IFP ++  ++        +AGPKYDGKYLH V+++ L
Sbjct  78   NENNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKMIKAMAGPKYDGKYLHSVVRDEL  137

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            GD RL QTLT+V                       P  +A LSDICI+TSAAPTYL
Sbjct  138  GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYL  193



>gb|KDO79284.1| hypothetical protein CISIN_1g0425841mg, partial [Citrus sinensis]
Length=311

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 122/180 (68%), Gaps = 27/180 (15%)
 Frame = -2

Query  474  ASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            A+ PP+   ++TILSIDGGGIRGIIPG I+AYLE QLQ  DG DAR+ADYFDVIAGTSTG
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTG  67

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVL  121
            GL+T ML AP +  RP+ A KDIVPFY  HGP IFP   +     L G KYDGKYLH+V+
Sbjct  68   GLITAMLTAPKEQNRPMSAAKDIVPFYIRHGPKIFPQLRA-----LMGSKYDGKYLHKVI  122

Query  120  KNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
            K +L DT+L QTLT+                    V  SP+ +A+L+DI I TSAAPTY 
Sbjct  123  KEDLKDTKLHQTLTNVVIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSAAPTYF  182



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 116/176 (66%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VTILSIDGGGIRGIIP  I+ +LE +LQ  DG DAR+ADYFDVIAGTSTGGL+T MLAAP
Sbjct  18   VTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVIAGTSTGGLVTAMLAAP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNNL  109
            ++N RPLYA KDI  FY E+ P IFP      G       +L+GPKYDGKYLH +L+  +
Sbjct  78   NENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDGKYLHNLLQQKV  137

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            G T+L QTLT+V                     + P  +  LSDICI TSAAPT+L
Sbjct  138  GKTKLHQTLTNVVIPTFDIKLLQPTIFSSYAIKNEPSLDGVLSDICIGTSAAPTFL  193



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 119/179 (66%), Gaps = 28/179 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+ +LE +LQ  DG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKYLHQVLK  118
            PD+N RPL+A KDI  FY EH P IFP        G        ++GPKYDGKYLH+++K
Sbjct  76   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKYDGKYLHKIVK  135

Query  117  NNLGDTRLSQTLTHV---------------NDSPEK-----NAKLSDICIATSAAPTYL  1
              LGD RLS TLT+V               +   EK     NA LSDICI TSAAPTYL
Sbjct  136  EILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLSDICIGTSAAPTYL  194



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
            T ML +PD+N RPL+A KDI  FY ++ P IFP ++  +         + GPKYDGKYLH
Sbjct  71   TAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++K  LG+ RL QTLT+                    V   P  NA LSDICI+TSAAP
Sbjct  131  ELVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>ref|XP_009366768.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=387

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 124/188 (66%), Gaps = 28/188 (15%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++  +    +VT+LSIDGGGIRGIIP T++A+LE +LQ  DGP ARIADYFD+IAGTSTG
Sbjct  1    MSTGLTKRRMVTVLSIDGGGIRGIIPSTLLAFLESKLQELDGPAARIADYFDIIAGTSTG  60

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYD  145
            GL+TTMLAAP+K+ RP+Y  KDI  FY +H P IFP N+        ++    + GPKYD
Sbjct  61   GLVTTMLAAPNKDNRPMYEAKDINNFYLDHTPKIFPQNSRNNFLTSLTSMVGAVMGPKYD  120

Query  144  GKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIA  25
            G+YL  + K  LGD  L QTLT V                     +SP KNAKLSDICI+
Sbjct  121  GEYLRTLTKELLGDLTLKQTLTTVIIPTFDIKHLQPVLFSTIDAKESPLKNAKLSDICIS  180

Query  24   TSAAPTYL  1
            TSAAPT+L
Sbjct  181  TSAAPTFL  188



>ref|XP_008220195.1| PREDICTED: patatin-like protein 2 isoform X2 [Prunus mume]
Length=415

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 122/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+ +LE +LQ  DG +AR+ DYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDVIAGTSTGGLVTAMLTT  82

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGN---TSAWQNM---LAGPKYDGKYLHQVLKNN  112
            PD+N RPL+A KDI  FY EH P IFP +   TS   +M   ++GPKYDGKYLH+++K  
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDRYLTSYLTSMVKAVSGPKYDGKYLHKIMKEI  142

Query  111  LGDTRLSQTLTHV---------------NDSPEK-----NAKLSDICIATSAAPTYL  1
            LGD RLS TLT+V               +   EK     NA LSDICI TSAAPTYL
Sbjct  143  LGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLSDICIGTSAAPTYL  199



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 119/183 (65%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE +LQ  DG DARIADYFDVIAGTSTGG++
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML APD  KRPL+A KDI PFY EHGP IFP      G   +    + GPKYDGKYL 
Sbjct  71   TAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLK  130

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
            +++K  LG TRL +TLT                     V  SP  +A L+DICI +SAAP
Sbjct  131  RLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAP  190

Query  9    TYL  1
            TY 
Sbjct  191  TYF  193



>ref|XP_004169210.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=258

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 118/176 (67%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGIIPGTI+A+LE +LQ  DGPDAR+ADYFDVIAGTSTGGL+T+ML AP
Sbjct  14   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARVADYFDVIAGTSTGGLVTSMLTAP  73

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNMLA---GPKYDGKYLHQVLKNNL  109
            ++N RPLYA KD+  FY EHGP IFP      S+  NM     GPKYDGKYL  ++   L
Sbjct  74   NENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSAVNMFGKVMGPKYDGKYLRSLINRLL  133

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            GD  L +TLT V                         KN KL+D+CI+TSAAPT+L
Sbjct  134  GDITLKETLTQVIIPAFDIKLLQPVIFSTLDAKWDALKNPKLADVCISTSAAPTFL  189



>ref|XP_007227189.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
 gb|EMJ28388.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
Length=410

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 119/179 (66%), Gaps = 28/179 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+ +LE +LQ  DG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKYLHQVLK  118
            PD+N RPL+A KDI  FY EH P IFP        G        ++GPKYDGKYLH+++K
Sbjct  76   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKYDGKYLHKIVK  135

Query  117  NNLGDTRLSQTLTHV---------------NDSPEK-----NAKLSDICIATSAAPTYL  1
              LGD RLS TLT+V               +   EK     NA LSDICI TSAAPTYL
Sbjct  136  EILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLSDICIGTSAAPTYL  194



>gb|EAZ07347.1| hypothetical protein OsI_29596 [Oryza sativa Indica Group]
Length=426

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 127/183 (69%), Gaps = 27/183 (15%)
 Frame = -2

Query  471  SIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgg  298
            S PPS   +VT+LSIDGGG+RGIIPGTI+A LEE+LQ  DG DARIADYFDVIAGTSTGG
Sbjct  36   SSPPSYGSIVTVLSIDGGGVRGIIPGTILASLEEKLQELDGADARIADYFDVIAGTSTGG  95

Query  297  lmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT----SAWQNMLAGPKYDGKYLH  130
            L+T ML AP+   RPL+A KDI  FY EH P IFP  +      +Q+M AGPKYDGKYLH
Sbjct  96   LVTAMLTAPNDQGRPLFAAKDINNFYLEHCPKIFPPRSIPMVGLFQSM-AGPKYDGKYLH  154

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
             V+++ LGD R+++T+T+V                     +   KNA LSD+CI+TSAAP
Sbjct  155  SVVQSLLGDKRVNETITNVVIPTFDIKLLQPITFSRYDAQNDVSKNALLSDVCISTSAAP  214

Query  9    TYL  1
            TYL
Sbjct  215  TYL  217



>emb|CDP02475.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 123/182 (68%), Gaps = 25/182 (14%)
 Frame = -2

Query  471  SIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            +I    + T+LSIDGGGIRGIIPGTI+A+LE +LQ  DGP+ARIADYFDV+AGTSTGGL+
Sbjct  26   AITKGRLATVLSIDGGGIRGIIPGTILAFLEAKLQELDGPNARIADYFDVVAGTSTGGLV  85

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT-----SAWQNMLAGPKYDGKYLHQ  127
            TTML AP+K+ RPLYA KDI  FY ++ P IFP ++      +  N+L GPKYDGKYLH 
Sbjct  86   TTMLTAPNKDSRPLYAAKDITSFYLQNSPQIFPESSRKDVVKSLTNLLGGPKYDGKYLHS  145

Query  126  VLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPT  7
            ++K  LG+  +  TLT V                      +  KNA LSD+CI+TSAAPT
Sbjct  146  LIKRLLGNLTMENTLTDVVIPTFDIKRLQPIIFSTIDAKANASKNALLSDVCISTSAAPT  205

Query  6    YL  1
            YL
Sbjct  206  YL  207



>ref|XP_009370192.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=350

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 119/178 (67%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRG+IP TI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+T MLAA
Sbjct  16   IVTVLSIDGGGIRGLIPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPG-------NTSAWQNMLAGPKYDGKYLHQVLKN  115
            P++N RPL+A KDI+ FY    P IFP        NT+     LAGPKY+GKYLH++++ 
Sbjct  76   PNENNRPLFAAKDIIDFYINQCPKIFPQNTWPIFPNTTKIIKALAGPKYNGKYLHRLIRE  135

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LG+ +L  TLT+                    V   P  +A LSDICI TSAAPTYL
Sbjct  136  RLGNKKLHDTLTNVVIPTFDIKNLQPAIFSNFKVKKKPSYDALLSDICIGTSAAPTYL  193



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
            T ML +PD+N RPL+A KDI  FY ++ P IFP ++  +         + GPKYDGKYLH
Sbjct  71   TAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++K  LG+ RL QTLT+                    V   P  NA LSDICI+TSAAP
Sbjct  131  KLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>gb|AAB08427.1| patatin homolog, partial [Nicotiana tabacum]
Length=263

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 24/172 (14%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDG-PDARIADYFDVIAgtstgglmttmLA  277
            + T+LSIDGGGI+GIIP T++++LE QLQ  D   DAR+ADYFDVIAGTSTGG++TTM++
Sbjct  28   IATVLSIDGGGIKGIIPATVLSFLESQLQELDNNEDARLADYFDVIAGTSTGGILTTMIS  87

Query  276  APDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVLKNNLGDTR  97
            AP++  RP  A KDIV FY EHGP IFP     W  +L GPKYDGKYLH+VL++ LG+TR
Sbjct  88   APNEKGRPFSAAKDIVSFYFEHGPKIFP--QGVWPPIL-GPKYDGKYLHKVLEDKLGETR  144

Query  96   LSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L QTLT+V                     +SP  +AK+SDIC  T+AAPTY 
Sbjct  145  LHQTLTNVVIPTFDMKKFQPIIFTKSEIANSPHLDAKMSDICYGTAAAPTYF  196



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 118/178 (66%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRG+IPGTI+ YLE +LQ  DG DARIADYFDVIAGTSTGGL+T MLA 
Sbjct  17   LITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGN-------TSAWQNMLAGPKYDGKYLHQVLKN  115
            PD+N RP++A KDI  FY  H P IFP         T+     LAGPKYDGKYLH ++  
Sbjct  77   PDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYTTKIIKALAGPKYDGKYLHDLVGQ  136

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LGD +L QTLT+                    V   P  +AKLSDICIATSAAPTYL
Sbjct  137  KLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSAAPTYL  194



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++ E QLQ  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  42   PPNYGNLITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVIAGTSTGGLI  101

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
              MLAAPD+NKRP  A KDI PFY EH   IF   +   +++      LAGPKYD KYLH
Sbjct  102  AAMLAAPDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYDEKYLH  161

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++++ LG+TRL  T+T+                    V  SP+ + KLSDICI TSAAP
Sbjct  162  GLMRDKLGETRLHDTVTNLVIPTFDIKRLQPTVFSSYEVRSSPDLDVKLSDICIGTSAAP  221

Query  9    TYL  1
            TYL
Sbjct  222  TYL  224



>gb|EAZ07350.1| hypothetical protein OsI_29600 [Oryza sativa Indica Group]
Length=429

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 129/194 (66%), Gaps = 35/194 (18%)
 Frame = -2

Query  510  TPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIA  337
            TP SP          PPS   +VT+LSIDGGG+RGIIPGTI+A LEE+LQ  DG DARIA
Sbjct  37   TPKSP----------PPSYGSIVTVLSIDGGGVRGIIPGTILASLEEKLQRIDGADARIA  86

Query  336  DYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--SAWQNML  163
            DYFDVIAGTSTGGL+T ML AP+   RPL+A KDI  FY EH P IFP  +    +Q+M 
Sbjct  87   DYFDVIAGTSTGGLVTAMLTAPNDQGRPLFAAKDINDFYLEHCPKIFPPRSIMGLFQSM-  145

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
            AGPKYDGKYLH V+++ LGD R+++TLT+V                         KNA L
Sbjct  146  AGPKYDGKYLHSVVQSLLGDKRVNETLTNVVIPTFDIKLLQPITFSRYDAQIDVSKNALL  205

Query  42   SDICIATSAAPTYL  1
            SD+CI+TSAAPTYL
Sbjct  206  SDVCISTSAAPTYL  219



>ref|XP_006645174.1| PREDICTED: patatin-2-Kuras 4-like [Oryza brachyantha]
Length=415

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 124/192 (65%), Gaps = 33/192 (17%)
 Frame = -2

Query  477  AASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
            +A +PPS   ++TILSIDGGG++GIIP  ++ +LE +LQ  DG DARIA+YFDVIAGTST
Sbjct  5    SACLPPSKGNMITILSIDGGGVKGIIPAVMLLFLESKLQELDGKDARIANYFDVIAGTST  64

Query  303  gglmttmLAAPD--KNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------NMLAG  157
            GGL+  MLAAP     K+P    KDIVPFY +H PYIFP  T  +           M+ G
Sbjct  65   GGLIAGMLAAPSPGNAKQPCCEAKDIVPFYLKHSPYIFPHMTGTFGWFFNILGIIKMVIG  124

Query  156  PKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSD  37
            PKYDGKYLH+++ + LGDTR+ +TLT+V                       P KNA+L+D
Sbjct  125  PKYDGKYLHKLINDLLGDTRMKETLTNVVIPTFDVKCVKPIIFSTFKARHKPLKNARLAD  184

Query  36   ICIATSAAPTYL  1
            +CI TSAAPT+L
Sbjct  185  VCIGTSAAPTFL  196



>ref|XP_006829699.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
 gb|ERM97115.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
Length=222

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 120/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+++LE +LQ  DG + R+ADYFDVI+GTSTGGL+
Sbjct  11   PPTYGDLITILSIDGGGIRGIIPSTILSFLESELQKLDGEEVRLADYFDVISGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T M+ AP  N RPLYA KDI  FY +H P IFP      G+   + + + GPKY+GKYLH
Sbjct  71   TAMITAPGDNNRPLYAAKDITSFYLDHCPKIFPQQSGLLGSARKFVSAITGPKYNGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            ++++  LGD RL QTLT V                         K+A LSDICI+TSAAP
Sbjct  131  KLVRKQLGDKRLHQTLTKVVIPAFDILLLQPTIFSSYQIKADKSKDALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>ref|XP_004148052.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004169209.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=394

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 117/176 (66%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGIIPGTI+A+LE +LQ  DGPD RIADYFDVI+GTSTGGL+T+ML AP
Sbjct  12   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVISGTSTGGLVTSMLTAP  71

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNML------AGPKYDGKYLHQVLKNNL  109
            D+N RPLYA KD+  FY EHGP IFP       +++       GPKYDGKYL  ++ N L
Sbjct  72   DENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSVMDIFGKVTGPKYDGKYLRTLINNLL  131

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            GDT L +TLT V                         KN KL+D+CI+TSAAPT L
Sbjct  132  GDTTLKETLTQVIIPAFDIKRLQPVIFTTVEAKLDELKNPKLADVCISTSAAPTIL  187



>gb|KFK30330.1| hypothetical protein AALP_AA7G247800 [Arabis alpina]
Length=401

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 118/183 (64%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   +VTILS+DGGGIRGII G ++AYLE+QLQ  DG + R+ADYFDVIAGTSTGGLM
Sbjct  12   PPSCGNLVTILSLDGGGIRGIIAGVVLAYLEKQLQELDGENVRLADYFDVIAGTSTGGLM  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIF--PGNTSAWQ----NMLAGPKYDGKYLH  130
            T ML  PDK  RP +AGKDIVPFY EH P IF  PG  S W+      L GPKYDGKYL 
Sbjct  72   TAMLTLPDKTGRPTFAGKDIVPFYLEHAPKIFPQPGFWSPWKPKFTKSLYGPKYDGKYLR  131

Query  129  QVLKNNLGDTRLSQTLTHVND--------------------SPEKNAKLSDICIATSAAP  10
             ++    G+ RL  TLT+V                      +P  +AKLSDICI TSAAP
Sbjct  132  NLISKLTGEARLRDTLTNVVIPTFDIKKFQPTIFSSYQTIVNPSLDAKLSDICIGTSAAP  191

Query  9    TYL  1
            TY 
Sbjct  192  TYF  194



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 119/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN---TSAW-QNM---LAGPKYDGKYL  133
            T ML AP+  KRPL+A KDI PFY +HGP IFP        W  N+   + GP YDGKYL
Sbjct  71   TAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYDGKYL  130

Query  132  HQVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAA  13
            H ++K  LG TRL QTLT                     V  SP  +A L+DICI +SAA
Sbjct  131  HNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSSAA  190

Query  12   PTYL  1
            PTY 
Sbjct  191  PTYF  194



>ref|XP_010102581.1| Patatin group A-3 [Morus notabilis]
 gb|EXB93684.1| Patatin group A-3 [Morus notabilis]
Length=396

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 123/177 (69%), Gaps = 28/177 (16%)
 Frame = -2

Query  447  TILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAPD  268
            T+LSIDGGGIRGIIPGT++A+LE +LQ  DGP+ RIADYFD+IAGTSTGGL+T ML AP+
Sbjct  17   TVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNVRIADYFDIIAGTSTGGLVTAMLTAPN  76

Query  267  --KNKRPLYAGKDIVPFYKEHGPYIFPGN------TSAWQNMLAGPKYDGKYLHQVLKNN  112
               N RPL+A KDI  FY +H P IFP N       ++W +  +GPKYDGKYLH +L + 
Sbjct  77   PKDNGRPLFAAKDINDFYLQHTPKIFPQNRDFMTAITSWLDAFSGPKYDGKYLHSLLNSL  136

Query  111  LGDTRLSQTLTHV-----------------NDSPE---KNAKLSDICIATSAAPTYL  1
            LGD  L QTLT+V                 +D+ E   +NA+L+DICI+TSAAPTYL
Sbjct  137  LGDLTLKQTLTNVVIPAFDIKLLQPVIFYTHDAKENALRNARLADICISTSAAPTYL  193



>ref|XP_006488153.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
Length=408

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G+ +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  RLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_006434813.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48053.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=403

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G+ +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  RLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_006434815.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48055.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=408

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G+ +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  RLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_004973690.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Setaria italica]
Length=412

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 121/184 (66%), Gaps = 28/184 (15%)
 Frame = -2

Query  468  IPPSGV--VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstggl  295
            +PP  +  VTILSIDGGGIRGIIP TI+A+LE +LQ  DGPDARIADYFDV+AGTSTGGL
Sbjct  13   MPPDNLKLVTILSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGL  72

Query  294  mttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIF------PGNTSAWQNMLAGPKYDGKYL  133
            +T ML APD N RPL+A KD+  FY +H P IF          ++   ML+GPKYDGKYL
Sbjct  73   LTAMLTAPDTNGRPLFAAKDLARFYIKHSPKIFRQKNHIRSKIASKLRMLSGPKYDGKYL  132

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H +L+  LGD RL +TLT++                       P KNA LSDI ++TSAA
Sbjct  133  HALLRRYLGDMRLDRTLTNIVIPTFDIAYMQPTIFSTFELKHQPSKNALLSDISMSTSAA  192

Query  12   PTYL  1
            PT+ 
Sbjct  193  PTFF  196



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGI+P TI+++LE +LQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTNGNLVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLL  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT------SAWQNMLAGPKYDGKYLH  130
            T ML +P++  RP++A KDI  FY E+GP IFP ++      +     L  P+YDGKYLH
Sbjct  70   TAMLTSPNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLTRPRYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +++  L DTRL QTLTH                    V + P  +A LSDICIATSAAP
Sbjct  130  SLVREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDICIATSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>emb|CDX83197.1| BnaA03g23090D [Brassica napus]
Length=407

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE +LQ  DG +AR+ADYFDV+AGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL A  +I  FY EH P IFP N    SA +N+   L GPKYDG+YLH
Sbjct  72   TAMLTAPNKEGRPLLAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++   LGDTRL QTLT+                    V  +P KNA L+DI I+TSAAP
Sbjct  132  QLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIFSSYGVKKNPLKNATLADITISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_010238242.1| PREDICTED: patatin-like protein 2 isoform X2 [Brachypodium distachyon]
Length=399

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 119/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGII    +A+LE +LQ  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  12   PPTYVNLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML AP+K++RPL+A KDI  FY +H P IFP    A+  +      L+GP YDGKYLH
Sbjct  72   TAMLTAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV---------------------NDSPEKNAKLSDICIATSAA  13
            +V++  LG  RL QTLT+V                           +A LSDICI+TSAA
Sbjct  132  EVVRKKLGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAA  191

Query  12   PTYL  1
            PTYL
Sbjct  192  PTYL  195



>ref|XP_006419185.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
 gb|ESR32425.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
Length=381

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 121/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G  +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  RLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>gb|KJB58444.1| hypothetical protein B456_009G210400 [Gossypium raimondii]
Length=417

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 122/179 (68%), Gaps = 28/179 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRG+IPGTI+A+LE QLQ  DG +AR+ADYFDVI GTSTGGL+T ML  
Sbjct  26   LITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEEARLADYFDVITGTSTGGLVTAMLTT  85

Query  273  PDKNK--RPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLK  118
            PD N   RPL+A KDI  FY EH P IFP + + +        +L GPKYDG+YLH++++
Sbjct  86   PDPNNGNRPLFAAKDISDFYLEHCPKIFPQDCTPFAPATNLVKLLTGPKYDGQYLHKIVR  145

Query  117  NNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
              LG+TRL QTLT+                    V ++P +NA LSDICI TSAAPTYL
Sbjct  146  EKLGETRLHQTLTNVVIPTFDIKQLHPKIFSSYEVKNNPCRNALLSDICIGTSAAPTYL  204



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGI+P TI+++LE +LQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTNGNLVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLL  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT------SAWQNMLAGPKYDGKYLH  130
            T ML +P++  RP++A KDI  FY E+GP IFP ++      +     L  P+YDGKYLH
Sbjct  70   TAMLTSPNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLTRPRYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             +++  L DTRL QTLTH                    V + P  +A LSDICIATSAAP
Sbjct  130  SLVREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDICIATSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 116/177 (66%), Gaps = 27/177 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGIIP TI+++LE QLQ  DG DA +ADYFDVIAGTSTGGL+T ML +P
Sbjct  17   ITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVIAGTSTGGLVTAMLTSP  76

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSA-------WQNMLAGPKYDGKYLHQVLKNN  112
            D+N RPLYA KDI PFY EH P IFP                L GPKYDGKYLH+V+K  
Sbjct  77   DENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHKVVKEK  136

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L DT +S T+T+V                      S   +AKLSDICI+TSAAPTYL
Sbjct  137  LKDTCISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLSDICISTSAAPTYL  193



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+ADYFDV+AGTSTGGL+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW---QNM---LAGPKYDGKYLH  130
            T ML APD+N RPLYA KDI PFY E+ P IFP  +  +   +N+   L G K DGKYLH
Sbjct  70   TAMLTAPDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIGSKCDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +V+K  L DTRLS T+T+V                      +   +AKLSDICI TSAAP
Sbjct  130  EVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSDICIGTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_010269079.1| PREDICTED: patatin-like protein 2 isoform X3 [Nelumbo nucifera]
Length=324

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 123/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP  I+ +LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNM---LAGPKYDGKYLH  130
            T ML APDK+ RPL+A KDI  FY EH P IFP   G  S+ + +   LAGPKY+GKYLH
Sbjct  70   TAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++K  LG +RL  TLT+                    V   P  +A+LSDICI+T+AAP
Sbjct  130  GLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDICISTAAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_009138468.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=412

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 129/194 (66%), Gaps = 35/194 (18%)
 Frame = -2

Query  477  AASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
             + +PPS   +VTILSIDGGGIRGIIPGTI+AYLE QLQ  DG +AR+ DYFDVI+GTST
Sbjct  9    VSCLPPSYGQLVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTST  68

Query  303  gglmttmLAAPDKN-------KRPLYAGKDIVPFYKEHGPYIFPGN--TSAW----QNML  163
            GGL+  ML A DK+        RPL+A K+IVPFY +H P IFP +    +W    + ++
Sbjct  69   GGLIVAMLTAEDKDVKNSRNRSRPLFAAKEIVPFYLKHSPKIFPQHRGVCSWAQTMRRLV  128

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
             GPKY+GKYLH+V++  LGDTRL+QT+T+V                     +    +AKL
Sbjct  129  RGPKYNGKYLHEVIQGYLGDTRLTQTMTNVVIPCFDIKKLQPVIFSSYQAVNHQVIDAKL  188

Query  42   SDICIATSAAPTYL  1
            SDICI+TSAAPTY 
Sbjct  189  SDICISTSAAPTYF  202



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 119/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGII    +A+LE +LQ  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  12   PPTYVNLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML AP+K++RPL+A KDI  FY +H P IFP    A+  +      L+GP YDGKYLH
Sbjct  72   TAMLTAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV---------------------NDSPEKNAKLSDICIATSAA  13
            +V++  LG  RL QTLT+V                           +A LSDICI+TSAA
Sbjct  132  EVVRKKLGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAA  191

Query  12   PTYL  1
            PTYL
Sbjct  192  PTYL  195



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 125/189 (66%), Gaps = 27/189 (14%)
 Frame = -2

Query  486  GYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            G +A   P  G +VT+LSIDGGG+RGIIPGTI+A+LE +LQ  DG DARIADYFD+IAGT
Sbjct  6    GKLANPPPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGT  65

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKY  148
            STGGL+T ML  P+K+ RPL+A KDI  FY EH P IFP  T    ++      + GPKY
Sbjct  66   STGGLVTAMLTTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKY  125

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            DGKYLH  ++  LG++RL Q LT++                     ++P KN  LSDICI
Sbjct  126  DGKYLHLKVRELLGESRLHQALTNIVIPAFDIKFLQPTVFSTFEARNTPLKNPLLSDICI  185

Query  27   ATSAAPTYL  1
            +TSAAPTYL
Sbjct  186  STSAAPTYL  194



>ref|XP_008220193.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=417

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 118/179 (66%), Gaps = 28/179 (16%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+ +LE +LQ  DG +AR+ DYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDVIAGTSTGGLVTAMLTT  82

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP--------GNTSAWQNMLAGPKYDGKYLHQVLK  118
            PD+N RPL+A KDI  FY EH P IFP        G        ++GPKYDGKYLH+++K
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGKAMDMVKAVSGPKYDGKYLHKIMK  142

Query  117  NNLGDTRLSQTLTHV---------------NDSPEK-----NAKLSDICIATSAAPTYL  1
              LGD RLS TLT+V               +   EK     NA LSDICI TSAAPTYL
Sbjct  143  EILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLSDICIGTSAAPTYL  201



>gb|KCW66463.1| hypothetical protein EUGRSUZ_F00261 [Eucalyptus grandis]
Length=383

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 130/202 (64%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  S++ P  P T G          ++TILSIDGGG+RG++PG I+A+LE +LQ  DG D
Sbjct  1    MERSKSLPLQPPTYG---------NLITILSIDGGGMRGLVPGAILAFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW--  175
            AR+ADYFDVIAGTSTGGL+T ML +PDK+ RPL+  KDI  F+  + P IFP ++  +  
Sbjct  52   ARLADYFDVIAGTSTGGLVTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAP  111

Query  174  -QNML---AGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
              NM+    GPKYDGKYLH+++K  LG+TRL+QTLT+                    V  
Sbjct  112  ATNMIKAVTGPKYDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKK  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  +A LSD+CI+TSAAPTYL
Sbjct  172  KPSIDALLSDVCISTSAAPTYL  193



>ref|XP_006488152.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 120/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G  +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
             ++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  HLVKEKLGDKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_009785774.1| PREDICTED: patatin-17-like [Nicotiana sylvestris]
Length=392

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 123/172 (72%), Gaps = 24/172 (14%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDG-PDARIADYFDVIAgtstgglmttmLA  277
            +VT+LSIDGGGI+GIIP T++++LE QLQ  D   +AR+ADYFDVIAGTSTGG++TTM++
Sbjct  28   MVTVLSIDGGGIKGIIPATVLSFLESQLQMQDXDENARLADYFDVIAGTSTGGILTTMIS  87

Query  276  APDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVLKNNLGDTR  97
            AP++  RP  A KDIV FY EHGP IFP    AW  +LA PKYDGKYLH+VL++ LG+TR
Sbjct  88   APNEKGRPFSAAKDIVSFYFEHGPKIFP--PGAWPPILA-PKYDGKYLHKVLQDKLGETR  144

Query  96   LSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L QTLT+V                     +SP  +AK+SDICI TSAAPTY 
Sbjct  145  LHQTLTNVVIPTFDMKKFQPTIFTKSEIANSPHLDAKMSDICIGTSAAPTYF  196



>ref|XP_008777590.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=403

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 125/189 (66%), Gaps = 27/189 (14%)
 Frame = -2

Query  486  GYIAASIPPSG-VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            G +A   P  G +VT+LSIDGGG+RGIIPGTI+A+LE +LQ  DG DARIADYFD+IAGT
Sbjct  6    GKLANPPPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGT  65

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKY  148
            STGGL+T ML  P+K+ RPL+A KDI  FY EH P IFP  T    ++      + GPKY
Sbjct  66   STGGLVTAMLTTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKY  125

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICI  28
            DGKYLH  ++  LG++RL Q LT++                     ++P KN  LSDICI
Sbjct  126  DGKYLHLKVRELLGESRLHQALTNIVIPAFDIKFLQPTVFSTFEARNTPLKNPLLSDICI  185

Query  27   ATSAAPTYL  1
            +TSAAPTYL
Sbjct  186  STSAAPTYL  194



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 118/183 (64%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTI SIDGGGIRGIIP TI+A LE +LQ  DG DARIADYFDVIAGTSTGG++
Sbjct  11   PPTYGNLVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML APD  KRPL+A KDI PFY EHGP IFP      G   +    + GPKYDGKYL 
Sbjct  71   TAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLK  130

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
            +++K  LG TRL +TLT                     V  SP  +A L+DICI +SAAP
Sbjct  131  RLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAP  190

Query  9    TYL  1
            TY 
Sbjct  191  TYF  193



>gb|EEE53387.1| hypothetical protein OsJ_36433 [Oryza sativa Japonica Group]
Length=1246

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 100/201 (50%), Positives = 128/201 (64%), Gaps = 27/201 (13%)
 Frame = -2

Query  522   NSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDAR  343
             N  TTP+S   G + AA       VT+L+IDGGGIRGIIPG ++ +LE +LQ  DGPDAR
Sbjct  821   NVATTPASTMNGNHAAAGSVAGERVTVLTIDGGGIRGIIPGKVLEFLETELQRLDGPDAR  880

Query  342   IADYFDVIAgtstgglmttmLAAP----DKNKRPLYAGKDIVPFYKEHGPYIFP---GNT  184
             +ADYFD IAGTSTGGL+T MLA P    D  +RP++A  +I PFY+EHGP IFP   G  
Sbjct  881   LADYFDYIAGTSTGGLITAMLATPKEDGDGPRRPMFAAGEICPFYQEHGPRIFPQRWGKL  940

Query  183   SAWQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDS  64
             ++    + GPKYDG+YL  +++  LG+T +  TLT+V                     +S
Sbjct  941   ASTVAAVWGPKYDGRYLRDMVREVLGETTVDGTLTNVVIPTFDVRLLQPVIFSTYDAKNS  1000

Query  63    PEKNAKLSDICIATSAAPTYL  1
               KNA+LSD+CI TSAAPTYL
Sbjct  1001  TLKNARLSDVCIGTSAAPTYL  1021



>ref|XP_010059968.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
Length=411

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 130/202 (64%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  S++ P  P T G          ++TILSIDGGG+RG++PG I+A+LE +LQ  DG D
Sbjct  1    MERSKSLPLQPPTYG---------NLITILSIDGGGMRGLVPGAILAFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW--  175
            AR+ADYFDVIAGTSTGGL+T ML +PDK+ RPL+  KDI  F+  + P IFP ++  +  
Sbjct  52   ARLADYFDVIAGTSTGGLVTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAP  111

Query  174  -QNML---AGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
              NM+    GPKYDGKYLH+++K  LG+TRL+QTLT+                    V  
Sbjct  112  ATNMIKAVTGPKYDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKK  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  +A LSD+CI+TSAAPTYL
Sbjct  172  KPSIDALLSDVCISTSAAPTYL  193



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 120/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP TI+A LE QLQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML APD  KRPL+A K+I+PFY EHGP IFP      G   +    L GPKYDGKYL 
Sbjct  71   TAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLK  130

Query  129  QVLKNNLGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAP  10
            +++K  LG TRL +TLT                     V  SP  +A L+DICI +SAAP
Sbjct  131  RIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAP  190

Query  9    TYL  1
            TY 
Sbjct  191  TYF  193



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 130/202 (64%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  S++ P  P T G          ++TILSIDGGG+RG++PG I+A+LE +LQ  DG D
Sbjct  1    MERSKSLPLQPPTYG---------NLITILSIDGGGMRGLVPGAILAFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW--  175
            AR+ADYFDVIAGTSTGGL+T ML +PDK+ RPL+  KDI  F+  + P IFP ++  +  
Sbjct  52   ARLADYFDVIAGTSTGGLVTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAP  111

Query  174  -QNML---AGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
              NM+    GPKYDGKYLH+++K  LG+TRL+QTLT+                    V  
Sbjct  112  ATNMIKAVTGPKYDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKK  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  +A LSD+CI+TSAAPTYL
Sbjct  172  KPSIDALLSDVCISTSAAPTYL  193



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGG+RG+IPGT++A+LE +LQ  DGPDARIADYFDVI GTSTGGL++ M+ +
Sbjct  30   LITVLSIDGGGVRGLIPGTVLAFLELKLQELDGPDARIADYFDVITGTSTGGLLSAMITS  89

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLHQVLKNN  112
            PD+NKRPL++   ++ FY E+ P IFP  +  + ++      + GPKYDGK+LH  +K  
Sbjct  90   PDENKRPLFSANQVIDFYLENSPKIFPQGSGMFSSLTKLVSAIRGPKYDGKFLHSKVKQL  149

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L +T+LS+TLT+V                      SP KNA L+DICI+TSAAPTYL
Sbjct  150  LTETKLSETLTNVIIPTFDIKLLQPVIFSSFEARHSPLKNAHLADICISTSAAPTYL  206



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 123/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP  I+ +LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNM---LAGPKYDGKYLH  130
            T ML APDK+ RPL+A KDI  FY EH P IFP   G  S+ + +   LAGPKY+GKYLH
Sbjct  70   TAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++K  LG +RL  TLT+                    V   P  +A+LSDICI+T+AAP
Sbjct  130  GLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDICISTAAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIPGTI+A+LE +LQ  DG DAR+ADYFDVI+GTSTGGL+
Sbjct  10   PPTYGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS---AWQNML---AGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY +H P IFP + S   A  N++   +GPKYDGKYLH
Sbjct  70   TAMLTAPNEQNRPLFAAKDINDFYLKHSPRIFPQDGSPFAAAGNLIKAFSGPKYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++K  LG+ RL QTLT+                    V + P  +A LSDICI TSAAP
Sbjct  130  SIVKEKLGEKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSDICIGTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_006291236.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
 gb|EOA24134.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
Length=405

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 127/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRGIIP  I+ +LE +LQ  DG +AR+ADYFDV+AGTSTGGL+
Sbjct  10   PPTYGNLVTILSIDGGGIRGIIPAVILGFLESELQKLDGQEARLADYFDVMAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN---TSAWQNM---LAGPKYDGKYLH  130
            T ML+AP+K  RPL+A  +I  FY E+ P IFP N    SA +N+   L+GPKYDG+YLH
Sbjct  70   TAMLSAPNKEGRPLFAASEIKQFYLENCPKIFPQNHFPLSAAKNLVKSLSGPKYDGEYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++   LGDTRL+QTLT+                    V ++P KNA L+DI I+TSAAP
Sbjct  130  QLIHAKLGDTRLNQTLTNVVIPTFDIKHLQPMIFSSYEVKNNPLKNATLADIAISTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>sp|Q6ZJD3.1|PLP2_ORYSJ RecName: Full=Patatin-like protein 2; Short=OsPLP2 [Oryza sativa 
Japonica Group]
 sp|A2YW91.1|PLP2_ORYSI RecName: Full=Patatin-like protein 2 [Oryza sativa Indica Group]
 dbj|BAD08998.1| putative patatin [Oryza sativa Japonica Group]
 gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group]
 gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group]
Length=405

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGG+RGIIP TI+A+LE++LQ  DGPDARIADYFDV+AGTSTGGL+T ML A
Sbjct  20   MVTVLSIDGGGVRGIIPATILAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTAMLTA  79

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNN  112
            P++N RPL+A  ++  FY EH P IFP         +    M++GPKYDGKYLH +L+  
Sbjct  80   PNENNRPLFAADELAKFYIEHSPSIFPQKNWVLSKIAGTLRMVSGPKYDGKYLHSLLREK  139

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LGDTRL + LT+V                       P KNA LSDI I+TSAAPT+ 
Sbjct  140  LGDTRLDKALTNVVIPTFDIANLQPTIFSKFELKYKPLKNALLSDISISTSAAPTFF  196



>ref|XP_009780402.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=413

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 117/174 (67%), Gaps = 24/174 (14%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VT+LSIDGGGIRGIIPGT++A+LE +LQ  DGP+AR+ADYFDV+AGTSTGGL+TTML AP
Sbjct  33   VTVLSIDGGGIRGIIPGTVLAFLESKLQELDGPNARVADYFDVVAGTSTGGLVTTMLTAP  92

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPG----NTSAWQNMLAGPKYDGKYLHQVLKNNLGD  103
            +K+ RPLYA  DI  F+ EHGP IFP     N     N+  GPKYDG+YL  ++++ LG+
Sbjct  93   NKDNRPLYAANDITSFFFEHGPKIFPASSRNNVKKIFNIFGGPKYDGRYLRSLVRSKLGN  152

Query  102  TRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
              + QTLTH                       +  K+A LSD+C+ TSAAPTY 
Sbjct  153  LTMKQTLTHTVIPTFDIKHLQPIIFTTSDARTTVSKDALLSDVCLGTSAAPTYF  206



>ref|XP_010525997.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=406

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 126/183 (69%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIP TI+++LE +LQ  DG +AR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGSLITVLSIDGGGIRGIIPATILSFLESELQKLDGEEARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+A  +I  FY EH P IFP      SA +N+   L GPKYDGKYLH
Sbjct  70   TAMLTAPNKQGRPLFAASEIKDFYLEHCPKIFPQEHFPFSAAKNLVKTLTGPKYDGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++   LGDTRL+QTLT+                    V ++P KNA L+DI I+TSAAP
Sbjct  130  KLVMEKLGDTRLNQTLTNVVIPTFDIKCLQPTIFSSYEVKNNPLKNATLADISISTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_010269072.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 123/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP  I+ +LE QLQ  DG DAR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP---GNTSAWQNM---LAGPKYDGKYLH  130
            T ML APDK+ RPL+A KDI  FY EH P IFP   G  S+ + +   LAGPKY+GKYLH
Sbjct  70   TAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
             ++K  LG +RL  TLT+                    V   P  +A+LSDICI+T+AAP
Sbjct  130  GLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSDICISTAAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 124/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
            T ML +PD+N RPL+A KDI  FY ++ P IFP ++  +         + GPKYDGKYLH
Sbjct  71   TAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            ++++  LG+ RL QTLT+                    V   P  NA LSDICI+TSAAP
Sbjct  131  KLVQEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>gb|EMT28251.1| Patatin group A-3 [Aegilops tauschii]
Length=422

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 116/174 (67%), Gaps = 23/174 (13%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DGPD RIADYFDV+AGTSTGGL+  ML A
Sbjct  41   IVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGPDVRIADYFDVVAGTSTGGLVAAMLTA  100

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTS---AWQNMLAGPKYDGKYLHQVLKNNLGD  103
            P+   RPL+A KD+  FY EH P IFP        W   + GPKY G +LH+V+K  LGD
Sbjct  101  PNAEGRPLFAAKDVNKFYLEHCPNIFPAVCKGPLGWLKSMMGPKYSGHHLHKVVKELLGD  160

Query  102  TRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            TR+++TL ++                         KNA LSD+CI+TSAAPTYL
Sbjct  161  TRVNETLKNIVIPTFDIKLLQPTIFSTYDAMRDVSKNALLSDVCISTSAAPTYL  214



>gb|EAZ06806.1| hypothetical protein OsI_29050 [Oryza sativa Indica Group]
Length=442

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 120/175 (69%), Gaps = 25/175 (14%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +V +LSIDGGG+RGIIPGTI+A+LEE+LQ  DGP AR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  55   IVAVLSIDGGGVRGIIPGTILAFLEEKLQELDGPAARVADYFDVIAGTSTGGLVTAMLAA  114

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNMLAGPKYDGKYLHQVLKNNLG  106
            P  + RPL+A KDIV FY  H P IFP    G     ++M+ GPKYDG+YL  +++  LG
Sbjct  115  PGADGRPLFAAKDIVDFYLRHSPKIFPPVIKGPLGLLKSMM-GPKYDGRYLRSIVQELLG  173

Query  105  DTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            DTR+SQ +T+V                         KNA LSD+CI+TSAAPTYL
Sbjct  174  DTRISQAITNVVIPTFDIKLLQPTIFSRFDAQKDASKNALLSDVCISTSAAPTYL  228



>gb|AAF98369.1|AF158253_1 patatin-like protein 3 [Nicotiana tabacum]
Length=411

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 123/185 (66%), Gaps = 25/185 (14%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            +A ++    +VT+LS+DGGGIRGIIPGT++A+LE +LQ  DGP+AR+ADYFDV+AGTSTG
Sbjct  23   MAFAVTKGKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTG  82

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN-----TSAWQNMLAGPKYDGKY  136
            GL+TTML AP+K+ RPLY  KDI  FY EHGP IFP +          N+  GPKYDGKY
Sbjct  83   GLITTMLTAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGKY  142

Query  135  LHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSA  16
            L  ++ + LG+  + QTLT+                       +  KNA+LSDIC++TSA
Sbjct  143  LRSIINSILGNLTMKQTLTNTIIPTFDIKRLQPIIFSTADAKANISKNAQLSDICLSTSA  202

Query  15   APTYL  1
            APTY 
Sbjct  203  APTYF  207



>ref|XP_010429587.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 125/183 (68%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   +VTILSIDGGGIRG+IP  I+ +LE +LQ  DG DAR+ADYFDV+AGTSTGGL+
Sbjct  12   PPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFDVVAGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+A  +I  FY EH P IFP +    SA +N+   L GPKYDG+YLH
Sbjct  72   TAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQDHFPFSAAKNLVKSLTGPKYDGEYLH  131

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++   LGDT+L+QTLT+                    V ++P KNA L+DI I+TSAAP
Sbjct  132  QLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNPLKNATLADIAISTSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_010101004.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86652.1| Patatin group A-3 [Morus notabilis]
Length=407

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 124/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+ +LEE+LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  9    PPTYGNLITILSIDGGGIRGLIPGTILNFLEEELQKLDGEDARIADYFDVIAGTSTGGLV  68

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT-------SAWQNMLAGPKYDGKYL  133
            T ML+APD+  RP++A KDI  FY    P IFP N        +     L+GPKYDGKYL
Sbjct  69   TAMLSAPDEKNRPVFAAKDIKDFYLTQCPKIFPQNNCPVFPHLAKIIKALSGPKYDGKYL  128

Query  132  HQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAA  13
            H+++K  LG T+L QTLT+                    V ++P  +A LSDICIATSAA
Sbjct  129  HKLVKEKLGSTKLHQTLTNVVIPTFDIKQQHPTIFSSYGVKNNPSYDALLSDICIATSAA  188

Query  12   PTYL  1
            PTYL
Sbjct  189  PTYL  192



>ref|XP_009589751.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=412

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 118/174 (68%), Gaps = 24/174 (14%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VT+LSIDGGGIRGIIPGTI+A+LE +LQ  DGP+ARIADYFDV+AGTSTGGL+T+ML AP
Sbjct  33   VTVLSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGGLVTSMLTAP  92

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNT----SAWQNMLAGPKYDGKYLHQVLKNNLGD  103
            +K+ RPLYA  DI  FY EHGP IFP ++        N+  GPKYDG+YL  ++++ LG+
Sbjct  93   NKDNRPLYAANDITSFYFEHGPKIFPASSRNDVKKIFNIFGGPKYDGRYLRSLVRSKLGN  152

Query  102  TRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
              + QTLTH                       +  K+A LSD+C+ TSAAPTY 
Sbjct  153  LTMKQTLTHTVIPTFDIKRLQPIIFTTSDARTTVSKDALLSDVCLGTSAAPTYF  206



>ref|XP_003544451.1| PREDICTED: patatin-05-like [Glycine max]
Length=408

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 118/180 (66%), Gaps = 30/180 (17%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPG I+ +LE +LQ  DG   R+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGGLVTAMLTA  77

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------NMLAGPKYDGKYLHQVL  121
            P++N RPLYA KDI  FY EH P IFP N   W            L GP+Y+GKYLH+++
Sbjct  78   PNENNRPLYAAKDIKNFYLEHTPKIFPQN-KCWNLFSSMVKFTRTLFGPQYNGKYLHRLI  136

Query  120  KNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            +  LG+T+L QTLT+V                       P+ NA LSDICI+TSAAPTYL
Sbjct  137  REKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDICISTSAAPTYL  196



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 122/180 (68%), Gaps = 32/180 (18%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VTILS+DGGG+RGII G I+A LE++LQ  DG  AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  11   LVTILSLDGGGVRGIIAGVILARLEKELQELDGEGARLADYFDVMAGTSTGGLVTAMLTA  70

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIF--PGNTSAWQN-------MLAGPKYDGKYLHQVL  121
            P++  RPL+A K+IVPFY EH P IF  PG    W +       +L+GPKYDGKYLH++L
Sbjct  71   PNELGRPLFAAKEIVPFYMEHSPKIFSQPG---GWLSVLPMPPRLLSGPKYDGKYLHELL  127

Query  120  KNNLGDTRLSQTLTHVN--------------------DSPEKNAKLSDICIATSAAPTYL  1
            +  LGD RL QTLT++                       P  +AKLSDICI+TSAAPT+L
Sbjct  128  RKLLGDKRLHQTLTNIVIPTFDIKKLNPTIFSSYKILTDPTLDAKLSDICISTSAAPTFL  187



>ref|XP_003544453.1| PREDICTED: patatin-05 [Glycine max]
Length=408

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 118/180 (66%), Gaps = 30/180 (17%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPG I+ +LE +LQ  DG   R+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGGLVTAMLTA  77

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ---------NMLAGPKYDGKYLHQVL  121
            P++N RPLYA KDI  FY EH P IFP N   W            L GP+Y+GKYLH+++
Sbjct  78   PNENNRPLYAAKDIKNFYLEHTPKIFPQN-KCWNLFSSMVKFTRTLFGPQYNGKYLHRLI  136

Query  120  KNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            +  LG+T+L QTLT+V                       P+ NA LSDICI+TSAAPTYL
Sbjct  137  REKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDICISTSAAPTYL  196



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 126/204 (62%), Gaps = 37/204 (18%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            MG    +P  P T G          ++TILSIDGGGIRGIIPGT++ +LE +LQ  DG D
Sbjct  1    MGEGPKSPLQPPTYG---------NLITILSIDGGGIRGIIPGTVLGFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNK-RPLYAGKDIVPFYKEHGPYIFPGNT----  184
            ARI+DYFDVIAGTSTGGL+T ML  P++N  RPL++ KDI  FY EHGP IFP ++    
Sbjct  52   ARISDYFDVIAGTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPI  111

Query  183  ---SAWQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLT--------------------HV  73
               +     L+GPKYDGKYLH ++K  LG+TRL QTLT                     V
Sbjct  112  PRVTKVVTALSGPKYDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQV  171

Query  72   NDSPEKNAKLSDICIATSAAPTYL  1
               P  +A LSDICI TSAAPTYL
Sbjct  172  KSRPCLDALLSDICIGTSAAPTYL  195



>ref|XP_010548404.1| PREDICTED: patatin-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=407

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 122/188 (65%), Gaps = 30/188 (16%)
 Frame = -2

Query  477  AASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
            A + PP+   +VTILS+DGGG+RGII G I+  LE  LQ  DG  AR+ADYFDV+AGTST
Sbjct  8    AKNKPPAYGKMVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTST  67

Query  303  gglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYD  145
            GGL+T ML AP++  RPL+ GKDIVPFY EH P IFP     W N       +L+GPKYD
Sbjct  68   GGLVTAMLTAPNELGRPLFTGKDIVPFYMEHAPKIFP-QPQGWFNLLPKLPKLLSGPKYD  126

Query  144  GKYLHQVLKNNLGDTRLSQTLTHVN--------------------DSPEKNAKLSDICIA  25
            GKYLH++L+  LGD RL QTLT+V                       P  +AKLSDICI 
Sbjct  127  GKYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIFSSYQILSDPALDAKLSDICIG  186

Query  24   TSAAPTYL  1
            TSAAPT+L
Sbjct  187  TSAAPTFL  194



>ref|NP_001061678.1| Os08g0376500 [Oryza sativa Japonica Group]
 dbj|BAC45096.1| putative patatin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAD05294.1| putative patatin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAF23592.1| Os08g0376500 [Oryza sativa Japonica Group]
Length=442

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 127/196 (65%), Gaps = 37/196 (19%)
 Frame = -2

Query  510  TPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIA  337
            TP SP          PP+   +V +LSIDGGG+RGIIPGTI+A+LEE+LQ  DGP AR+A
Sbjct  44   TPRSP----------PPAFGSIVAVLSIDGGGVRGIIPGTILAFLEEKLQELDGPAARVA  93

Query  336  DYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQN  169
            DYFDVIAGTSTGGL+T MLAAP  + RPL+A KDIV FY  H P IFP    G     ++
Sbjct  94   DYFDVIAGTSTGGLVTAMLAAPGADGRPLFAAKDIVDFYLRHSPKIFPPVIKGPLGLLKS  153

Query  168  MLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNA  49
            M+ GPKYDG+YL  +++  LGDTR+SQ +T+V                         KNA
Sbjct  154  MM-GPKYDGRYLRSIVQELLGDTRISQAITNVVIPTFDIKLLQPTIFSRFDAQKDASKNA  212

Query  48   KLSDICIATSAAPTYL  1
             LSD+CI+TSAAPTYL
Sbjct  213  LLSDVCISTSAAPTYL  228



>emb|CDX69271.1| BnaC01g01820D [Brassica napus]
Length=407

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 30/179 (17%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VTILSIDGGG+RGIIPG ++AYLE QLQ  DG +AR+ DYFDVI+GTSTGGL+  ML AP
Sbjct  20   VTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTAP  79

Query  270  DK----NKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNMLAGPKYDGKYLHQVLKNN  112
            DK      RPL+A K+IVPFY++H P IFP      SA+  ++ GPKY+GKYL +V+++ 
Sbjct  80   DKTNPNRNRPLFAAKEIVPFYRKHCPKIFPHPRYVPSAFA-LVRGPKYNGKYLREVIEDF  138

Query  111  LGDTRLSQTLTHV----------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LGDTRL+QTLT+V                      N  P  +AK+SDIC++TSAAPTYL
Sbjct  139  LGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQVYTNIDPVTDAKISDICLSTSAAPTYL  197



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 120/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmtt  286
            P    +T+LSIDGGGIRGIIPG ++AYLE +LQ  DG +AR+ADYFDV+ GTSTGGL+ +
Sbjct  12   PKYDTITVLSIDGGGIRGIIPGVVLAYLESELQELDGDNARLADYFDVMTGTSTGGLVAS  71

Query  285  mLAAPD--KNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            MLAAPD   N RPL++ KDIVPFY ++ P IFP     +  +      L GPKYDGKYLH
Sbjct  72   MLAAPDPKANNRPLFSAKDIVPFYLKNSPQIFPQKRGIFTPLVNIGKALMGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            ++++ NLGDT L QTLT+V                       P  +  LSDICIATSAAP
Sbjct  132  ELIRKNLGDTMLHQTLTNVVIPTFDVKKLQPTIFSSYQLETEPALDVPLSDICIATSAAP  191

Query  9    TYL  1
            T+L
Sbjct  192  TFL  194



>emb|CDY42720.1| BnaA03g53730D [Brassica napus]
Length=413

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 128/194 (66%), Gaps = 35/194 (18%)
 Frame = -2

Query  477  AASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
             + +PPS   +VTILSIDGGGIRGIIPGTI+AYLE QLQ  DG +AR+ DYFDVI+GTST
Sbjct  9    VSCLPPSYGQLVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTST  68

Query  303  gglmttmLAAPDKN-------KRPLYAGKDIVPFYKEHGPYIFPGN--TSAW----QNML  163
            GGL+  ML A DK+        RPL+A K+IVPFY +H P IFP +    +W    + ++
Sbjct  69   GGLIVAMLTAEDKDVKNSRNRSRPLFAAKEIVPFYLKHSPKIFPQHRGVCSWAQTMRRLV  128

Query  162  AGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKL  43
             GPKY+GKYLH+V+   LGDTRL+QT+T+V                     +    +AKL
Sbjct  129  RGPKYNGKYLHEVILGCLGDTRLTQTMTNVVIPCFDIKKLQPVIFSSYQAVNHQVIDAKL  188

Query  42   SDICIATSAAPTYL  1
            SDICI+TSAAPTY 
Sbjct  189  SDICISTSAAPTYF  202



>ref|XP_004160046.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 123/182 (68%), Gaps = 28/182 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIPGTI+ +LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTFGNLITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGGLL  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ-----NMLAGPKYDGKYLHQ  127
            T M+ +P++N RPLY+ KDI  F+ +H P IFP     W        L GPKYDGKYLH+
Sbjct  71   TAMITSPNENNRPLYSAKDIKQFFLDHSPLIFPQKMK-WSLAKVLKSLEGPKYDGKYLHR  129

Query  126  VLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPT  7
            +++  LG+T+L+QTLT+V                      +   +A LSDICI+TSAAPT
Sbjct  130  LVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVFSSYEMKKNSSLDALLSDICISTSAAPT  189

Query  6    YL  1
            YL
Sbjct  190  YL  191



>ref|NP_001151190.1| LOC100284823 [Zea mays]
 gb|ACG41923.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++TILSIDGGGIRG+IP TI+AYLE +LQ  DGPDARIADYFDVIAGTSTG L+
Sbjct  18   PPSTGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALL  77

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNMLA---GPKYDGKYL  133
             +MLAAPD+N RPL+A KD+  FY E+GP IFP    G  +  +N+L    GPKYDG +L
Sbjct  78   ASMLAAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFL  137

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H  +K+   D R++ T+T+V                         KNA LSDICI+TSAA
Sbjct  138  HDKIKSLTHDVRVADTVTNVIVPAFDVKYLQPIIFSTYEAKTDALKNAHLSDICISTSAA  197

Query  12   PTYL  1
            PTY 
Sbjct  198  PTYF  201



>ref|XP_010548412.1| PREDICTED: patatin-like protein 3 isoform X3 [Tarenaya hassleriana]
Length=350

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 129/202 (64%), Gaps = 28/202 (14%)
 Frame = -2

Query  522  NSQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
             S + PS+  +     + +PPS   +VTILSIDGGGIRGIIPG I+++LE  LQ  DG D
Sbjct  6    RSSSAPSTTLSLERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGED  65

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN--TSAW  175
            AR+ DYFDVI+GTSTGGL+T ML+AP K+ RPL++ KDIVPFY  H P IFP       W
Sbjct  66   ARLVDYFDVISGTSTGGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGW  125

Query  174  Q----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------ND  67
                  ++ GPKY+GKYLH++++  LGD +LSQTLT +                    + 
Sbjct  126  VENVIRVIRGPKYNGKYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIFSSYQTSC  185

Query  66   SPEKNAKLSDICIATSAAPTYL  1
            +   +AKLSDICI TSAAPTY 
Sbjct  186  NQVLDAKLSDICIGTSAAPTYF  207



>gb|EEC84713.1| hypothetical protein OsI_31673 [Oryza sativa Indica Group]
Length=387

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 30/191 (16%)
 Frame = -2

Query  483  YIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            +I    PP+   ++T+LSIDGGGIRGIIP  ++ +LE +LQ  DG +ARIADYFDVIAGT
Sbjct  6    HIICRHPPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGT  65

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKY  148
            STGGL+T MLAAP+K +RPL+A KDI  FY  H P IFP     +  M      ++GP Y
Sbjct  66   STGGLVTAMLAAPNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSY  125

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV----------------------NDSPEKNAKLSDI  34
            DGK+LH+V++  LG TRL QTLT+V                       ++   +A LSDI
Sbjct  126  DGKHLHEVVREKLGSTRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKNNNTMDALLSDI  185

Query  33   CIATSAAPTYL  1
            CI+TSAAPTYL
Sbjct  186  CISTSAAPTYL  196



>ref|XP_010548405.1| PREDICTED: patatin-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 122/188 (65%), Gaps = 30/188 (16%)
 Frame = -2

Query  477  AASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtst  304
            A + PP+   +VTILS+DGGG+RGII G I+  LE  LQ  DG  AR+ADYFDV+AGTST
Sbjct  8    AKNKPPAYGKMVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTST  67

Query  303  gglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN-------MLAGPKYD  145
            GGL+T ML AP++  RPL+ GKDIVPFY EH P IFP     W N       +L+GPKYD
Sbjct  68   GGLVTAMLTAPNELGRPLFTGKDIVPFYMEHAPKIFP-QPQGWFNLLPKLPKLLSGPKYD  126

Query  144  GKYLHQVLKNNLGDTRLSQTLTHVN--------------------DSPEKNAKLSDICIA  25
            GKYLH++L+  LGD RL QTLT+V                       P  +AKLSDICI 
Sbjct  127  GKYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIFSSYQILSDPALDAKLSDICIG  186

Query  24   TSAAPTYL  1
            TSAAPT+L
Sbjct  187  TSAAPTFL  194



>gb|ACN25198.1| unknown [Zea mays]
 gb|AFW60363.1| patatin T5 [Zea mays]
Length=410

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++TILSIDGGGIRG+IP TI+AYLE +LQ  DGPDARIADYFDVIAGTSTG L+
Sbjct  18   PPSTGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALL  77

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNMLA---GPKYDGKYL  133
             +MLAAPD+N RPL+A KD+  FY E+GP IFP    G  +  +N+L    GPKYDG +L
Sbjct  78   ASMLAAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFL  137

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H  +K+   D R++ T+T+V                         KNA LSDICI+TSAA
Sbjct  138  HDKIKSLTHDVRVADTVTNVIVPAFDVKSLQPIIFSTYEAKTDTLKNAHLSDICISTSAA  197

Query  12   PTYL  1
            PTY 
Sbjct  198  PTYF  201



>ref|XP_004973692.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=401

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 124/198 (63%), Gaps = 34/198 (17%)
 Frame = -2

Query  504  SSPATGGYIAASIPPSGV--VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADY  331
            S+ + GG  A  I P  V  VT+LSIDGGG+RGIIP  ++A+LEE+LQ  DGPDARIADY
Sbjct  3    STSSAGG--APQINPEKVKLVTVLSIDGGGVRGIIPAVVLAFLEEKLQELDGPDARIADY  60

Query  330  FDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW--------  175
            FDVIAGTSTGGL+TTMLAAP KN RPL+  KD+  FY +H P IFP     W        
Sbjct  61   FDVIAGTSTGGLLTTMLAAPGKNGRPLFNAKDLAQFYIDHSPKIFPQKN--WILSKIFGT  118

Query  174  QNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEK  55
              M+ GPKYDGKYLH +L   LGD +L + LT+V                       P K
Sbjct  119  LRMVRGPKYDGKYLHALLGQYLGDMKLDKALTNVIIPTFDIAFLQPTIFSSFELKHRPSK  178

Query  54   NAKLSDICIATSAAPTYL  1
            NA LSDI I+TSAAPT+ 
Sbjct  179  NALLSDIAISTSAAPTFF  196



>ref|XP_007227183.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
 gb|EMJ28382.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
Length=383

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 115/171 (67%), Gaps = 21/171 (12%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++TILSIDGGGIRG+IP TI+++LE +LQ  DG DARIADYFDV+AGTSTGGL+T ML  
Sbjct  1    MITILSIDGGGIRGLIPATILSFLESELQKLDGEDARIADYFDVVAGTSTGGLVTAMLTT  60

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVLKNNLGDTRL  94
            P++N RPL++ KDI  FY  H P IFP      +  L GPKYDGKYLH +++  LGDT++
Sbjct  61   PNENDRPLFSAKDISDFYMNHCPKIFPQKKKIIK-ALGGPKYDGKYLHGLIRQKLGDTKM  119

Query  93   SQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             QTLT+                    V   P  NA LSD+CI TSAAPT+L
Sbjct  120  DQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYNALLSDVCIGTSAAPTFL  170



>ref|XP_010548410.1| PREDICTED: patatin-like protein 3 isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 129/202 (64%), Gaps = 28/202 (14%)
 Frame = -2

Query  522  NSQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
             S + PS+  +     + +PPS   +VTILSIDGGGIRGIIPG I+++LE  LQ  DG D
Sbjct  6    RSSSAPSTTLSLERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGED  65

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN--TSAW  175
            AR+ DYFDVI+GTSTGGL+T ML+AP K+ RPL++ KDIVPFY  H P IFP       W
Sbjct  66   ARLVDYFDVISGTSTGGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGW  125

Query  174  Q----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------ND  67
                  ++ GPKY+GKYLH++++  LGD +LSQTLT +                    + 
Sbjct  126  VENVIRVIRGPKYNGKYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIFSSYQTSC  185

Query  66   SPEKNAKLSDICIATSAAPTYL  1
            +   +AKLSDICI TSAAPTY 
Sbjct  186  NQVLDAKLSDICIGTSAAPTYF  207



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 121/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G  +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LGD +L +TLT+V                      +P  +A LSDIC+ATSAAP
Sbjct  132  RLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASLSDICVATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_006380722.1| hypothetical protein POPTR_0007s11370g [Populus trichocarpa]
 gb|ERP58519.1| hypothetical protein POPTR_0007s11370g [Populus trichocarpa]
Length=387

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 118/174 (68%), Gaps = 23/174 (13%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            V T+LSIDGGGIRGIIPG+++A+LE +LQ  DG  ARIADYFD+IAGTSTGGL+ TMLAA
Sbjct  10   VATVLSIDGGGIRGIIPGSLLAFLESKLQELDGSQARIADYFDIIAGTSTGGLVATMLAA  69

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM---LAGPKYDGKYLHQVLKNNLGD  103
            P+K  RP+YA KDI+ FY +H P IFP  ++    +     GPKYDGKYL  +  N LGD
Sbjct  70   PNKENRPMYAAKDIIDFYLDHSPKIFPQKSNLLGPLSIFFGGPKYDGKYLRSLTNNLLGD  129

Query  102  TRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
              ++QTLT+V                      +  KNA+L+DIC+ATSAAPTYL
Sbjct  130  LTITQTLTNVILPTFDMKLLQPVIFSTTEGKTNALKNARLADICVATSAAPTYL  183



>ref|XP_002880809.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57068.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 123/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+++LE +LQ  DG  AR+ADYFDVIAGTSTGGL+
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPATILSFLESELQKLDGEGARLADYFDVIAGTSTGGLV  69

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT---SAWQNM---LAGPKYDGKYLH  130
            T ML AP+K  RPL+A  +I  FY EH P IFP +    SA +N+   L GPKYDG YLH
Sbjct  70   TAMLTAPNKEGRPLFAANEIKDFYLEHCPKIFPQDQFPFSAAKNLLKSLTGPKYDGHYLH  129

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            Q++K  LGDTRL QTLT+                    V   P KNA L+DI I+TSAAP
Sbjct  130  QLIKEKLGDTRLDQTLTNVVIPSFDIKHLQPTIFTTYEVKTKPFKNALLADISISTSAAP  189

Query  9    TYL  1
            TYL
Sbjct  190  TYL  192



>emb|CDX75621.1| BnaA01g00810D [Brassica napus]
Length=407

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 121/178 (68%), Gaps = 28/178 (16%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VTILSIDGGG+RGIIPG ++AYLE QLQ  DG +AR+ DYFDVI+GTSTGGL+  ML AP
Sbjct  20   VTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTAP  79

Query  270  DK--NKRPLYAGKDIVPFYKEHGPYIF--PGNTSAWQNMLA----GPKYDGKYLHQVLKN  115
            DK    RPL+A K+IVPFY++H P IF  P    AW  +L     GPKY+GKYL +V+++
Sbjct  80   DKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVIED  139

Query  114  NLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
             LGDTRL+QTLT+V                          +AK+SDIC++TSAAPTYL
Sbjct  140  FLGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQAVSRRVTDAKISDICLSTSAAPTYL  197



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 26/178 (15%)
 Frame = -2

Query  456  GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLA  277
            G + ILSIDGGGIRG+IPGTI+ +LE +LQ  DG DAR+ADYFDVI+GTSTGGL+T ML 
Sbjct  30   GTIFILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLT  89

Query  276  APDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLKN  115
             P++N RP++A KDI  FY  H P IFP ++ +++        +AGPKYDGKYLH V+++
Sbjct  90   TPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDGKYLHSVVRD  149

Query  114  NLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
             LGD RL QTLT+V                       P  +A LSDICI+TSAAPTYL
Sbjct  150  KLGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYL  207



>ref|XP_009139093.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=407

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 121/178 (68%), Gaps = 28/178 (16%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            VTILSIDGGG+RGIIPG ++AYLE QLQ  DG +AR+ DYFDVI+GTSTGGL+  ML AP
Sbjct  20   VTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTAP  79

Query  270  DK--NKRPLYAGKDIVPFYKEHGPYIF--PGNTSAWQNMLA----GPKYDGKYLHQVLKN  115
            DK    RPL+A K+IVPFY++H P IF  P    AW  +L     GPKY+GKYL +V+++
Sbjct  80   DKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVIED  139

Query  114  NLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
             LGDTRL+QTLT+V                          +AK+SDIC++TSAAPTYL
Sbjct  140  FLGDTRLTQTLTNVVIPCFDIKKLQPVIFSSYQAVSRRVTDAKISDICLSTSAAPTYL  197



>gb|ACG31156.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 122/184 (66%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++TILSIDGGGIRG+IP TI+AYLE +LQ  DGPDARIADYFDVIAGTSTG L+
Sbjct  18   PPSTGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALL  77

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP----GNTSAWQNMLA---GPKYDGKYL  133
             +MLAAPD+N RPL+A KD+  FY E+GP IFP    G  +  +N+L    GPKYDG +L
Sbjct  78   ASMLAAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFL  137

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H  +K+   D R++ T+T+V                         KNA LSDICI+TSAA
Sbjct  138  HDKIKSLTHDVRVADTVTNVIVPAFDVKYLQPIIFSTYEAKTDTLKNAHLSDICISTSAA  197

Query  12   PTYL  1
            PTY 
Sbjct  198  PTYF  201



>ref|XP_009370176.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 118/178 (66%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VTILSIDGGGIRG++P TI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+T MLAA
Sbjct  16   IVTILSIDGGGIRGLLPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  75

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGN-------TSAWQNMLAGPKYDGKYLHQVLKN  115
            P++N RPL+A KDI+ FY    P IFP         T+     LAGPKY+GKYLH++++ 
Sbjct  76   PNENNRPLFAAKDIIDFYLNQCPKIFPQKTWPIFPYTTKIIKALAGPKYNGKYLHRLIRE  135

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LG+ +L  TLT+                    V   P  +A LSDICI TSAAPTYL
Sbjct  136  RLGNKKLHDTLTNVVIPTFDIKNLQPAIFSSFKVKKKPSYDALLSDICIGTSAAPTYL  193



>ref|XP_008228777.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Prunus 
mume]
Length=406

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 126/202 (62%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  +++ P  P T G          ++T+LSIDGGGIRG+IPGTI+A+LE +LQ  DG D
Sbjct  1    MERTKSIPLQPPTYG---------NLITVLSIDGGGIRGLIPGTILAFLESELQKLDGED  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ-  172
            AR+ADYFDVIAGTSTGGL+T ML APD+N RPL+A  DI  FY    P IFP NT  +  
Sbjct  52   ARLADYFDVIAGTSTGGLVTAMLTAPDENNRPLFAANDIKEFYLNECPKIFPQNTXWFPY  111

Query  171  -----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
                   LAGPKY+GKYLH +++  LGD +L QTLT+                    VN 
Sbjct  112  VTKIIKALAGPKYNGKYLHSLVRQKLGDKKLHQTLTNVVIPTFDIRNLQPTIFSSFEVNH  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  +A LSDICI TSAAPTYL
Sbjct  172  KPCFDALLSDICIGTSAAPTYL  193



>gb|KJB58442.1| hypothetical protein B456_009G210300 [Gossypium raimondii]
Length=434

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 122/185 (66%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRG+IPGTI+A+LE QLQ  DG  AR+ADYFD+I+GTSTGGL+
Sbjct  25   PPTYGNLITLLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDIISGTSTGGLV  84

Query  291  ttmLAAPD--KNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKY  136
            T ML  PD  K  RPL+A KDI  FY EH P IFP NTS +         L GPKYDGKY
Sbjct  85   TAMLTTPDPKKENRPLFAAKDINEFYLEHCPKIFPQNTSPFAPAANVVKSLMGPKYDGKY  144

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH +++  LG+T+L QTLT+                    V   P  +A LSDICIATSA
Sbjct  145  LHDIVREKLGETKLHQTLTNVVIPTFDIKQLQPRIFSTYEVKSDPCTDALLSDICIATSA  204

Query  15   APTYL  1
            APTYL
Sbjct  205  APTYL  209



>ref|XP_009368084.1| PREDICTED: patatin-like protein 3 [Pyrus x bretschneideri]
Length=397

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 123/188 (65%), Gaps = 28/188 (15%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++  +    +VT+LSIDGGGIRGIIPGT++A+LE +LQ  DGP ARIADYFD+IAGTSTG
Sbjct  1    MSTGLAKRKMVTVLSIDGGGIRGIIPGTLLAFLESKLQQLDGPSARIADYFDIIAGTSTG  60

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYD  145
            GL+TTML AP+K+ RP+Y  KDI  FY +H P IFP  +        ++    + GPKYD
Sbjct  61   GLVTTMLTAPNKDNRPMYEAKDINNFYLDHTPKIFPQKSRNDFMTSITSMVGAVKGPKYD  120

Query  144  GKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIA  25
            GKYL  + K  LGD  L QTLT+V                     +  EKNAKLSDIC++
Sbjct  121  GKYLRALTKGLLGDLTLKQTLTNVVIPAFDINYLQPVIFSTIDAKEKSEKNAKLSDICVS  180

Query  24   TSAAPTYL  1
            TSAAPT+L
Sbjct  181  TSAAPTFL  188



>ref|XP_010064133.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=361

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRG+IPGTI+ +LE +LQ  DG DAR+ADYFDVI+GTSTGGL+T ML  P
Sbjct  18   ITILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTTP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLKNNL  109
            ++N RP++A KDI  FY  H P IFP ++  ++        +AGPKYDGKYLH V+++ L
Sbjct  78   NENNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKMIKAMAGPKYDGKYLHSVVRDEL  137

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            GD RL QTLT+V                       P  +A LSDICI+TSAAPTYL
Sbjct  138  GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYL  193



>ref|XP_010064187.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66460.1| hypothetical protein EUGRSUZ_F00256 [Eucalyptus grandis]
Length=421

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 123/183 (67%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRG+IPGTI+A+LE +LQ  DG DARIADYFDVIAGTSTGGL+
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLV  70

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLH  130
            T ML  PD N RPL+A KDI  FY ++ P IFP ++  +         + GPKYDGKYLH
Sbjct  71   TAMLTTPDDNNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLH  130

Query  129  QVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAP  10
            +++K  LG+ RL QTLT+                    V  +P  +A LSDICI+TSAAP
Sbjct  131  KLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAAP  190

Query  9    TYL  1
            TYL
Sbjct  191  TYL  193



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 121/183 (66%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++TILSIDGGGIRGIIP TI+A+LE +LQ  DG +ARIADYFDVI+GTSTGGL+
Sbjct  12   PPTFGNLITILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLV  71

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLH  130
            T ML AP++  RPL+A KDI  FY  H P IFP      G  +     L GPKYDGKYLH
Sbjct  72   TAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLH  131

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
            +++K  LG+ +L +TLT+V                      +P  +A LSDICIATSAAP
Sbjct  132  RLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASLSDICIATSAAP  191

Query  9    TYL  1
            TYL
Sbjct  192  TYL  194



>ref|XP_010548411.1| PREDICTED: patatin-like protein 3 isoform X2 [Tarenaya hassleriana]
Length=406

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 129/202 (64%), Gaps = 28/202 (14%)
 Frame = -2

Query  522  NSQTTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
             S + PS+  +     + +PPS   +VTILSIDGGGIRGIIPG I+++LE  LQ  DG D
Sbjct  6    RSSSAPSTTLSLERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGED  65

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGN--TSAW  175
            AR+ DYFDVI+GTSTGGL+T ML+AP K+ RPL++ KDIVPFY  H P IFP       W
Sbjct  66   ARLVDYFDVISGTSTGGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGW  125

Query  174  Q----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV--------------------ND  67
                  ++ GPKY+GKYLH++++  LGD +LSQTLT +                    + 
Sbjct  126  VENVIRVIRGPKYNGKYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIFSSYQTSC  185

Query  66   SPEKNAKLSDICIATSAAPTYL  1
            +   +AKLSDICI TSAAPTY 
Sbjct  186  NQVLDAKLSDICIGTSAAPTYF  207



>ref|NP_001063402.2| Os09g0462400 [Oryza sativa Japonica Group]
 dbj|BAD38550.1| putative patatin homolog [Oryza sativa Japonica Group]
 gb|EAZ45016.1| hypothetical protein OsJ_29655 [Oryza sativa Japonica Group]
 dbj|BAF25316.2| Os09g0462400 [Oryza sativa Japonica Group]
Length=387

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 30/191 (16%)
 Frame = -2

Query  483  YIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgt  310
            +I    PP+   ++T+LSIDGGGIRGIIP  ++ +LE +LQ  DG +ARIADYFDVIAGT
Sbjct  6    HIICRHPPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGT  65

Query  309  stgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKY  148
            STGGL+T MLAAP+K +RPL+A KDI  FY  H P IFP     +  M      ++GP Y
Sbjct  66   STGGLVTAMLAAPNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSY  125

Query  147  DGKYLHQVLKNNLGDTRLSQTLTHV----------------------NDSPEKNAKLSDI  34
            DGK+LH+V++  LG TRL QTLT+V                       ++   +A LSDI
Sbjct  126  DGKHLHEVVREKLGSTRLHQTLTNVVIPTFDIKWLQPTIFSSYEVKKKNNNTMDALLSDI  185

Query  33   CIATSAAPTYL  1
            CI+TSAAPTYL
Sbjct  186  CISTSAAPTYL  196



>ref|XP_007203506.1| hypothetical protein PRUPE_ppa024781mg [Prunus persica]
 gb|EMJ04705.1| hypothetical protein PRUPE_ppa024781mg [Prunus persica]
Length=398

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 118/172 (69%), Gaps = 22/172 (13%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +T+LSIDGGGIRGIIP TI+ +LE +LQ  DG +ARIADYFDVIAGTSTGGL+T ML AP
Sbjct  16   ITVLSIDGGGIRGIIPATILTFLESKLQELDGEEARIADYFDVIAGTSTGGLITAMLTAP  75

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM--LAGPKYDGKYLHQVLKNNLGDTR  97
            D+NKRPLY  KDIVPFY  H P IFP ++     M  L GPKYDGKYL ++++  LG  R
Sbjct  76   DQNKRPLYEAKDIVPFYLNHCPKIFPQSSGPLMRMRALRGPKYDGKYLRKLVRKILGTRR  135

Query  96   LSQTLT--------------HVNDSPE------KNAKLSDICIATSAAPTYL  1
            L +T+T              HV  + E      ++A LSDICI TS+APTYL
Sbjct  136  LHETVTRIVVPTFDIKLLQPHVFSTFEAEMEFSEDALLSDICIGTSSAPTYL  187



>ref|XP_004291128.2| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=438

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 117/178 (66%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGT++++LE +LQ  DG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   LVTVLSIDGGGIRGIIPGTMLSFLESELQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  79

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYLHQVLKN  115
            PD+N RPL+A KDI  FY EH P +FP       G        + GPKY+GKYLH ++K 
Sbjct  80   PDENNRPLFAAKDINDFYLEHCPKMFPQHSTPLIGEAVEMLKAVKGPKYNGKYLHDIVKE  139

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LGD  L++TLT+                    V      NA LSDICIATSAAPTYL
Sbjct  140  KLGDVTLNKTLTNVIIPTFDIKRLQPIIFSSYEVKKKDSLNALLSDICIATSAAPTYL  197



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 119/178 (67%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGTI+++LE +LQ  DG DAR+ADYFDVI GTSTGGL+T ML  
Sbjct  22   LVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVITGTSTGGLVTAMLTT  81

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYLHQVLKN  115
            PD+N RPL++ KDI  FY EH P IFP       G        L GPKYDGKYLH ++K 
Sbjct  82   PDENNRPLFSAKDINAFYLEHCPKIFPQGSAPLIGEAVDMVKNLTGPKYDGKYLHNIVKE  141

Query  114  NLGDTRLSQTLTHV-----------------NDSPEK---NAKLSDICIATSAAPTYL  1
             LGD RL+ TLT+V                  ++ +K   +A LSDICIATSAAPTYL
Sbjct  142  KLGDKRLNDTLTNVIIPTFDIKRLQPTIFSSYEAKKKSCVDALLSDICIATSAAPTYL  199



>ref|XP_007017304.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
 gb|EOY14529.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
Length=438

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 123/185 (66%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRG+IPGTI+A+LE QLQ  DG  AR+ADYFDVIAGTSTGGL+
Sbjct  25   PPTYGNLITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTSTGGLV  84

Query  291  ttmLAAPDKN--KRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKY  136
            T ML  P+     RPL+A KDI+ FY EH P IFP ++S +         L GPKYDGKY
Sbjct  85   TAMLTTPNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKYDGKY  144

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH +++  LG+TRL QTLT+                    V  +P K+A LSDICI TSA
Sbjct  145  LHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICIGTSA  204

Query  15   APTYL  1
            APTYL
Sbjct  205  APTYL  209



>ref|XP_008228776.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=428

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 117/178 (66%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRG+IPGTI+ YLE +LQ  DG DARIADYFDVIAGTSTGGL+T MLA 
Sbjct  17   LITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAT  76

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGN-------TSAWQNMLAGPKYDGKYLHQVLKN  115
            PD+N RP++A KDI  FY  H P IFP          +     LAGPKYDGKYLH ++  
Sbjct  77   PDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYATKIIKALAGPKYDGKYLHDLVGQ  136

Query  114  NLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
             LGD +L QTLT+                    V   P  +AKLSDICIATSAAPTYL
Sbjct  137  KLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSAAPTYL  194



>gb|KJB40252.1| hypothetical protein B456_007G053800 [Gossypium raimondii]
Length=397

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 123/177 (69%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIPG I+A LE +LQ  DG D R+ADYFDV+AGTSTGGL+T MLAA
Sbjct  18   LITVLSIDGGGIRGIIPGVILAALESELQKLDGEDVRLADYFDVMAGTSTGGLITAMLAA  77

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIF--PGNTSAWQNM----LAGPKYDGKYLHQVLKNN  112
            PD++ RPL+A KDIVPFY ++GP IF  P    AW +     L GP+YDGKYL++++++ 
Sbjct  78   PDESGRPLFAAKDIVPFYVKNGPQIFPQPSGILAWASTITKALTGPRYDGKYLYKLIRDL  137

Query  111  LGDTRLSQTLT--------------------HVNDSPEKNAKLSDICIATSAAPTYL  1
            LG+T+L QTLT                     +   PE +A LSDICI+TSAAPTY 
Sbjct  138  LGNTKLHQTLTSIAIPTFDIKKLQPTIFSTYQIPQRPEIDALLSDICISTSAAPTYF  194



>ref|XP_009349524.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 119/183 (65%), Gaps = 28/183 (15%)
 Frame = -2

Query  465  PPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIPG I+++LE +LQ  DG DAR+ADYFDVI GTSTGGL+
Sbjct  8    PPTNGSLITVLSIDGGGIRGIIPGIILSFLESELQKLDGKDARLADYFDVITGTSTGGLV  67

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM------LAGPKYDGKYLH  130
            T ML  PD+N RPLYA KDI PFY E+GP IFP ++S   N+      L  PKYDGK+LH
Sbjct  68   TAMLTTPDENNRPLYAAKDITPFYLENGPKIFPQDSSIVANLAMNVKVLGRPKYDGKFLH  127

Query  129  QVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAP  10
             +L+  LGD  L  TLT+V                      +   +A LSDICI TSAAP
Sbjct  128  SLLREKLGDKHLRHTLTNVVIPTFDIKRLQPVIFSSYQLQKNNSLDALLSDICIGTSAAP  187

Query  9    TYL  1
             YL
Sbjct  188  YYL  190



>gb|EMT18762.1| Patatin group A-3 [Aegilops tauschii]
Length=403

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 23/154 (15%)
 Frame = -2

Query  393  VAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKE  214
            +A+LEE+LQ  DGPD RIADYFDVIAGTSTGGL+T ML APD   RPL+A KDI  FY E
Sbjct  39   LAFLEEKLQELDGPDVRIADYFDVIAGTSTGGLVTAMLTAPDAKGRPLFAAKDINNFYLE  98

Query  213  HGPYIFP---GNTSAWQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTHV----------  73
            H P IFP   G        + GPKYDG+YLH V+K  LG+TR+ + L ++          
Sbjct  99   HCPKIFPAVYGGPLGLLRSMRGPKYDGQYLHSVVKELLGETRVGEALQNIVIPTFDIKLL  158

Query  72   ----------NDSPEKNAKLSDICIATSAAPTYL  1
                       +   KNA LSD+CI+TSAAPTYL
Sbjct  159  QPTIFSRYDARNDVSKNALLSDVCISTSAAPTYL  192



>ref|XP_004962815.1| PREDICTED: patatin-T5-like [Setaria italica]
Length=460

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 25/153 (16%)
 Frame = -2

Query  393  VAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP-DKNKRPLYAGKDIVPFYK  217
            +AYLEEQLQ  DGP+AR+ADYFD IAGTSTGGL+T MLAAP D ++RPL+A + I PFY 
Sbjct  88   LAYLEEQLQELDGPEARLADYFDYIAGTSTGGLITAMLAAPADGSRRPLFAAEGINPFYL  147

Query  216  EHGPYIFPGNTSAWQNMLA-GPKYDGKYLHQVLKNNLGDTRLSQTLTHV-----------  73
            EHGP IFP     W    A GPK+DGKYL  V +  LG+TR+  T+T V           
Sbjct  148  EHGPRIFP---RKWSIAAASGPKHDGKYLRAVTRRVLGETRVRDTVTDVIIPTFDVKLVQ  204

Query  72   ---------NDSPEKNAKLSDICIATSAAPTYL  1
                       +PEKNA LSD+CI T+AAPTYL
Sbjct  205  PIIFSKCDAEKTPEKNALLSDVCIGTAAAPTYL  237



>ref|XP_007017303.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14528.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=437

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 123/185 (66%), Gaps = 30/185 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRG+IPGTI+A+LE QLQ  DG  AR+ADYFDVIAGTSTGGL+
Sbjct  25   PPTYGNLITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTSTGGLV  84

Query  291  ttmLAAPDKN--KRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKY  136
            T ML  P+     RPL+A KDI+ FY EH P IFP ++S +         L GPKYDGKY
Sbjct  85   TAMLTTPNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKYDGKY  144

Query  135  LHQVLKNNLGDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSA  16
            LH +++  LG+TRL QTLT+                    V  +P K+A LSDICI TSA
Sbjct  145  LHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICIGTSA  204

Query  15   APTYL  1
            APTYL
Sbjct  205  APTYL  209



>ref|XP_008378189.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=398

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 116/173 (67%), Gaps = 22/173 (13%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIPGTI+++LE +LQ  DG DAR+ADYFDVI GTSTGGL+T ML  
Sbjct  14   LITVLSIDGGGIRGIIPGTILSFLESELQKLDGKDARLADYFDVITGTSTGGLVTAMLTX  73

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNM--LAGPKYDGKYLHQVLKNNLGDT  100
            PD+NKRPLYA KDI  FY E+ P IFP ++S   N+  L  PKYDGKYLH +LK  LGD 
Sbjct  74   PDENKRPLYAAKDITAFYLENCPKIFPQDSSIVANLKVLGKPKYDGKYLHSLLKEKLGDK  133

Query  99   RLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
             L  TLT+V                      +   +A LSDICI TSAAP YL
Sbjct  134  HLRHTLTNVVIPTFDIKRLQPVIFSSYQLKKNNSLDALLSDICIGTSAAPYYL  186



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 123/184 (67%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PP+   ++T+LSIDGGGIRGIIPGTI+A+LE QLQ  DG DARIADYFDVI GTSTGGL+
Sbjct  14   PPTYGNLITVLSIDGGGIRGIIPGTILAFLESQLQELDGEDARIADYFDVIGGTSTGGLV  73

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAW-------QNMLAGPKYDGKYL  133
            T ML AP++N RPL+A +D+  FY ++ P IFP     +       +++  GPKY+GKYL
Sbjct  74   TAMLTAPNENNRPLFAAQDVTAFYLDNCPKIFPQMCGIFGSVAKTLRSIFVGPKYNGKYL  133

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H +L+  LG+TRL Q LT+V                      +   +A+LSDICIATSAA
Sbjct  134  HGILREKLGETRLHQALTNVVIPTFDVKQLQPIIFSSFEAKTTSAMDARLSDICIATSAA  193

Query  12   PTYL  1
            PTYL
Sbjct  194  PTYL  197



>ref|XP_002451118.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
 gb|AAD22170.1|AF061282_24 patatin-like protein [Sorghum bicolor]
 gb|EES10106.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
Length=410

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 120/184 (65%), Gaps = 29/184 (16%)
 Frame = -2

Query  465  PPSG--VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglm  292
            PPS   ++TILSIDGGGIRG+IP TI+AYLE +LQ  DGPDARIADYFDVIAGTSTG L+
Sbjct  18   PPSKGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALL  77

Query  291  ttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLA-------GPKYDGKYL  133
            T+MLAAPD N RPL+A KD+  FY E+GP IFP   + W   +A       GPKYDG +L
Sbjct  78   TSMLAAPDDNNRPLFAAKDLTTFYLENGPKIFPQRKAGWLTPVANLIGTMRGPKYDGVFL  137

Query  132  HQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAA  13
            H  +K+   D +++ T+T++                         KNA LSDICI+TSAA
Sbjct  138  HDKIKSLTHDVKVADTVTNIIVPAFDVKYLQPIIFSTYEAKTDALKNAHLSDICISTSAA  197

Query  12   PTYL  1
            PTY 
Sbjct  198  PTYF  201



>gb|AAB08428.1| patatin homolog [Nicotiana tabacum]
Length=390

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 24/172 (14%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDG-PDARIADYFDVIAgtstgglmttmLA  277
            + T+LSIDGGGI+GIIP T++++LE QLQ  D   DAR+ADYFDVIAGTSTGG++TTM++
Sbjct  28   IATVLSIDGGGIKGIIPATVLSFLESQLQELDNNEDARLADYFDVIAGTSTGGILTTMIS  87

Query  276  APDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQNMLAGPKYDGKYLHQVLKNNLGDTR  97
            AP++  RP  A KDIV FY EHGP IFP     W  +L GPKYDGKYLH+VL++ LG+TR
Sbjct  88   APNEKGRPFSAAKDIVSFYFEHGPKIFP--QGVWPPIL-GPKYDGKYLHKVLEDKLGETR  144

Query  96   LSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            L QTLT+V                     +SP  +AK+SDIC  T+AAPTY 
Sbjct  145  LHQTLTNVVIPTFDMKKFQPIIFTKSEIANSPHLDAKMSDICYGTAAAPTYF  196



>ref|XP_006829696.1| hypothetical protein AMTR_s00126p00051390 [Amborella trichopoda]
 gb|ERM97112.1| hypothetical protein AMTR_s00126p00051390 [Amborella trichopoda]
Length=228

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 111/176 (63%), Gaps = 26/176 (15%)
 Frame = -2

Query  450  VTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAP  271
            +TILSIDGGGIRGIIP TI+A+LE QLQ  DG + RIADYFDVIA TST GL+T ML AP
Sbjct  18   ITILSIDGGGIRGIIPATILAFLESQLQKLDGEEMRIADYFDVIAETSTKGLVTAMLTAP  77

Query  270  DKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNNL  109
              + RPL+A KDI  FY EH   IFP       +   + N + GPKY+GKYLH V+K  L
Sbjct  78   GDDNRPLFAAKDITSFYLEHCTKIFPQRRGPFASCLKFLNAVVGPKYNGKYLHDVVKRKL  137

Query  108  GDTRLSQTLTH--------------------VNDSPEKNAKLSDICIATSAAPTYL  1
            GD  +++TLT+                    V     KNA LSDICI TSAAPTYL
Sbjct  138  GDKSIAETLTNAVIPTFDIRRLQPIIFSTYQVKSHKSKNAVLSDICIGTSAAPTYL  193



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 119/178 (67%), Gaps = 27/178 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGG+RGIIPGTI+A+LE +LQ  DG D RIADYFDV+AGTSTGGL+T MLAA
Sbjct  1    MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDVRIADYFDVVAGTSTGGLVTAMLAA  60

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-------GNTSAWQNMLAGPKYDGKYLHQVLKN  115
            PD+N RPL+A K+I  FY E+ P IFP       G+  +    +AGPKYDGKYLH  +K 
Sbjct  61   PDENNRPLFAAKEINDFYLENCPKIFPKNGNGILGSVKSLLGSIAGPKYDGKYLHSKVKQ  120

Query  114  NLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
             LG  RL QTLT++                         K+A LSDICI+TSAAPTYL
Sbjct  121  LLGGIRLHQTLTNIVIPTFDIKLLQPTIFSTFETKKEVSKDALLSDICISTSAAPTYL  178



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 125/202 (62%), Gaps = 35/202 (17%)
 Frame = -2

Query  528  MGNSQTTPSSPATGGYIAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPD  349
            M  +++ P  P T G          ++T+LSIDGGGIRG+IPGT++ +LE +LQ  DG D
Sbjct  1    MERTRSIPLQPPTYG---------NLITVLSIDGGGIRGLIPGTVLNFLESELQRLDGKD  51

Query  348  ARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ-  172
            ARI DYFDVI+GTSTGGL+T ML  PD N RP++A KDI  FY  H P IFP ++  ++ 
Sbjct  52   ARIVDYFDVISGTSTGGLVTAMLTTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKP  111

Query  171  -----NMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH--------------------VND  67
                   +AGPKYDGKYLH V++  LGD RL QTLT+                    V  
Sbjct  112  VTKIIKAVAGPKYDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKK  171

Query  66   SPEKNAKLSDICIATSAAPTYL  1
             P  +A LSDICI+TSAAPTYL
Sbjct  172  DPSVDALLSDICISTSAAPTYL  193



>ref|NP_001149326.1| patatin class 1 [Zea mays]
 gb|ACG35038.1| patatin class 1 precursor [Zea mays]
Length=423

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 115/177 (65%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIP TI+A+LE +LQ  DGPDARIADYFDV+AGTSTGGL+T ML A
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  80

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLKNN  112
            PD N+RPL+A KD+  FY +H P IF    +          M  GPKYDGKYLH  L+  
Sbjct  81   PDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYLHAQLRRL  140

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LG+ RL +TLT+V                       P  NA LSDIC++TSAAPTY 
Sbjct  141  LGNMRLDRTLTNVVIPTFDIAYMQPMIFSSFELKHRPSTNALLSDICMSTSAAPTYF  197



>tpg|DAA48471.1| TPA: patatin class 1 [Zea mays]
Length=423

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 115/177 (65%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++T+LSIDGGGIRGIIP TI+A+LE +LQ  DGPDARIADYFDV+AGTSTGGL+T ML A
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  80

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFPGNTSAWQ------NMLAGPKYDGKYLHQVLKNN  112
            PD N+RPL+A KD+  FY +H P IF    +          M  GPKYDGKYLH  L+  
Sbjct  81   PDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYLHAQLRRL  140

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LG+ RL +TLT+V                       P  NA LSDIC++TSAAPTY 
Sbjct  141  LGNMRLDRTLTNVVIPTFDIAYMQPMIFSSFELKHRPSTNALLSDICMSTSAAPTYF  197



>ref|XP_009366807.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=389

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 121/188 (64%), Gaps = 28/188 (15%)
 Frame = -2

Query  480  IAASIPPSGVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstg  301
            ++  +     VT+LSIDGGGIRGIIP T++A+LE +LQ  DGPDAR+ADYFD+IAGTSTG
Sbjct  1    MSTGLTKRRTVTVLSIDGGGIRGIIPSTLLAFLESKLQELDGPDARVADYFDIIAGTSTG  60

Query  300  glmttmLAAPDKNKRPLYAGKDIVPFYKEHGPYIFPGNT--------SAWQNMLAGPKYD  145
            GL+TTMLAAP+K+ RP++  KDI  FY +H P IFP N+        ++    + GPKYD
Sbjct  61   GLVTTMLAAPNKDNRPMFEAKDINNFYFDHTPKIFPQNSRNNFLTSLTSMVGAVMGPKYD  120

Query  144  GKYLHQVLKNNLGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIA  25
            GKYL  +    LGD  L QTLT V                       P KNAKLSDIC++
Sbjct  121  GKYLRTLTNELLGDLTLKQTLTTVLIPTFDIKHLQPVIFSTIDAKKIPLKNAKLSDICVS  180

Query  24   TSAAPTYL  1
            TSAAPTYL
Sbjct  181  TSAAPTYL  188



>ref|XP_004973689.1| PREDICTED: LOW QUALITY PROTEIN: patatin-2-Kuras 3-like [Setaria 
italica]
Length=436

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 130/201 (65%), Gaps = 41/201 (20%)
 Frame = -2

Query  513  TTPSSPATGGYIAASIPPS--GVVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARI  340
            +TP SP          PP+   +VT+LSIDGGG+RGIIPGTI+A+LEE+LQ  DGPDARI
Sbjct  36   STPKSP----------PPAYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGPDARI  85

Query  339  ADYFDVIAgtstgglmttmLAAPDKN---KRPLYAGKDIVPFYKEHGPYIFPGNTSAWQN  169
            ADYFDVIAGTSTGGL+T ML AP+K     RPL+A KDI  FY +H P IFP        
Sbjct  86   ADYFDVIAGTSTGGLVTAMLTAPNKKVDPNRPLFAAKDINDFYLKHCPKIFPARRXGLLQ  145

Query  168  MLA----GPKYDGKYLHQVLKNNLGDTRLSQTLTHV---------------------NDS  64
             LA    GPKYDGKYL  ++++ LGDT++S+ L ++                     ND+
Sbjct  146  NLAGLVLGPKYDGKYLQSIVRDLLGDTKVSEVLQNIVIPTFDIKLLQPTVFSRYDAKNDA  205

Query  63   PEKNAKLSDICIATSAAPTYL  1
              KNA LSD+CI+TSAAPTYL
Sbjct  206  -SKNALLSDVCISTSAAPTYL  225



>ref|XP_008337062.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=406

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 100/158 (63%), Gaps = 27/158 (17%)
 Frame = -2

Query  393  VAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAAPDKNKRPLYAGKDIVPFYKE  214
            +A+LE +LQ  DG DARIADYFDVIAGTSTGGL+T MLAAP++N RPL+A KDI+ FY  
Sbjct  36   LAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAAPNENNRPLFAAKDIIDFYFH  95

Query  213  HGPYIFPGNTS-------AWQNMLAGPKYDGKYLHQVLKNNLGDTRLSQTLTH-------  76
            H P IFP NT             LAGPKY+GKYLH +++  +G+ +L +TLT+       
Sbjct  96   HCPKIFPQNTCPIFRYTIKIIKALAGPKYNGKYLHSLIREKMGNKKLHETLTNVVIPTFD  155

Query  75   -------------VNDSPEKNAKLSDICIATSAAPTYL  1
                         V   P  +A LSDI IATSAAPTYL
Sbjct  156  IKNLQPTVFSNHRVKRKPSYBALLSDIXIATSAAPTYL  193



>gb|AAF98370.1|AF158254_1 patatin-like protein 2 [Nicotiana tabacum]
Length=207

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 117/176 (66%), Gaps = 25/176 (14%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            +VT+LSIDGGGIRGIIPGT++A+LE +LQ  DGP+ARIADYFDV+AGTSTGGL++TML A
Sbjct  6    IVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGGLISTMLTA  65

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP-----GNTSAWQNMLAGPKYDGKYLHQVLKNNL  109
            P+K+ RPLYA K+I  FY EHG  IFP     G      N+  GPKYDGKYL  ++K+ L
Sbjct  66   PNKDNRPLYAAKNITNFYMEHGSKIFPESSRSGFVKRITNLFGGPKYDGKYLKTLVKSIL  125

Query  108  GDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            G+  + QTLT                           ++A L+DIC++TSAAPTY 
Sbjct  126  GNLTMKQTLTQTVIPAFDIKRLQPIVFTTADAKTHVSRDALLADICLSTSAAPTYF  181



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 115/177 (65%), Gaps = 26/177 (15%)
 Frame = -2

Query  453  VVTILSidgggirgiipgtIVAYLEEQLQTFDGPDARIADYFDVIAgtstgglmttmLAA  274
            ++TILSIDGGGIRGIIP  I+  LE +LQ  DG DARIADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  273  PDKNKRPLYAGKDIVPFYKEHGPYIFP------GNTSAWQNMLAGPKYDGKYLHQVLKNN  112
            PD N RPLYA KDI  FY +HGP IFP      G+  +    L  PKY GKYLH+++++N
Sbjct  77   PDANNRPLYAAKDIAAFYVKHGPKIFPHKGGVIGSLESMVVQLGRPKYKGKYLHKLIRDN  136

Query  111  LGDTRLSQTLTHV--------------------NDSPEKNAKLSDICIATSAAPTYL  1
            LG TRL  TLT+V                     + P  +A LSDICI TSAAPT+ 
Sbjct  137  LGQTRLHDTLTNVVIPTFDIRNLQPTVFSSYEMKNMPYLDALLSDICIGTSAAPTFF  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720