BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003A06 644 bp,

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004249595.1|  PREDICTED: MACPF domain-containing protein C...    122   9e-36   Solanum lycopersicum
ref|XP_006338925.1|  PREDICTED: MACPF domain-containing protein C...    119   9e-35   Solanum tuberosum [potatoes]
ref|XP_009762737.1|  PREDICTED: MACPF domain-containing protein C...    119   2e-34   Nicotiana sylvestris
ref|XP_010653346.1|  PREDICTED: MACPF domain-containing protein C...    115   2e-34   Vitis vinifera
ref|XP_009790100.1|  PREDICTED: MACPF domain-containing protein C...    119   3e-34   Nicotiana sylvestris
ref|XP_009602365.1|  PREDICTED: MACPF domain-containing protein C...    119   3e-34   Nicotiana tomentosiformis
ref|XP_011095129.1|  PREDICTED: MACPF domain-containing protein C...    115   1e-33   Sesamum indicum [beniseed]
ref|XP_009607403.1|  PREDICTED: MACPF domain-containing protein C...    116   3e-33   Nicotiana tomentosiformis
emb|CBI18046.3|  unnamed protein product                                110   4e-33   Vitis vinifera
emb|CDP06393.1|  unnamed protein product                                113   5e-33   Coffea canephora [robusta coffee]
ref|XP_006429563.1|  hypothetical protein CICLE_v10011355mg             115   1e-32   Citrus clementina
ref|XP_006346676.1|  PREDICTED: MACPF domain-containing protein C...    114   2e-32   Solanum tuberosum [potatoes]
ref|XP_006346677.1|  PREDICTED: MACPF domain-containing protein C...    114   2e-32   Solanum tuberosum [potatoes]
gb|KDO49684.1|  hypothetical protein CISIN_1g008004mg                   116   2e-32   Citrus sinensis [Valencia orange]
gb|AGZ20102.1|  hypothetical protein                                    109   2e-32   Camellia sinensis [black tea]
gb|EYU42009.1|  hypothetical protein MIMGU_mgv1a003451mg                114   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_010653345.1|  PREDICTED: MACPF domain-containing protein C...    110   6e-32   Vitis vinifera
ref|XP_010043143.1|  PREDICTED: MACPF domain-containing protein C...    113   1e-31   Eucalyptus grandis [rose gum]
ref|XP_008388339.1|  PREDICTED: MACPF domain-containing protein C...    113   2e-31   
gb|KJB38055.1|  hypothetical protein B456_006G234900                    114   2e-31   Gossypium raimondii
emb|CAN79815.1|  hypothetical protein VITISV_027127                     108   2e-31   Vitis vinifera
gb|KHG09866.1|  MACPF domain-containing CAD1 -like protein              114   3e-31   Gossypium arboreum [tree cotton]
ref|XP_008463260.1|  PREDICTED: MACPF domain-containing protein C...    113   3e-31   Cucumis melo [Oriental melon]
ref|XP_009372008.1|  PREDICTED: MACPF domain-containing protein C...    113   3e-31   Pyrus x bretschneideri [bai li]
gb|KDP22772.1|  hypothetical protein JCGZ_00359                         110   5e-31   Jatropha curcas
ref|XP_008244991.1|  PREDICTED: MACPF domain-containing protein C...    113   1e-30   Prunus mume [ume]
gb|KGN54446.1|  hypothetical protein Csa_4G332620                       110   1e-30   Cucumis sativus [cucumbers]
ref|XP_004142683.1|  PREDICTED: MACPF domain-containing protein C...    110   2e-30   
ref|XP_002323068.2|  hypothetical protein POPTR_0016s14250g             107   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004168924.1|  PREDICTED: MACPF domain-containing protein C...    108   5e-30   
ref|XP_011011314.1|  PREDICTED: MACPF domain-containing protein C...    104   8e-30   Populus euphratica
ref|XP_011019015.1|  PREDICTED: MACPF domain-containing protein C...    104   1e-29   Populus euphratica
ref|XP_008388338.1|  PREDICTED: MACPF domain-containing protein C...    110   1e-29   Malus domestica [apple tree]
ref|XP_009372007.1|  PREDICTED: MACPF domain-containing protein C...    109   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_010325753.1|  PREDICTED: MACPF domain-containing protein C...    103   2e-29   Solanum lycopersicum
ref|XP_010325754.1|  PREDICTED: MACPF domain-containing protein C...    103   2e-29   Solanum lycopersicum
ref|XP_007208282.1|  hypothetical protein PRUPE_ppa003772mg             108   4e-29   Prunus persica
ref|XP_009346914.1|  PREDICTED: MACPF domain-containing protein C...    108   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_004302554.1|  PREDICTED: MACPF domain-containing protein C...    105   6e-29   Fragaria vesca subsp. vesca
ref|XP_011466424.1|  PREDICTED: MACPF domain-containing protein C...    105   6e-29   Fragaria vesca subsp. vesca
ref|XP_002308249.1|  hypothetical protein POPTR_0006s10840g             101   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010253106.1|  PREDICTED: MACPF domain-containing protein C...    102   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_007134695.1|  hypothetical protein PHAVU_010G068500g           99.0    7e-28   Phaseolus vulgaris [French bean]
ref|XP_009400008.1|  PREDICTED: MACPF domain-containing protein C...    104   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007033550.1|  MAC/Perforin domain-containing protein             119   1e-27   Theobroma cacao [chocolate]
ref|XP_009400007.1|  PREDICTED: MACPF domain-containing protein C...    103   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004506430.1|  PREDICTED: MACPF domain-containing protein C...  99.8    2e-27   Cicer arietinum [garbanzo]
ref|XP_009400006.1|  PREDICTED: MACPF domain-containing protein C...    103   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH29198.1|  MACPF domain CAD1-like protein                          100   2e-27   Medicago truncatula
ref|XP_009396873.1|  PREDICTED: MACPF domain-containing protein C...    107   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004506431.1|  PREDICTED: MACPF domain-containing protein C...  99.4    2e-27   
gb|KJB27684.1|  hypothetical protein B456_005G004800                    117   3e-27   Gossypium raimondii
ref|XP_002532866.1|  conserved hypothetical protein                   97.8    6e-27   
ref|XP_008792214.1|  PREDICTED: MACPF domain-containing protein C...  98.6    7e-27   Phoenix dactylifera
gb|KJB27685.1|  hypothetical protein B456_005G004800                    117   8e-27   Gossypium raimondii
ref|XP_010922732.1|  PREDICTED: MACPF domain-containing protein C...  99.8    2e-26   Elaeis guineensis
gb|KHN47610.1|  MACPF domain-containing protein CAD1                  98.6    2e-26   Glycine soja [wild soybean]
ref|XP_009396872.1|  PREDICTED: MACPF domain-containing protein C...    103   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006573399.1|  PREDICTED: MACPF domain-containing protein C...  98.6    7e-26   Glycine max [soybeans]
ref|XP_006573398.1|  PREDICTED: MACPF domain-containing protein C...  98.2    1e-25   Glycine max [soybeans]
ref|XP_006449569.1|  hypothetical protein CICLE_v10017858mg             100   3e-25   Citrus clementina
ref|XP_006847772.1|  hypothetical protein AMTR_s00162p00048220        99.0    3e-25   
gb|KHG15967.1|  MACPF domain-containing CAD1 -like protein              112   4e-25   Gossypium arboreum [tree cotton]
ref|XP_010931356.1|  PREDICTED: MACPF domain-containing protein C...  96.3    7e-25   Elaeis guineensis
gb|KJB57350.1|  hypothetical protein B456_009G159300                    101   1e-24   Gossypium raimondii
gb|KJB57349.1|  hypothetical protein B456_009G159300                    101   2e-24   Gossypium raimondii
ref|XP_007025263.1|  MAC/Perforin domain-containing protein             100   2e-24   Theobroma cacao [chocolate]
emb|CDP19447.1|  unnamed protein product                                101   2e-24   Coffea canephora [robusta coffee]
gb|KHF98742.1|  MACPF domain-containing CAD1 -like protein              100   3e-24   Gossypium arboreum [tree cotton]
ref|XP_008225415.1|  PREDICTED: MACPF domain-containing protein CAD1    101   4e-24   Prunus mume [ume]
ref|XP_007213946.1|  hypothetical protein PRUPE_ppa003545mg             101   4e-24   Prunus persica
ref|XP_011102251.1|  PREDICTED: MACPF domain-containing protein C...  99.0    5e-24   Sesamum indicum [beniseed]
gb|KDO77962.1|  hypothetical protein CISIN_1g008646mg                 99.0    6e-24   Citrus sinensis [Valencia orange]
gb|KDO77963.1|  hypothetical protein CISIN_1g008646mg                 99.0    6e-24   Citrus sinensis [Valencia orange]
ref|XP_006467583.1|  PREDICTED: MACPF domain-containing protein C...  99.0    6e-24   Citrus sinensis [Valencia orange]
ref|XP_011101924.1|  PREDICTED: MACPF domain-containing protein CAD1  98.6    7e-24   Sesamum indicum [beniseed]
ref|XP_008439705.1|  PREDICTED: MACPF domain-containing protein CAD1    100   7e-24   Cucumis melo [Oriental melon]
ref|XP_002522282.1|  conserved hypothetical protein                   98.2    8e-24   Ricinus communis
gb|EYU28130.1|  hypothetical protein MIMGU_mgv1a004010mg              96.7    9e-24   Erythranthe guttata [common monkey flower]
emb|CDY35295.1|  BnaC03g59280D                                          100   1e-23   Brassica napus [oilseed rape]
ref|XP_009109654.1|  PREDICTED: MACPF domain-containing protein CAD1    100   1e-23   Brassica rapa
emb|CDX90203.1|  BnaA08g17810D                                          100   1e-23   Brassica napus [oilseed rape]
ref|XP_003546052.1|  PREDICTED: MACPF domain-containing protein C...  97.4    1e-23   Glycine max [soybeans]
ref|XP_004134924.1|  PREDICTED: LOW QUALITY PROTEIN: MACPF domain...  99.8    2e-23   
ref|XP_004163345.1|  PREDICTED: MACPF domain-containing protein C...  99.8    2e-23   
gb|KGN49339.1|  hypothetical protein Csa_6G520370                     99.8    2e-23   Cucumis sativus [cucumbers]
gb|KDP21158.1|  hypothetical protein JCGZ_21629                       98.6    2e-23   Jatropha curcas
ref|XP_009351881.1|  PREDICTED: MACPF domain-containing protein CAD1  98.6    3e-23   Pyrus x bretschneideri [bai li]
ref|XP_010665664.1|  PREDICTED: MACPF domain-containing protein CAD1  93.6    3e-23   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDY44294.1|  BnaA07g07780D                                        99.0    3e-23   Brassica napus [oilseed rape]
ref|XP_006307132.1|  hypothetical protein CARUB_v10008721mg           99.0    3e-23   Capsella rubella
ref|XP_008371521.1|  PREDICTED: MACPF domain-containing protein CAD1  98.2    3e-23   Malus domestica [apple tree]
ref|XP_009600903.1|  PREDICTED: MACPF domain-containing protein CAD1  96.3    3e-23   Nicotiana tomentosiformis
emb|CBI30755.3|  unnamed protein product                              94.7    3e-23   Vitis vinifera
ref|XP_006415554.1|  hypothetical protein EUTSA_v10007234mg           99.0    3e-23   Eutrema salsugineum
gb|EPS64598.1|  hypothetical protein M569_10178                       97.8    4e-23   Genlisea aurea
gb|KFK44796.1|  hypothetical protein AALP_AA1G304500                  99.0    4e-23   Arabis alpina [alpine rockcress]
ref|XP_008383581.1|  PREDICTED: MACPF domain-containing protein C...  99.4    5e-23   
ref|XP_002317318.2|  hypothetical protein POPTR_0011s03190g           98.6    5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011002038.1|  PREDICTED: MACPF domain-containing protein C...  98.6    5e-23   Populus euphratica
ref|XP_002893574.1|  hypothetical protein ARALYDRAFT_473172           97.8    6e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009758720.1|  PREDICTED: MACPF domain-containing protein CAD1  96.3    6e-23   Nicotiana sylvestris
ref|XP_010538230.1|  PREDICTED: MACPF domain-containing protein CAD1  97.8    6e-23   Tarenaya hassleriana [spider flower]
ref|NP_564333.1|  protein constitutively activated cell death 1       99.0    6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542969.1|  PREDICTED: MACPF domain-containing protein C...  97.1    7e-23   Glycine max [soybeans]
ref|XP_010499478.1|  PREDICTED: LOW QUALITY PROTEIN: MACPF domain...  97.4    8e-23   Camelina sativa [gold-of-pleasure]
gb|KHN47374.1|  MACPF domain-containing protein CAD1                  96.7    8e-23   Glycine soja [wild soybean]
ref|XP_010478331.1|  PREDICTED: MACPF domain-containing protein CAD1  97.4    9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004485949.1|  PREDICTED: MACPF domain-containing protein C...  94.7    9e-23   Cicer arietinum [garbanzo]
ref|XP_010462976.1|  PREDICTED: MACPF domain-containing protein C...  97.4    9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010052140.1|  PREDICTED: MACPF domain-containing protein CAD1  95.5    1e-22   Eucalyptus grandis [rose gum]
emb|CDO96893.1|  unnamed protein product                                102   1e-22   Coffea canephora [robusta coffee]
gb|KCW76046.1|  hypothetical protein EUGRSUZ_D00414                   95.5    1e-22   Eucalyptus grandis [rose gum]
gb|KHN40622.1|  MACPF domain-containing protein CAD1                  90.9    1e-22   Glycine soja [wild soybean]
ref|XP_007159499.1|  hypothetical protein PHAVU_002G242800g           94.7    1e-22   Phaseolus vulgaris [French bean]
emb|CDX94691.1|  BnaC07g09670D                                        96.3    1e-22   Brassica napus [oilseed rape]
ref|XP_004232984.1|  PREDICTED: MACPF domain-containing protein CAD1  94.0    2e-22   Solanum lycopersicum
ref|XP_006358073.1|  PREDICTED: MACPF domain-containing protein C...  94.0    2e-22   Solanum tuberosum [potatoes]
ref|XP_004307189.1|  PREDICTED: MACPF domain-containing protein CAD1  95.5    2e-22   Fragaria vesca subsp. vesca
ref|XP_010088625.1|  hypothetical protein L484_005084                 96.3    4e-22   Morus notabilis
ref|XP_006602711.1|  PREDICTED: MACPF domain-containing protein C...  89.4    4e-22   Glycine max [soybeans]
ref|XP_008792299.1|  PREDICTED: MACPF domain-containing protein CAD1  92.0    7e-22   Phoenix dactylifera
ref|XP_003593800.1|  MAC/Perforin domain containing protein           92.0    7e-22   Medicago truncatula
ref|XP_002305709.1|  hypothetical protein POPTR_0004s06280g           94.7    7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002264038.2|  PREDICTED: MACPF domain-containing protein C...  92.4    8e-22   Vitis vinifera
ref|XP_011009673.1|  PREDICTED: MACPF domain-containing protein C...  94.7    8e-22   Populus euphratica
ref|XP_010655591.1|  PREDICTED: MACPF domain-containing protein C...  92.0    1e-21   Vitis vinifera
gb|KHN43736.1|  MACPF domain-containing protein CAD1                    100   2e-21   Glycine soja [wild soybean]
ref|XP_009406153.1|  PREDICTED: MACPF domain-containing protein C...  89.7    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010273468.1|  PREDICTED: MACPF domain-containing protein C...  89.4    5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010916394.1|  PREDICTED: MACPF domain-containing protein C...  88.2    6e-21   Elaeis guineensis
ref|XP_010924700.1|  PREDICTED: MACPF domain-containing protein C...  89.7    6e-21   Elaeis guineensis
ref|XP_010916387.1|  PREDICTED: MACPF domain-containing protein C...  87.8    6e-21   Elaeis guineensis
gb|AAL06838.1|  At1g29690/F15D2_24                                    98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273469.1|  PREDICTED: MACPF domain-containing protein C...  89.4    6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006576450.1|  PREDICTED: MACPF domain-containing protein C...  99.8    1e-20   
emb|CAN81643.1|  hypothetical protein VITISV_012748                   87.4    3e-20   Vitis vinifera
ref|XP_009416434.1|  PREDICTED: MACPF domain-containing protein C...  87.0    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010272721.1|  PREDICTED: MACPF domain-containing protein C...  85.1    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010683518.1|  PREDICTED: MACPF domain-containing protein C...  97.1    1e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDM83977.1|  unnamed protein product                              82.4    5e-19   Triticum aestivum [Canadian hard winter wheat]
gb|EEC71475.1|  hypothetical protein OsI_03732                        80.5    5e-19   Oryza sativa Indica Group [Indian rice]
gb|EMS67830.1|  hypothetical protein TRIUR3_11035                     82.4    5e-19   Triticum urartu
ref|XP_006646321.1|  PREDICTED: MACPF domain-containing protein C...  79.3    5e-19   
gb|EMT19988.1|  hypothetical protein F775_07281                       82.4    5e-19   Aegilops tauschii
gb|EEE55380.1|  hypothetical protein OsJ_03453                        80.5    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569808.1|  PREDICTED: MACPF domain-containing protein CAD1  79.7    3e-18   Brachypodium distachyon [annual false brome]
dbj|BAJ95066.1|  predicted protein                                    79.7    3e-18   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001044243.1|  Os01g0748900                                     79.3    6e-18   
gb|KHN29513.1|  MACPF domain-containing protein CAD1                  89.4    9e-18   Glycine soja [wild soybean]
ref|XP_008673088.1|  PREDICTED: uncharacterized protein LOC100381...  77.0    2e-17   Zea mays [maize]
ref|XP_002963443.1|  hypothetical protein SELMODRAFT_80474            77.8    3e-17   Selaginella moellendorffii
ref|XP_002971577.1|  hypothetical protein SELMODRAFT_95546            77.8    3e-17   Selaginella moellendorffii
ref|XP_008673087.1|  PREDICTED: uncharacterized protein LOC100381...  76.6    3e-17   Zea mays [maize]
gb|ABF70092.1|  hypothetical protein MBP_81C12.22                     88.2    5e-17   Musa balbisiana [starchy banana]
ref|XP_004969946.1|  PREDICTED: MACPF domain-containing protein C...  75.5    7e-17   Setaria italica
gb|ABF72020.1|  hypothetical protein MA4_82I11.22                     87.8    7e-17   Musa acuminata [banana]
ref|XP_002456355.1|  hypothetical protein SORBIDRAFT_03g034590        75.5    8e-17   Sorghum bicolor [broomcorn]
ref|XP_004156931.1|  PREDICTED: MACPF domain-containing protein N...  73.2    1e-16   
ref|XP_006602710.1|  PREDICTED: MACPF domain-containing protein C...  87.8    1e-16   Glycine max [soybeans]
ref|XP_002263223.2|  PREDICTED: MACPF domain-containing protein A...  71.2    2e-16   Vitis vinifera
emb|CBI29699.3|  unnamed protein product                              71.2    2e-16   Vitis vinifera
ref|XP_004146657.1|  PREDICTED: MACPF domain-containing protein N...  72.0    2e-16   Cucumis sativus [cucumbers]
ref|XP_010657979.1|  PREDICTED: MACPF domain-containing protein A...  71.2    2e-16   Vitis vinifera
ref|XP_003592917.1|  hypothetical protein MTR_2g005730                70.5    3e-16   
gb|KDP21000.1|  hypothetical protein JCGZ_21471                       71.2    4e-16   Jatropha curcas
ref|XP_008649986.1|  PREDICTED: MACPF domain-containing protein N...  67.8    5e-16   Zea mays [maize]
ref|XP_007041214.1|  MAC/Perforin domain-containing protein           72.0    6e-16   Theobroma cacao [chocolate]
ref|XP_010087924.1|  hypothetical protein L484_001374                 71.6    7e-16   Morus notabilis
gb|KHG20066.1|  MACPF domain-containing NSL1 -like protein            67.8    1e-15   Gossypium arboreum [tree cotton]
gb|ACN33627.1|  unknown                                               73.6    1e-15   Zea mays [maize]
ref|NP_001149965.1|  MAC/Perforin domain containing protein           73.6    1e-15   Zea mays [maize]
ref|XP_010912654.1|  PREDICTED: MACPF domain-containing protein A...  73.9    2e-15   Elaeis guineensis
ref|XP_010243889.1|  PREDICTED: MACPF domain-containing protein A...  73.2    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010681765.1|  PREDICTED: MACPF domain-containing protein A...  73.2    2e-15   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010912652.1|  PREDICTED: MACPF domain-containing protein A...  73.9    2e-15   Elaeis guineensis
ref|XP_011027785.1|  PREDICTED: MACPF domain-containing protein NSL1  70.1    2e-15   Populus euphratica
ref|XP_007041213.1|  MAC/Perforin domain-containing protein           70.1    2e-15   Theobroma cacao [chocolate]
ref|XP_008649987.1|  PREDICTED: MACPF domain-containing protein N...  65.5    2e-15   Zea mays [maize]
ref|XP_008795255.1|  PREDICTED: MACPF domain-containing protein A...  73.6    2e-15   Phoenix dactylifera
ref|XP_010057373.1|  PREDICTED: MACPF domain-containing protein NSL1  70.1    2e-15   Eucalyptus grandis [rose gum]
ref|XP_002305779.2|  hypothetical protein POPTR_0004s04730g           69.7    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002526447.1|  conserved hypothetical protein                   69.7    3e-15   Ricinus communis
gb|KHN39672.1|  MACPF domain-containing protein                       70.1    3e-15   Glycine soja [wild soybean]
ref|XP_003548336.1|  PREDICTED: MACPF domain-containing protein A...  70.1    3e-15   
ref|XP_002441497.1|  hypothetical protein SORBIDRAFT_09g028080        65.1    3e-15   Sorghum bicolor [broomcorn]
ref|XP_008801493.1|  PREDICTED: MACPF domain-containing protein NSL1  66.6    4e-15   Phoenix dactylifera
ref|XP_004293800.1|  PREDICTED: MACPF domain-containing protein NSL1  68.6    4e-15   Fragaria vesca subsp. vesca
ref|XP_007158662.1|  hypothetical protein PHAVU_002G172000g           65.9    4e-15   Phaseolus vulgaris [French bean]
gb|KJB16207.1|  hypothetical protein B456_002G217400                  72.4    4e-15   Gossypium raimondii
gb|AFW79106.1|  hypothetical protein ZEAMMB73_446527                  68.2    4e-15   Zea mays [maize]
ref|XP_007148565.1|  hypothetical protein PHAVU_006G219200g           70.9    4e-15   Phaseolus vulgaris [French bean]
ref|XP_009612090.1|  PREDICTED: MACPF domain-containing protein NSL1  69.3    4e-15   Nicotiana tomentosiformis
gb|KEH18767.1|  MAC/perforin domain protein                           78.6    5e-15   Medicago truncatula
ref|XP_003630391.1|  hypothetical protein MTR_8g095090                67.8    5e-15   Medicago truncatula
dbj|BAJ92777.1|  predicted protein                                    66.6    5e-15   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002273740.2|  PREDICTED: MACPF domain-containing protein NSL1  68.9    5e-15   Vitis vinifera
gb|KHF99071.1|  hypothetical protein F383_17143                       72.0    5e-15   Gossypium arboreum [tree cotton]
ref|XP_008225135.1|  PREDICTED: MACPF domain-containing protein NSL1  67.8    6e-15   Prunus mume [ume]
ref|XP_006655579.1|  PREDICTED: MACPF domain-containing protein N...  66.2    6e-15   
gb|KHG13926.1|  hypothetical protein F383_06111                       72.0    6e-15   Gossypium arboreum [tree cotton]
gb|KJB68646.1|  hypothetical protein B456_010G256700                  65.1    6e-15   Gossypium raimondii
ref|XP_004503876.1|  PREDICTED: MACPF domain-containing protein A...  67.4    6e-15   Cicer arietinum [garbanzo]
ref|XP_006449390.1|  hypothetical protein CICLE_v10014498mg           67.8    6e-15   Citrus clementina
ref|XP_009352871.1|  PREDICTED: MACPF domain-containing protein NSL1  68.9    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_008347922.1|  PREDICTED: MACPF domain-containing protein A...  68.2    7e-15   Malus domestica [apple tree]
ref|XP_008347923.1|  PREDICTED: MACPF domain-containing protein A...  68.2    7e-15   Malus domestica [apple tree]
ref|XP_009410910.1|  PREDICTED: MACPF domain-containing protein N...  67.0    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008218721.1|  PREDICTED: MACPF domain-containing protein A...  68.2    8e-15   Prunus mume [ume]
ref|XP_010917949.1|  PREDICTED: MACPF domain-containing protein N...  65.5    9e-15   Elaeis guineensis
gb|KJB47872.1|  hypothetical protein B456_008G045500                  71.2    9e-15   Gossypium raimondii
ref|XP_010917939.1|  PREDICTED: MACPF domain-containing protein N...  65.5    9e-15   Elaeis guineensis
emb|CAN74094.1|  hypothetical protein VITISV_023707                   68.6    9e-15   Vitis vinifera
ref|XP_004232912.1|  PREDICTED: MACPF domain-containing protein NSL1  68.2    9e-15   Solanum lycopersicum
ref|XP_006467748.1|  PREDICTED: MACPF domain-containing protein N...  67.4    1e-14   Citrus sinensis [Valencia orange]
ref|XP_010111186.1|  hypothetical protein L484_015070                 67.0    1e-14   Morus notabilis
ref|XP_008339399.1|  PREDICTED: MACPF domain-containing protein A...  67.0    1e-14   Malus domestica [apple tree]
ref|XP_006364290.1|  PREDICTED: MACPF domain-containing protein N...  68.2    1e-14   Solanum tuberosum [potatoes]
ref|XP_011043424.1|  PREDICTED: MACPF domain-containing protein N...  68.9    1e-14   Populus euphratica
ref|XP_008786477.1|  PREDICTED: MACPF domain-containing protein A...  71.6    1e-14   
ref|XP_002439105.1|  hypothetical protein SORBIDRAFT_09g000570        66.2    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010930567.1|  PREDICTED: MACPF domain-containing protein A...  70.1    1e-14   Elaeis guineensis
ref|XP_003540144.1|  PREDICTED: MACPF domain-containing protein A...  70.9    1e-14   Glycine max [soybeans]
ref|XP_008786480.1|  PREDICTED: MACPF domain-containing protein A...  71.2    1e-14   Phoenix dactylifera
ref|XP_007222050.1|  hypothetical protein PRUPE_ppa003112mg           67.8    1e-14   Prunus persica
gb|ACN36806.1|  unknown                                               70.1    1e-14   Zea mays [maize]
ref|XP_002509441.1|  conserved hypothetical protein                   68.2    1e-14   
gb|KHN15479.1|  MACPF domain-containing protein NSL1                  63.9    1e-14   Glycine soja [wild soybean]
gb|EEC79676.1|  hypothetical protein OsI_20937                        65.5    1e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_003528464.1|  PREDICTED: MACPF domain-containing protein N...  63.9    1e-14   Glycine max [soybeans]
ref|XP_004961258.1|  PREDICTED: MACPF domain-containing protein N...  65.1    1e-14   Setaria italica
gb|ABE79564.1|  Membrane attack complex component/perforin/comple...  68.2    1e-14   Medicago truncatula
ref|NP_001056288.1|  Os05g0557400                                     65.9    1e-14   
ref|XP_009109731.1|  PREDICTED: MACPF domain-containing protein N...  65.9    1e-14   Brassica rapa
emb|CDX90147.1|  BnaA08g18370D                                        65.9    1e-14   Brassica napus [oilseed rape]
gb|KJB75520.1|  hypothetical protein B456_012G045100                  69.3    1e-14   Gossypium raimondii
emb|CAN60694.1|  hypothetical protein VITISV_007560                   64.7    2e-14   Vitis vinifera
ref|XP_002264053.1|  PREDICTED: MACPF domain-containing protein A...  64.7    2e-14   Vitis vinifera
ref|XP_011047918.1|  PREDICTED: MACPF domain-containing protein A...  67.4    2e-14   Populus euphratica
ref|XP_009353765.1|  PREDICTED: MACPF domain-containing protein A...  67.4    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_007211855.1|  hypothetical protein PRUPE_ppa003413mg           70.1    2e-14   Prunus persica
ref|XP_009779321.1|  PREDICTED: MACPF domain-containing protein NSL1  67.4    2e-14   Nicotiana sylvestris
ref|XP_008452249.1|  PREDICTED: MACPF domain-containing protein A...  67.0    2e-14   Cucumis melo [Oriental melon]
ref|XP_004133715.1|  PREDICTED: MACPF domain-containing protein A...  67.0    2e-14   Cucumis sativus [cucumbers]
ref|NP_001130673.1|  uncharacterized protein LOC100191776             65.9    2e-14   Zea mays [maize]
ref|XP_004971326.1|  PREDICTED: MACPF domain-containing protein A...  67.0    2e-14   
ref|XP_001770394.1|  predicted protein                                72.8    2e-14   Physcomitrella patens
ref|XP_002890774.1|  hypothetical protein ARALYDRAFT_473053           65.9    2e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006859050.1|  hypothetical protein AMTR_s00068p00188520        62.8    2e-14   Amborella trichopoda
ref|XP_008345898.1|  PREDICTED: MACPF domain-containing protein N...  65.9    2e-14   Malus domestica [apple tree]
ref|XP_002281436.1|  PREDICTED: MACPF domain-containing protein A...  68.9    2e-14   Vitis vinifera
ref|XP_009355313.1|  PREDICTED: MACPF domain-containing protein A...  66.6    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_009355315.1|  PREDICTED: MACPF domain-containing protein A...  66.6    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_006377398.1|  hypothetical protein POPTR_0011s05590g           69.7    3e-14   Populus trichocarpa [western balsam poplar]
emb|CDY35738.1|  BnaC03g58590D                                        65.1    3e-14   Brassica napus [oilseed rape]
emb|CBI26813.3|  unnamed protein product                              68.9    3e-14   Vitis vinifera
ref|XP_010231045.1|  PREDICTED: MACPF domain-containing protein N...  65.1    3e-14   Brachypodium distachyon [annual false brome]
gb|KDO60794.1|  hypothetical protein CISIN_1g006910mg                 68.2    3e-14   Citrus sinensis [Valencia orange]
ref|XP_009417682.1|  PREDICTED: MACPF domain-containing protein A...  67.8    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003630501.1|  hypothetical protein MTR_8g097210                63.5    3e-14   Medicago truncatula
ref|XP_009410909.1|  PREDICTED: MACPF domain-containing protein N...  67.8    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17420.1|  MACPF domain-containing protein                       66.2    3e-14   Glycine soja [wild soybean]
ref|XP_003525147.1|  PREDICTED: MACPF domain-containing protein A...  66.2    3e-14   Glycine max [soybeans]
ref|XP_006415663.1|  hypothetical protein EUTSA_v10007105mg           65.1    4e-14   Eutrema salsugineum
ref|XP_002869726.1|  hypothetical protein ARALYDRAFT_492421           65.9    4e-14   Arabidopsis lyrata subsp. lyrata
gb|KFK44710.1|  hypothetical protein AALP_AA1G292900                  65.1    4e-14   Arabis alpina [alpine rockcress]
emb|CDY24836.1|  BnaA08g14740D                                        67.8    4e-14   Brassica napus [oilseed rape]
ref|XP_006421070.1|  hypothetical protein CICLE_v10004590mg           61.2    4e-14   Citrus clementina
emb|CBI39416.3|  unnamed protein product                              65.1    4e-14   Vitis vinifera
gb|KHG05157.1|  hypothetical protein F383_31648                       58.5    4e-14   Gossypium arboreum [tree cotton]
ref|XP_006492970.1|  PREDICTED: MACPF domain-containing protein A...  61.2    4e-14   Citrus sinensis [Valencia orange]
ref|XP_009109250.1|  PREDICTED: MACPF domain-containing protein A...  67.8    4e-14   Brassica rapa
ref|XP_010460628.1|  PREDICTED: MACPF domain-containing protein NSL1  65.5    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006594309.1|  PREDICTED: MACPF domain-containing protein N...  64.3    4e-14   Glycine max [soybeans]
emb|CDO99506.1|  unnamed protein product                              65.1    4e-14   Coffea canephora [robusta coffee]
gb|AFW79110.1|  hypothetical protein ZEAMMB73_446527                  57.0    4e-14   Zea mays [maize]
ref|XP_010499363.1|  PREDICTED: MACPF domain-containing protein N...  65.5    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009343152.1|  PREDICTED: MACPF domain-containing protein N...  65.1    4e-14   Pyrus x bretschneideri [bai li]
ref|NP_564307.1|  protein necrotic spotted lesions 1                  64.7    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478209.1|  PREDICTED: MACPF domain-containing protein N...  65.5    5e-14   
gb|EMS60108.1|  hypothetical protein TRIUR3_33265                     68.9    5e-14   
ref|XP_008779211.1|  PREDICTED: MACPF domain-containing protein A...  73.2    5e-14   
ref|XP_006645361.1|  PREDICTED: MACPF domain-containing protein A...  65.1    5e-14   
ref|XP_011096345.1|  PREDICTED: MACPF domain-containing protein NSL1  65.9    5e-14   
gb|KEH20944.1|  MACPF domain protein                                  67.8    5e-14   
ref|XP_002456963.1|  hypothetical protein SORBIDRAFT_03g046450        65.9    5e-14   
ref|XP_006448143.1|  hypothetical protein CICLE_v10014601mg           67.4    6e-14   
ref|XP_006469267.1|  PREDICTED: MACPF domain-containing protein A...  67.4    6e-14   
ref|XP_008358675.1|  PREDICTED: MACPF domain-containing protein N...  65.1    6e-14   
ref|XP_010917957.1|  PREDICTED: MACPF domain-containing protein N...  65.5    6e-14   
ref|XP_003565135.1|  PREDICTED: MACPF domain-containing protein A...  68.6    6e-14   
ref|XP_006449391.1|  hypothetical protein CICLE_v10014498mg           68.2    6e-14   
ref|XP_004504392.1|  PREDICTED: MACPF domain-containing protein A...  62.8    6e-14   
gb|KEH36413.1|  MACPF domain protein                                  67.8    7e-14   
ref|XP_007041212.1|  MAC/Perforin domain-containing protein           66.2    7e-14   
ref|XP_004138354.1|  PREDICTED: MACPF domain-containing protein A...  65.9    7e-14   
gb|KJB75519.1|  hypothetical protein B456_012G045100                  69.3    8e-14   
ref|XP_008445617.1|  PREDICTED: MACPF domain-containing protein A...  66.2    8e-14   
gb|EMT04476.1|  hypothetical protein F775_29418                       68.2    8e-14   
ref|XP_004502271.1|  PREDICTED: MACPF domain-containing protein A...  62.8    8e-14   
gb|KHG02389.1|  hypothetical protein F383_25963                       69.3    8e-14   
ref|XP_008378993.1|  PREDICTED: MACPF domain-containing protein A...  68.2    8e-14   
ref|XP_006492581.1|  PREDICTED: MACPF domain-containing protein A...  65.1    8e-14   
ref|XP_009414997.1|  PREDICTED: MACPF domain-containing protein A...  67.8    9e-14   
gb|EYU26468.1|  hypothetical protein MIMGU_mgv1a003191mg              65.1    9e-14   
ref|XP_011087675.1|  PREDICTED: MACPF domain-containing protein A...  64.7    9e-14   
ref|XP_006364053.1|  PREDICTED: MACPF domain-containing protein A...  67.4    9e-14   
ref|XP_004299896.1|  PREDICTED: MACPF domain-containing protein A...  67.8    1e-13   
ref|XP_010520785.1|  PREDICTED: MACPF domain-containing protein A...  64.3    1e-13   
gb|KDP42447.1|  hypothetical protein JCGZ_00244                       67.8    1e-13   
ref|XP_006389520.1|  hypothetical protein POPTR_0022s00550g           67.4    1e-13   
gb|KGN45926.1|  hypothetical protein Csa_6G022370                     65.9    1e-13   
emb|CDY08932.1|  BnaC08g11620D                                        66.2    1e-13   
gb|EMT08819.1|  hypothetical protein F775_15880                       65.9    1e-13   
ref|XP_011047921.1|  PREDICTED: MACPF domain-containing protein A...  67.4    1e-13   
ref|NP_001058970.1|  Os07g0166100                                     64.7    1e-13   
ref|XP_004485434.1|  PREDICTED: MACPF domain-containing protein A...  67.4    1e-13   
ref|XP_007049981.1|  MAC/Perforin domain-containing protein           68.6    1e-13   
gb|EPS61818.1|  hypothetical protein M569_12969                       61.2    1e-13   
ref|XP_006655967.1|  PREDICTED: MACPF domain-containing protein A...  65.5    1e-13   
ref|XP_009782294.1|  PREDICTED: MACPF domain-containing protein A...  63.5    1e-13   
ref|XP_006283365.1|  hypothetical protein CARUB_v10004407mg           63.9    1e-13   
ref|XP_010549350.1|  PREDICTED: LOW QUALITY PROTEIN: MACPF domain...  63.5    1e-13   
ref|XP_009113667.1|  PREDICTED: MACPF domain-containing protein N...  63.2    1e-13   
gb|EMS66195.1|  hypothetical protein TRIUR3_20923                     65.5    2e-13   
gb|KJB79017.1|  hypothetical protein B456_013G029400                  62.8    2e-13   
gb|KJB16209.1|  hypothetical protein B456_002G217600                  67.4    2e-13   
ref|NP_001169966.1|  uncharacterized protein LOC100383866             67.0    2e-13   
gb|AFW75062.1|  hypothetical protein ZEAMMB73_919359                  65.5    2e-13   
gb|KJB16208.1|  hypothetical protein B456_002G217600                  67.4    2e-13   
gb|KJB71930.1|  hypothetical protein B456_011G147900                  59.7    2e-13   
gb|KEH20619.1|  MACPF domain protein                                  63.9    2e-13   
ref|XP_009416742.1|  PREDICTED: MACPF domain-containing protein A...  64.3    2e-13   
ref|XP_009598695.1|  PREDICTED: MACPF domain-containing protein A...  63.5    2e-13   
gb|AAF79223.1|AC006917_8  F10B6.18                                    63.5    2e-13   
ref|XP_006657476.1|  PREDICTED: MACPF domain-containing protein A...  63.9    2e-13   
emb|CDY34103.1|  BnaA09g27290D                                        62.8    2e-13   
ref|XP_010030180.1|  PREDICTED: MACPF domain-containing protein A...  65.1    2e-13   
ref|XP_007159902.1|  hypothetical protein PHAVU_002G277300g           66.6    2e-13   
ref|XP_009355316.1|  PREDICTED: MACPF domain-containing protein A...  66.6    2e-13   
gb|KDO40930.1|  hypothetical protein CISIN_1g0480482mg                61.2    2e-13   
ref|XP_006307026.1|  hypothetical protein CARUB_v10008612mg           62.8    2e-13   
gb|KJB75518.1|  hypothetical protein B456_012G045100                  67.8    2e-13   
ref|XP_007159354.1|  hypothetical protein PHAVU_002G231000g           60.8    2e-13   
gb|KEH31010.1|  MACPF domain NSL1-like protein                        61.6    2e-13   
ref|XP_004952507.1|  PREDICTED: MACPF domain-containing protein A...  61.2    2e-13   
ref|NP_001045455.1|  Os01g0958700                                     62.8    2e-13   
ref|XP_003532164.1|  PREDICTED: MACPF domain-containing protein A...  65.5    2e-13   
ref|XP_006431633.1|  hypothetical protein CICLE_v10000637mg           66.2    2e-13   
ref|XP_008812983.1|  PREDICTED: MACPF domain-containing protein A...  67.8    2e-13   
gb|KHN16918.1|  MACPF domain-containing protein                       65.5    2e-13   
ref|XP_006413447.1|  hypothetical protein EUTSA_v10024705mg           65.1    2e-13   
ref|XP_010260300.1|  PREDICTED: MACPF domain-containing protein NSL1  60.8    3e-13   
gb|KGN56254.1|  hypothetical protein Csa_3G110020                     65.9    3e-13   
dbj|BAJ97233.1|  predicted protein                                    66.2    3e-13   
ref|XP_009371113.1|  PREDICTED: MACPF domain-containing protein A...  62.8    3e-13   
gb|ACN33472.1|  unknown                                               66.2    3e-13   
ref|XP_008389157.1|  PREDICTED: MACPF domain-containing protein A...  67.4    3e-13   
ref|XP_003601744.1|  hypothetical protein MTR_3g084930                62.8    3e-13   
ref|XP_008812982.1|  PREDICTED: MACPF domain-containing protein A...  67.4    3e-13   
ref|XP_008220921.1|  PREDICTED: MACPF domain-containing protein A...  68.9    3e-13   
ref|XP_008337500.1|  PREDICTED: MACPF domain-containing protein A...  62.8    3e-13   
ref|XP_007034121.1|  MAC/Perforin domain-containing protein isofo...  58.9    3e-13   
gb|KJB28001.1|  hypothetical protein B456_005G021100                  60.5    3e-13   
gb|AES71995.2|  MACPF domain protein                                  62.8    3e-13   
ref|XP_008389158.1|  PREDICTED: MACPF domain-containing protein A...  67.0    3e-13   
gb|KDP32563.1|  hypothetical protein JCGZ_13113                       63.9    3e-13   
ref|XP_006358814.1|  PREDICTED: MACPF domain-containing protein A...  63.2    3e-13   
ref|XP_010244057.1|  PREDICTED: MACPF domain-containing protein A...  63.2    3e-13   
ref|XP_003553052.1|  PREDICTED: MACPF domain-containing protein A...  65.9    3e-13   
gb|KHN24046.1|  MACPF domain-containing protein                       65.9    3e-13   
emb|CDO97619.1|  unnamed protein product                              65.9    3e-13   
ref|XP_002436799.1|  hypothetical protein SORBIDRAFT_10g009010        60.5    4e-13   
ref|XP_004230448.1|  PREDICTED: MACPF domain-containing protein A...  62.8    4e-13   
emb|CDP10314.1|  unnamed protein product                              59.7    4e-13   
ref|XP_004296994.1|  PREDICTED: MACPF domain-containing protein A...  61.6    4e-13   
ref|XP_004248010.1|  PREDICTED: MACPF domain-containing protein A...  63.2    4e-13   
gb|KHN44458.1|  MACPF domain-containing protein                       65.9    4e-13   
ref|XP_010276392.1|  PREDICTED: MACPF domain-containing protein A...  67.4    4e-13   
gb|KHN09978.1|  MACPF domain-containing protein NSL1                  64.3    5e-13   
ref|XP_009379524.1|  PREDICTED: MACPF domain-containing protein A...  61.2    5e-13   
ref|XP_008646215.1|  PREDICTED: MACPF domain-containing protein A...  67.8    5e-13   
gb|KHG30481.1|  hypothetical protein F383_02001                       59.7    5e-13   
ref|XP_006349323.1|  PREDICTED: MACPF domain-containing protein A...  62.0    5e-13   
gb|KDP38138.1|  hypothetical protein JCGZ_04781                       67.4    5e-13   
ref|XP_010682705.1|  PREDICTED: MACPF domain-containing protein A...  63.9    5e-13   
ref|XP_007222029.1|  hypothetical protein PRUPE_ppa003015mg           61.6    5e-13   
ref|XP_010917512.1|  PREDICTED: MACPF domain-containing protein A...  65.9    5e-13   
ref|XP_008222720.1|  PREDICTED: MACPF domain-containing protein A...  61.6    6e-13   
ref|XP_004228745.1|  PREDICTED: MACPF domain-containing protein A...  67.0    6e-13   
ref|XP_008646214.1|  PREDICTED: MACPF domain-containing protein A...  67.8    6e-13   
gb|ADN33704.1|  hypothetical protein                                  63.2    6e-13   
ref|XP_010686412.1|  PREDICTED: MACPF domain-containing protein N...  62.4    6e-13   
gb|KHN12374.1|  MACPF domain-containing protein                       63.9    7e-13   
ref|XP_011087677.1|  PREDICTED: MACPF domain-containing protein A...  64.7    7e-13   
gb|EYU28002.1|  hypothetical protein MIMGU_mgv1a003011mg              62.0    7e-13   
ref|XP_002300219.2|  hypothetical protein POPTR_0001s31300g           64.3    7e-13   
gb|EMT27793.1|  hypothetical protein F775_16417                       66.6    7e-13   
ref|XP_003531208.1|  PREDICTED: MACPF domain-containing protein A...  63.9    7e-13   
ref|NP_849433.1|  MAC/Perforin domain-containing protein              64.7    7e-13   
ref|XP_007045544.1|  MAC/Perforin domain-containing protein, puta...  61.6    7e-13   
emb|CDY34277.1|  BnaA01g13800D                                        63.5    8e-13   
ref|XP_003524173.1|  PREDICTED: MACPF domain-containing protein A...  62.0    8e-13   
ref|XP_009137933.1|  PREDICTED: MACPF domain-containing protein A...  63.5    8e-13   
ref|XP_008467045.1|  PREDICTED: LOW QUALITY PROTEIN: MACPF domain...  63.2    8e-13   
emb|CDP05572.1|  unnamed protein product                              67.0    9e-13   
emb|CDP16016.1|  unnamed protein product                              65.1    9e-13   
ref|XP_010271240.1|  PREDICTED: MACPF domain-containing protein A...  68.2    9e-13   
emb|CCD74483.1|  MAC/Perforin domain-containing protein               65.1    9e-13   
ref|XP_004485438.1|  PREDICTED: MACPF domain-containing protein A...  67.4    9e-13   
ref|XP_010439059.1|  PREDICTED: MACPF domain-containing protein A...  64.3    9e-13   
ref|XP_010433790.1|  PREDICTED: MACPF domain-containing protein A...  64.3    9e-13   
ref|XP_010448581.1|  PREDICTED: MACPF domain-containing protein A...  64.3    9e-13   
ref|XP_011087676.1|  PREDICTED: MACPF domain-containing protein A...  64.3    1e-12   
gb|EPS73899.1|  hypothetical protein M569_00855                       64.3    1e-12   
ref|XP_009605382.1|  PREDICTED: MACPF domain-containing protein A...  65.5    1e-12   
ref|XP_009404231.1|  PREDICTED: MACPF domain-containing protein A...  61.2    1e-12   
ref|XP_003538538.1|  PREDICTED: MACPF domain-containing protein A...  64.7    1e-12   
ref|XP_007034122.1|  MAC/Perforin domain-containing protein isofo...  58.9    1e-12   
ref|XP_010652982.1|  PREDICTED: MACPF domain-containing protein A...  61.6    1e-12   
ref|XP_009599201.1|  PREDICTED: MACPF domain-containing protein A...  61.6    1e-12   
dbj|BAD45980.1|  hypothetical protein                                 62.4    1e-12   
ref|XP_002452590.1|  hypothetical protein SORBIDRAFT_04g028620        66.6    1e-12   
ref|NP_001057295.2|  Os06g0251100                                     62.4    1e-12   
ref|XP_008776980.1|  PREDICTED: MACPF domain-containing protein A...  62.0    1e-12   
ref|XP_010069406.1|  PREDICTED: MACPF domain-containing protein A...  60.8    1e-12   
ref|XP_003574970.1|  PREDICTED: MACPF domain-containing protein A...  59.7    1e-12   
ref|XP_008776979.1|  PREDICTED: MACPF domain-containing protein A...  61.6    1e-12   
ref|XP_010093317.1|  hypothetical protein L484_006776                 67.0    2e-12   
ref|XP_002518616.1|  conserved hypothetical protein                   61.2    2e-12   
gb|AFW73308.1|  hypothetical protein ZEAMMB73_115168                  75.1    2e-12   
ref|XP_004960572.1|  PREDICTED: MACPF domain-containing protein A...  63.5    2e-12   
ref|XP_006580131.1|  PREDICTED: MACPF domain-containing protein A...  62.4    2e-12   
ref|XP_010089454.1|  hypothetical protein L484_003128                 62.0    2e-12   
ref|XP_001777975.1|  predicted protein                                64.3    2e-12   
ref|XP_004960573.1|  PREDICTED: MACPF domain-containing protein A...  63.2    2e-12   
ref|XP_011070556.1|  PREDICTED: MACPF domain-containing protein A...  62.0    2e-12   
ref|XP_010236148.1|  PREDICTED: MACPF domain-containing protein A...  63.2    3e-12   
ref|XP_010673300.1|  PREDICTED: MACPF domain-containing protein A...  63.5    3e-12   
ref|XP_011099665.1|  PREDICTED: MACPF domain-containing protein A...  59.3    3e-12   
ref|XP_008394219.1|  PREDICTED: MACPF domain-containing protein A...  58.5    3e-12   
gb|KFK43748.1|  hypothetical protein AALP_AA1G167900                  61.6    3e-12   
ref|XP_011042746.1|  PREDICTED: MACPF domain-containing protein A...  63.5    4e-12   
ref|XP_002452078.1|  hypothetical protein SORBIDRAFT_04g018940        57.8    4e-12   
ref|NP_001169510.1|  hypothetical protein                             58.2    4e-12   
ref|XP_007222010.1|  hypothetical protein PRUPE_ppa002921mg           63.9    4e-12   
gb|KDP30396.1|  hypothetical protein JCGZ_18139                       62.0    4e-12   
ref|XP_010554973.1|  PREDICTED: MACPF domain-containing protein A...  63.2    4e-12   
ref|XP_002303004.1|  hypothetical protein POPTR_0002s23570g           63.5    4e-12   
ref|XP_010686414.1|  PREDICTED: MACPF domain-containing protein N...  62.4    4e-12   
ref|XP_009764682.1|  PREDICTED: MACPF domain-containing protein A...  63.9    4e-12   
ref|NP_001148060.1|  MAC/Perforin domain containing protein           58.2    4e-12   
gb|AFW62398.1|  MAC/Perforin domain containing protein                58.2    4e-12   
gb|KJB30623.1|  hypothetical protein B456_005G152300                  64.7    5e-12   
ref|XP_009762677.1|  PREDICTED: MACPF domain-containing protein A...  59.3    5e-12   
ref|XP_006306970.1|  hypothetical protein CARUB_v10008542mg           60.5    5e-12   
ref|XP_010227784.1|  PREDICTED: LOW QUALITY PROTEIN: MACPF domain...  60.8    5e-12   
ref|XP_010458996.1|  PREDICTED: MACPF domain-containing protein A...  60.8    6e-12   
ref|XP_010496556.1|  PREDICTED: MACPF domain-containing protein A...  60.8    6e-12   
ref|XP_010476551.1|  PREDICTED: MACPF domain-containing protein A...  60.5    6e-12   
ref|XP_007163784.1|  hypothetical protein PHAVU_001G263800g           60.1    6e-12   
ref|NP_172931.1|  MAC/Perforin domain-containing protein              60.8    6e-12   
ref|XP_009148867.1|  PREDICTED: MACPF domain-containing protein A...  60.1    7e-12   
emb|CDY45289.1|  BnaA06g09590D                                        60.1    7e-12   
ref|XP_004142827.1|  PREDICTED: MACPF domain-containing protein A...  59.7    7e-12   
ref|XP_009630359.1|  PREDICTED: MACPF domain-containing protein A...  63.2    7e-12   
ref|XP_009391421.1|  PREDICTED: MACPF domain-containing protein A...  62.8    7e-12   
emb|CDX81671.1|  BnaC08g39300D                                        60.1    7e-12   
emb|CDY33740.1|  BnaA09g45460D                                        60.1    7e-12   
emb|CDY41106.1|  BnaC05g10970D                                        60.1    7e-12   
ref|XP_009117874.1|  PREDICTED: MACPF domain-containing protein A...  59.7    8e-12   
dbj|BAK02908.1|  predicted protein                                    59.7    8e-12   
ref|XP_010236149.1|  PREDICTED: MACPF domain-containing protein A...  64.3    8e-12   
ref|XP_002890076.1|  hypothetical protein ARALYDRAFT_471668           60.1    8e-12   
gb|KFK43749.1|  hypothetical protein AALP_AA1G167900                  61.6    9e-12   
ref|XP_006845096.1|  hypothetical protein AMTR_s00005p00141350        54.3    9e-12   
emb|CBI21651.3|  unnamed protein product                              61.6    1e-11   
ref|XP_008658030.1|  PREDICTED: uncharacterized protein LOC100192...  60.1    1e-11   
ref|XP_006858570.1|  hypothetical protein AMTR_s00071p00180880        73.2    1e-11   
ref|XP_003630396.1|  hypothetical protein MTR_8g095140                59.3    1e-11   
emb|CAN71024.1|  hypothetical protein VITISV_029386                   61.6    1e-11   
ref|XP_008227706.1|  PREDICTED: MACPF domain-containing protein A...  56.6    1e-11   
gb|KJB37913.1|  hypothetical protein B456_006G226100                  58.2    1e-11   
ref|XP_008227705.1|  PREDICTED: MACPF domain-containing protein A...  56.6    1e-11   
gb|KHG00249.1|  hypothetical protein F383_18098                       58.2    1e-11   
ref|NP_001046842.1|  Os02g0475300                                     58.9    2e-11   
emb|CAN60940.1|  hypothetical protein VITISV_013258                   61.2    2e-11   
gb|EAZ23020.1|  hypothetical protein OsJ_06716                        58.9    2e-11   
gb|EYU30143.1|  hypothetical protein MIMGU_mgv1a007117mg              63.5    2e-11   
gb|EAY85828.1|  hypothetical protein OsI_07190                        58.9    2e-11   
gb|EAY87441.1|  hypothetical protein OsI_08850                        62.8    2e-11   
gb|EYU20576.1|  hypothetical protein MIMGU_mgv1a003164mg              57.8    2e-11   
ref|NP_001048052.1|  Os02g0736300                                     62.8    2e-11   
dbj|BAJ91193.1|  predicted protein                                    59.3    2e-11   
ref|XP_006647301.1|  PREDICTED: MACPF domain-containing protein A...  58.5    2e-11   
gb|AET04872.2|  MACPF domain protein                                  60.1    2e-11   
gb|KEH21392.1|  MACPF domain protein                                  63.5    2e-11   
ref|XP_008644068.1|  PREDICTED: hypothetical protein isoform X1       58.2    2e-11   
ref|XP_010095889.1|  hypothetical protein L484_002338                 60.1    2e-11   
ref|XP_011011262.1|  PREDICTED: MACPF domain-containing protein A...  60.1    2e-11   



>ref|XP_004249595.1| PREDICTED: MACPF domain-containing protein CAD1-like [Solanum 
lycopersicum]
Length=585

 Score =   122 bits (305),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKTV+SSPDVIEMSFYPIT+LLEG+KGKEHL RAISLY
Sbjct  259  EDVTVIFRRRGGDDLEQSHTQWAKTVRSSPDVIEMSFYPITLLLEGIKGKEHLERAISLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 55.5 bits (132),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+QDR
Sbjct  315  ISLYLEYKPQIEELRYFLEFQVPRVWAPVQDR  346



>ref|XP_006338925.1| PREDICTED: MACPF domain-containing protein CAD1-like [Solanum 
tuberosum]
Length=585

 Score =   119 bits (298),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKTV+SSPDVIEMSFYPIT+L+EG+KGKEHL RA+SLY
Sbjct  259  EDVTVIFRRRGGDDLEQSHSQWAKTVRSSPDVIEMSFYPITLLIEGIKGKEHLERAVSLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 54.7 bits (130),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            +SL+ + KPQ+EELRYFLEFQVPR+WAP+QDR
Sbjct  315  VSLYLEYKPQIEELRYFLEFQVPRVWAPVQDR  346



>ref|XP_009762737.1| PREDICTED: MACPF domain-containing protein CAD1-like [Nicotiana 
sylvestris]
Length=582

 Score =   119 bits (299),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W KTV+SSPDVIEMSFYPIT+LLEGVKGK+HL+RAISLY
Sbjct  259  EDVTVIFRRRGGDDLEQSHTQWEKTVRSSPDVIEMSFYPITLLLEGVKGKDHLARAISLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 53.1 bits (126),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+ DR
Sbjct  315  ISLYLEYKPQIEELRYFLEFQVPRVWAPVHDR  346



>ref|XP_010653346.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Vitis vinifera]
Length=603

 Score =   115 bits (287),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            MQDVTVIFRRRGGDDLEQSH  WA +V+SSPDVIEM+F+PIT LLEGV GKEHL+ AI L
Sbjct  276  MQDVTVIFRRRGGDDLEQSHTQWATSVRSSPDVIEMTFFPITALLEGVTGKEHLAHAIGL  335

Query  197  YLECK  183
            YLE K
Sbjct  336  YLEYK  340


 Score = 57.8 bits (138),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQLEELRYFLEFQ+PRIWAP+QD+
Sbjct  340  KPQLEELRYFLEFQIPRIWAPIQDK  364



>ref|XP_009790100.1| PREDICTED: MACPF domain-containing protein CAD1-like [Nicotiana 
sylvestris]
Length=588

 Score =   119 bits (298),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKTV+SSPDVIEMSF+PIT+LLEG+KGK+HL+RAISLY
Sbjct  262  EDVTVIFRRRGGDDLEQSHTQWAKTVRSSPDVIEMSFFPITLLLEGIKGKDHLARAISLY  321

Query  194  LECK  183
            LE K
Sbjct  322  LEYK  325


 Score = 52.8 bits (125),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+Q R
Sbjct  318  ISLYLEYKPQIEELRYFLEFQVPRVWAPVQSR  349



>ref|XP_009602365.1| PREDICTED: MACPF domain-containing protein CAD1-like, partial 
[Nicotiana tomentosiformis]
Length=585

 Score =   119 bits (299),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKTV+SSPDVIEMSF+PIT+LLEG+KGK+HL+RAISLY
Sbjct  259  EDVTVIFRRRGGDDLEQSHTQWAKTVRSSPDVIEMSFFPITLLLEGIKGKDHLARAISLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 52.4 bits (124),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+Q R
Sbjct  315  ISLYLEYKPQIEELRYFLEFQVPRVWAPVQSR  346



>ref|XP_011095129.1| PREDICTED: MACPF domain-containing protein CAD1-like [Sesamum 
indicum]
Length=584

 Score =   115 bits (288),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+SSPDVIEMSF+PIT LL+GV+GKEHL+RAI+LY
Sbjct  259  EDVTVIFRRRGGDDLEQSHTQWARTVRSSPDVIEMSFFPITELLDGVRGKEHLARAIALY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 55.1 bits (131),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQVPRIWAP+QDR
Sbjct  322  KPQIEELRYFLEFQVPRIWAPIQDR  346



>ref|XP_009607403.1| PREDICTED: MACPF domain-containing protein CAD1-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   116 bits (290),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W  TV+SSPDVIEMSF+PIT+LLEGVKGK+HL+RAISLY
Sbjct  173  EDVTVIFRRRGGDDLEQSHTQWEMTVRSSPDVIEMSFFPITLLLEGVKGKDHLARAISLY  232

Query  194  LECK  183
            LE K
Sbjct  233  LEYK  236


 Score = 52.8 bits (125),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+ DR
Sbjct  229  ISLYLEYKPQIEELRYFLEFQVPRVWAPVHDR  260



>emb|CBI18046.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   110 bits (275),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA +V+SSPDVIEM+F+PIT LLEGV GKEHL+ AI LY
Sbjct  297  EDVTVIFRRRGGDDLEQSHTQWATSVRSSPDVIEMTFFPITALLEGVTGKEHLAHAIGLY  356

Query  194  LECK  183
            LE K
Sbjct  357  LEYK  360


 Score = 58.2 bits (139),  Expect(2) = 4e-33, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQLEELRYFLEFQ+PRIWAP+QD+
Sbjct  360  KPQLEELRYFLEFQIPRIWAPIQDK  384



>emb|CDP06393.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   113 bits (282),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+SSPDVIEM FYPI++LL+GV+GKEHL+RAI LY
Sbjct  213  EDVTVIFRRRGGDDLEQSHTQWARTVQSSPDVIEMQFYPISLLLDGVRGKEHLTRAIDLY  272

Query  194  LECK  183
            L+ K
Sbjct  273  LDYK  276


 Score = 55.1 bits (131),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            I L+ D KPQ+EELRYFLEFQVPR WAPLQDR
Sbjct  269  IDLYLDYKPQIEELRYFLEFQVPRTWAPLQDR  300



>ref|XP_006429563.1| hypothetical protein CICLE_v10011355mg [Citrus clementina]
 ref|XP_006481179.1| PREDICTED: MACPF domain-containing protein CAD1-like [Citrus 
sinensis]
 gb|ESR42803.1| hypothetical protein CICLE_v10011355mg [Citrus clementina]
Length=581

 Score =   115 bits (289),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LL+G+ GKEHL+RAI LY
Sbjct  256  EDVTVIFRRRGGDDLEQNHRQWARTVRSSPDVIEMTFFPITALLDGITGKEHLTRAIGLY  315

Query  194  LECK  183
            LECK
Sbjct  316  LECK  319


 Score = 51.2 bits (121),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PR+WAP+Q++
Sbjct  319  KPQIEELRYFLEFQIPRVWAPVQNK  343



>ref|XP_006346676.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Solanum tuberosum]
Length=579

 Score =   114 bits (285),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKT++SSPDVIEMSF PI +LLEGVKG++HL+RAISLY
Sbjct  257  EDVTVIFRRRGGDDLEQSHTQWAKTIRSSPDVIEMSFVPIILLLEGVKGRDHLARAISLY  316

Query  194  LECK  183
            LE K
Sbjct  317  LEYK  320


 Score = 52.0 bits (123),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+E+LRYFLEFQVPR+WAP+ DR
Sbjct  313  ISLYLEYKPQIEDLRYFLEFQVPRVWAPVHDR  344



>ref|XP_006346677.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Solanum tuberosum]
Length=578

 Score =   114 bits (285),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKT++SSPDVIEMSF PI +LLEGVKG++HL+RAISLY
Sbjct  256  EDVTVIFRRRGGDDLEQSHTQWAKTIRSSPDVIEMSFVPIILLLEGVKGRDHLARAISLY  315

Query  194  LECK  183
            LE K
Sbjct  316  LEYK  319


 Score = 52.0 bits (123),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+E+LRYFLEFQVPR+WAP+ DR
Sbjct  312  ISLYLEYKPQIEDLRYFLEFQVPRVWAPVHDR  343



>gb|KDO49684.1| hypothetical protein CISIN_1g008004mg [Citrus sinensis]
Length=581

 Score =   116 bits (290),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LL+G+ GKEHL+RAI LY
Sbjct  256  EDVTVIFRRRGGDDLEQNHRQWARTVRSSPDVIEMTFFPITALLDGITGKEHLTRAIGLY  315

Query  194  LECK  183
            LECK
Sbjct  316  LECK  319


 Score = 50.1 bits (118),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PR+WAP+Q +
Sbjct  319  KPQIEELRYFLEFQIPRVWAPVQTK  343



>gb|AGZ20102.1| hypothetical protein [Camellia sinensis]
Length=586

 Score =   109 bits (272),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVI RRRGGDDLEQSH  W +TV SSPDVIEMSF PIT+LLEGV GKEHL+RAI LY
Sbjct  259  EDVTVILRRRGGDDLEQSHTQWVRTVASSPDVIEMSFLPITLLLEGVTGKEHLARAIGLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 56.6 bits (135),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KPQ+EELRYFLEFQVPRIWAP+QD+H
Sbjct  322  KPQIEELRYFLEFQVPRIWAPVQDKH  347



>gb|EYU42009.1| hypothetical protein MIMGU_mgv1a003451mg [Erythranthe guttata]
Length=584

 Score =   114 bits (286),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WAKTV+SSPDVIEM F+PIT LL+GVKG EHLSRAI+LY
Sbjct  259  EDVTVIFRRRGGDDLEQSHTQWAKTVRSSPDVIEMEFFPITELLDGVKGNEHLSRAIALY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEHK  322


 Score = 50.4 bits (119),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KPQ+EELRYFLEFQVPRIWAP+Q
Sbjct  322  KPQIEELRYFLEFQVPRIWAPVQ  344



>ref|XP_010653345.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Vitis vinifera]
Length=583

 Score =   110 bits (275),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA +V+SSPDVIEM+F+PIT LLEGV GKEHL+ AI LY
Sbjct  257  EDVTVIFRRRGGDDLEQSHTQWATSVRSSPDVIEMTFFPITALLEGVTGKEHLAHAIGLY  316

Query  194  LECK  183
            LE K
Sbjct  317  LEYK  320


 Score = 54.3 bits (129),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQLEELRYFLEFQ+PRIWAP+QD+
Sbjct  320  KPQLEELRYFLEFQIPRIWAPIQDK  344



>ref|XP_010043143.1| PREDICTED: MACPF domain-containing protein CAD1-like [Eucalyptus 
grandis]
 gb|KCW88331.1| hypothetical protein EUGRSUZ_A00720 [Eucalyptus grandis]
Length=585

 Score =   113 bits (282),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPD+IEM+FYPIT L++G+ GKEHL+RAI+LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHFQWAKTVQSSPDIIEMTFYPITALIDGITGKEHLTRAINLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 50.1 bits (118),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+PRIWAP+QD+
Sbjct  320  KPPIEELRYFLEFQIPRIWAPVQDK  344



>ref|XP_008388339.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Malus domestica]
Length=603

 Score =   113 bits (283),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            MQDVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLE + GKEHL+RAI L
Sbjct  281  MQDVTVIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEEIPGKEHLTRAIGL  340

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  341  YLEYKPPIEE  350


 Score = 49.3 bits (116),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  345  KPPIEELRYFLEFQISRIWAPMPDRN  370



>gb|KJB38055.1| hypothetical protein B456_006G234900 [Gossypium raimondii]
Length=580

 Score =   114 bits (286),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPIT LL+GV GKEHL RAISLY
Sbjct  261  EDVTVIFRRRGGDDLEQNHTQWAKTVQSSPDVIEMTFYPITALLDGVAGKEHLIRAISLY  320

Query  194  LECK  183
            LE K
Sbjct  321  LEYK  324


 Score = 47.8 bits (112),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQD  7
            ISL+ + KP +EELRYFLEFQ PRIWAP+Q 
Sbjct  317  ISLYLEYKPPMEELRYFLEFQTPRIWAPIQG  347



>emb|CAN79815.1| hypothetical protein VITISV_027127 [Vitis vinifera]
Length=382

 Score =   108 bits (271),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            DVTVIFRRRGGDDLEQSH  WA +V+SSPDVIEM+F+PIT LLEGV GKEHL+ AI LYL
Sbjct  57   DVTVIFRRRGGDDLEQSHTQWATSVRSSPDVIEMTFFPITALLEGVTGKEHLAHAIGLYL  116

Query  191  ECK  183
            E K
Sbjct  117  EYK  119


 Score = 53.5 bits (127),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQLEELRYFLEFQ+PRIWAP+QD+
Sbjct  119  KPQLEELRYFLEFQIPRIWAPIQDK  143



>gb|KHG09866.1| MACPF domain-containing CAD1 -like protein [Gossypium arboreum]
Length=584

 Score =   114 bits (285),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPIT LL+G+ GKEHL RAISLY
Sbjct  265  EDVTVIFRRRGGDDLEQNHTQWAKTVQSSPDVIEMTFYPITALLDGIAGKEHLIRAISLY  324

Query  194  LECK  183
            LE K
Sbjct  325  LEYK  328


 Score = 47.8 bits (112),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQD  7
            ISL+ + KP +EELRYFLEFQ PRIWAP+Q 
Sbjct  321  ISLYLEYKPPMEELRYFLEFQTPRIWAPIQG  351



>ref|XP_008463260.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis 
melo]
Length=586

 Score =   113 bits (283),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+HV WA+TV+SSPDVIEM+FYPIT LL+GV GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHVRWARTVRSSPDVIEMTFYPITALLDGVVGKEHLTRAILLY  316

Query  194  LECK  183
            LE K
Sbjct  317  LEYK  320


 Score = 48.9 bits (115),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP LEELRYFLEFQ+PR+WAP+ D+
Sbjct  320  KPPLEELRYFLEFQIPRVWAPIHDK  344



>ref|XP_009372008.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Pyrus x bretschneideri]
Length=603

 Score =   113 bits (282),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            MQDVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLE + GKEHL+RAI L
Sbjct  281  MQDVTVIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEEIPGKEHLTRAIDL  340

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  341  YLEYKPPIEE  350


 Score = 48.9 bits (115),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  345  KPPIEELRYFLEFQISRIWAPVSDRN  370



>gb|KDP22772.1| hypothetical protein JCGZ_00359 [Jatropha curcas]
Length=592

 Score =   110 bits (274),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TVKSSPD+IEM+F PIT LL GV GKEHL+RAI LY
Sbjct  265  EDVTVIFRRRGGDDLEQNHTRWARTVKSSPDIIEMAFVPITDLLNGVPGKEHLTRAIGLY  324

Query  194  LECK  183
            LE K
Sbjct  325  LEYK  328


 Score = 51.6 bits (122),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PRIWAPLQ+ 
Sbjct  328  KPQIEELRYFLEFQIPRIWAPLQEN  352



>ref|XP_008244991.1| PREDICTED: MACPF domain-containing protein CAD1-like [Prunus 
mume]
Length=578

 Score =   113 bits (283),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLEGV GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEGVTGKEHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 46.2 bits (108),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  320  KPPIEELRYFLEFQISRIWAPVYDRN  345



>gb|KGN54446.1| hypothetical protein Csa_4G332620 [Cucumis sativus]
Length=586

 Score =   110 bits (276),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+HV WA+TV+SSPDVIEM+F PIT LL+GV GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHVRWARTVRSSPDVIEMTFNPITALLDGVAGKEHLTRAILLY  316

Query  194  LECK  183
            LE K
Sbjct  317  LEYK  320


 Score = 48.9 bits (115),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP LEELRYFLEFQ+PR+WAP+ D+
Sbjct  320  KPPLEELRYFLEFQIPRVWAPIHDK  344



>ref|XP_004142683.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis 
sativus]
Length=560

 Score =   110 bits (276),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+HV WA+TV+SSPDVIEM+F PIT LL+GV GKEHL+RAI LY
Sbjct  231  KDVTVIFRRRGGDDLEQNHVRWARTVRSSPDVIEMTFNPITALLDGVAGKEHLTRAILLY  290

Query  194  LECK  183
            LE K
Sbjct  291  LEYK  294


 Score = 48.9 bits (115),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP LEELRYFLEFQ+PR+WAP+ D+
Sbjct  294  KPPLEELRYFLEFQIPRVWAPIHDK  318



>ref|XP_002323068.2| hypothetical protein POPTR_0016s14250g [Populus trichocarpa]
 gb|EEF04829.2| hypothetical protein POPTR_0016s14250g [Populus trichocarpa]
Length=571

 Score =   107 bits (266),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            DVTVIFRRRGGDDLEQ+H+ WA+TV+SSPDVIEM+F PI  LL GV GKEHLSRAI+LYL
Sbjct  246  DVTVIFRRRGGDDLEQNHIRWARTVESSPDVIEMTFVPIADLLVGVPGKEHLSRAIALYL  305

Query  191  ECK  183
            E K
Sbjct  306  EYK  308


 Score = 52.4 bits (124),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PRIWAP+QD 
Sbjct  308  KPQIEELRYFLEFQIPRIWAPVQDN  332



>ref|XP_004168924.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis 
sativus]
Length=560

 Score =   108 bits (271),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            ++VTVIFRRRGGDDLEQ+HV WA+TV+SSPDVIEM+F PIT LL+GV GKEHL+RAI LY
Sbjct  231  KNVTVIFRRRGGDDLEQNHVRWARTVRSSPDVIEMTFNPITALLDGVAGKEHLTRAILLY  290

Query  194  LECK  183
            LE K
Sbjct  291  LEYK  294


 Score = 48.9 bits (115),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP LEELRYFLEFQ+PR+WAP+ D+
Sbjct  294  KPPLEELRYFLEFQIPRVWAPIHDK  318



>ref|XP_011011314.1| PREDICTED: MACPF domain-containing protein CAD1-like [Populus 
euphratica]
Length=587

 Score =   104 bits (260),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H+ WA+TV+SSPDVIEM+F PI  LL GV G EHLSRAI+LY
Sbjct  261  EDVTVIFRRRGGDDLEQNHIRWARTVESSPDVIEMTFVPIADLLVGVPGIEHLSRAIALY  320

Query  194  LECK  183
            LE K
Sbjct  321  LEYK  324


 Score = 52.4 bits (124),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PRIWAP+QD 
Sbjct  324  KPQIEELRYFLEFQIPRIWAPVQDN  348



>ref|XP_011019015.1| PREDICTED: MACPF domain-containing protein CAD1-like [Populus 
euphratica]
 ref|XP_011019017.1| PREDICTED: MACPF domain-containing protein CAD1-like [Populus 
euphratica]
Length=587

 Score =   104 bits (260),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            + VTVIF RRGGDDLEQ+H+ WA+TV+SSPDVIEMSF PIT LL GV GKEHLSRAI+LY
Sbjct  261  EHVTVIFCRRGGDDLEQNHIQWARTVQSSPDVIEMSFVPITDLLVGVPGKEHLSRAIALY  320

Query  194  LECK  183
            LE K
Sbjct  321  LEYK  324


 Score = 52.4 bits (124),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PRIWAP+QD 
Sbjct  324  KPQIEELRYFLEFQIPRIWAPVQDN  348



>ref|XP_008388338.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Malus domestica]
Length=578

 Score =   110 bits (274),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLE + GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEEIPGKEHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 46.6 bits (109),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  320  KPPIEELRYFLEFQISRIWAPMPDRN  345



>ref|XP_009372007.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Pyrus x bretschneideri]
Length=578

 Score =   109 bits (272),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLE + GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEEIPGKEHLTRAIDLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  320  KPPIEELRYFLEFQISRIWAPVSDRN  345



>ref|XP_010325753.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Solanum lycopersicum]
Length=579

 Score =   103 bits (258),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTV  RRRGGDDLEQSH  WA T++SSPDVIEMSF PI +LLEGVKG+++L+RAISLY
Sbjct  257  EDVTVSCRRRGGDDLEQSHTQWAHTIRSSPDVIEMSFVPIILLLEGVKGRDYLARAISLY  316

Query  194  LECK  183
            LE K
Sbjct  317  LEYK  320


 Score = 52.0 bits (123),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+ D+
Sbjct  313  ISLYLEYKPQIEELRYFLEFQVPRVWAPVHDK  344



>ref|XP_010325754.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Solanum lycopersicum]
Length=578

 Score =   103 bits (258),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTV  RRRGGDDLEQSH  WA T++SSPDVIEMSF PI +LLEGVKG+++L+RAISLY
Sbjct  256  EDVTVSCRRRGGDDLEQSHTQWAHTIRSSPDVIEMSFVPIILLLEGVKGRDYLARAISLY  315

Query  194  LECK  183
            LE K
Sbjct  316  LEYK  319


 Score = 52.0 bits (123),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KPQ+EELRYFLEFQVPR+WAP+ D+
Sbjct  312  ISLYLEYKPQIEELRYFLEFQVPRVWAPVHDK  343



>ref|XP_007208282.1| hypothetical protein PRUPE_ppa003772mg [Prunus persica]
 gb|EMJ09481.1| hypothetical protein PRUPE_ppa003772mg [Prunus persica]
Length=550

 Score =   108 bits (270),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
              D  +IFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PIT LLEGV GKEHL+RAI L
Sbjct  228  FNDKAIIFRRRGGDDLEQNHTRWARTVRSSPDVIEMTFFPITALLEGVTGKEHLTRAIGL  287

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  288  YLEYKPPIEE  297


 Score = 46.2 bits (108),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  292  KPPIEELRYFLEFQISRIWAPVYDRN  317



>ref|XP_009346914.1| PREDICTED: MACPF domain-containing protein CAD1-like [Pyrus x 
bretschneideri]
Length=578

 Score =   108 bits (269),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+SSPDVIEM+F+PI  LLE + GKEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHTQWARTVRSSPDVIEMTFFPIAALLEEIPGKEHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 46.2 bits (108),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+ RIWAP+ DR+
Sbjct  320  KPPIEELRYFLEFQISRIWAPVYDRN  345



>ref|XP_004302554.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=584

 Score =   105 bits (261),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGD+LEQ+H  WA+TV+SSPDVIEM+F+PI  LLE V G+EHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDELEQNHTRWARTVRSSPDVIEMTFFPIAALLEEVIGREHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 49.3 bits (116),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+PRIWAP+ DR+
Sbjct  320  KPPIEELRYFLEFQIPRIWAPVYDRN  345



>ref|XP_011466424.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=498

 Score =   105 bits (261),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGD+LEQ+H  WA+TV+SSPDVIEM+F+PI  LLE V G+EHL+RAI LY
Sbjct  171  EDVTVIFRRRGGDELEQNHTRWARTVRSSPDVIEMTFFPIAALLEEVIGREHLTRAIGLY  230

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  231  LEYKPPIEE  239


 Score = 49.3 bits (116),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EELRYFLEFQ+PRIWAP+ DR+
Sbjct  234  KPPIEELRYFLEFQIPRIWAPVYDRN  259



>ref|XP_002308249.1| hypothetical protein POPTR_0006s10840g [Populus trichocarpa]
 gb|EEE91772.1| hypothetical protein POPTR_0006s10840g [Populus trichocarpa]
Length=597

 Score =   101 bits (251),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            + VTVIF RRGGDDLEQ+H+ WA+TV+SSPDVIEMSF PIT LL G  GKEHL RAI+LY
Sbjct  271  EHVTVIFCRRGGDDLEQNHIKWARTVQSSPDVIEMSFVPITDLLVGAPGKEHLCRAIALY  330

Query  194  LECK  183
            LE K
Sbjct  331  LEYK  334


 Score = 52.4 bits (124),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PRIWAP+QD 
Sbjct  334  KPQIEELRYFLEFQIPRIWAPVQDN  358



>ref|XP_010253106.1| PREDICTED: MACPF domain-containing protein CAD1-like [Nelumbo 
nucifera]
Length=587

 Score =   102 bits (254),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV VIFRRRGGDDL Q H  WA+TV +SPDVI+M+F+PIT LLEGV GK+HL+RAISLY
Sbjct  259  EDVIVIFRRRGGDDLIQRHTLWARTVHASPDVIDMTFFPITSLLEGVPGKDHLTRAISLY  318

Query  194  LECK  183
            LE K
Sbjct  319  LEYK  322


 Score = 50.8 bits (120),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+PRIWAP+QD+
Sbjct  315  ISLYLEYKPPIEELRYFLEFQIPRIWAPVQDK  346



>ref|XP_007134695.1| hypothetical protein PHAVU_010G068500g [Phaseolus vulgaris]
 gb|ESW06689.1| hypothetical protein PHAVU_010G068500g [Phaseolus vulgaris]
Length=581

 Score = 99.0 bits (245),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W  TVKSSPD+IEM+F PIT LL+ +  KEHL RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHSKWLSTVKSSPDIIEMTFCPITALLDEIPAKEHLIRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEFKPPIEE  325


 Score = 52.0 bits (123),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+PR+WAPLQDR
Sbjct  320  KPPIEELRYFLEFQIPRVWAPLQDR  344



>ref|XP_009400008.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=459

 Score =   104 bits (260),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+HV WA+TV S+PDVIEM+F+PIT LLE + GK+HL RAI+LY
Sbjct  260  EDVTVIFRRRGGDDLVQNHVDWARTVPSAPDVIEMTFFPITSLLESIPGKDHLVRAINLY  319

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  320  LEYKPPIEE  328


 Score = 45.4 bits (106),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQ+PRIWAP+++
Sbjct  323  KPPIEELRYFLEFQIPRIWAPVRE  346



>ref|XP_007033550.1| MAC/Perforin domain-containing protein [Theobroma cacao]
 gb|EOY04476.1| MAC/Perforin domain-containing protein [Theobroma cacao]
Length=609

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +QDVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPIT LLEGV GKEHL+RAIS+
Sbjct  282  LQDVTVIFRRRGGDDLEQNHTQWAKTVRSSPDVIEMTFYPITALLEGVAGKEHLTRAISV  341

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  342  YLEYKPPIEE  351


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            IS++ + KP +EELRYFLEFQ+PRIWAP++D+
Sbjct  339  ISVYLEYKPPIEELRYFLEFQIPRIWAPIRDK  370



>ref|XP_009400007.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=581

 Score =   103 bits (258),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+HV WA+TV S+PDVIEM+F+PIT LLE + GK+HL RAI+LY
Sbjct  256  EDVTVIFRRRGGDDLVQNHVDWARTVPSAPDVIEMTFFPITSLLESIPGKDHLVRAINLY  315

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  316  LEYKPPIEE  324


 Score = 45.4 bits (106),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQ+PRIWAP+++
Sbjct  319  KPPIEELRYFLEFQIPRIWAPVRE  342



>ref|XP_004506430.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Cicer arietinum]
Length=585

 Score = 99.8 bits (247),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W KTVKSSPD+IEM+F PIT LL+ +  KEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHHVWLKTVKSSPDIIEMTFCPITDLLDKIPAKEHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 50.1 bits (118),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+PR+WAPL DR
Sbjct  320  KPPIEELRYFLEFQIPRVWAPLHDR  344



>ref|XP_009400006.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=585

 Score =   103 bits (258),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+HV WA+TV S+PDVIEM+F+PIT LLE + GK+HL RAI+LY
Sbjct  260  EDVTVIFRRRGGDDLVQNHVDWARTVPSAPDVIEMTFFPITSLLESIPGKDHLVRAINLY  319

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  320  LEYKPPIEE  328


 Score = 45.4 bits (106),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQ+PRIWAP+++
Sbjct  323  KPPIEELRYFLEFQIPRIWAPVRE  346



>gb|KEH29198.1| MACPF domain CAD1-like protein [Medicago truncatula]
Length=406

 Score =   100 bits (248),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W +TVKSSPD+IEM+F PIT LLE +  KEHL+RAI LY
Sbjct  79   EDVTVIFRRRGGDDLEQNHSIWLETVKSSPDIIEMTFCPITDLLEEIPAKEHLTRAIGLY  138

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  139  LEYKPPIEE  147


 Score = 49.3 bits (116),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+PR+WAPL DR
Sbjct  142  KPPIEELRYFLEFQIPRVWAPLHDR  166



>ref|XP_009396873.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=612

 Score =   107 bits (267),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            MQDVTVIFRRRGGDDL QSHV WA+TV S+PDVI+M+F PIT LLE + GK+HL+RAI+L
Sbjct  286  MQDVTVIFRRRGGDDLVQSHVEWARTVPSAPDVIQMTFLPITSLLESIPGKDHLTRAINL  345

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  346  YLEYKPPIEE  355


 Score = 42.0 bits (97),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQVP IWAP+++
Sbjct  350  KPPIEELRYFLEFQVPWIWAPVRE  373



>ref|XP_004506431.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Cicer arietinum]
Length=559

 Score = 99.4 bits (246),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W KTVKSSPD+IEM+F PIT LL+ +  KEHL+RAI LY
Sbjct  231  KDVTVIFRRRGGDDLEQNHHVWLKTVKSSPDIIEMTFCPITDLLDKIPAKEHLTRAIGLY  290

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  291  LEYKPPIEE  299


 Score = 49.7 bits (117),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+PR+WAPL DR
Sbjct  294  KPPIEELRYFLEFQIPRVWAPLHDR  318



>gb|KJB27684.1| hypothetical protein B456_005G004800 [Gossypium raimondii]
Length=497

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPIT LL+GV GKEHL+RAISLY
Sbjct  171  EDVTVIFRRRGGDDLEQNHTQWAKTVRSSPDVIEMTFYPITALLDGVAGKEHLTRAISLY  230

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  231  LEYKPPVEE  239


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+PRIWAP+QD+
Sbjct  227  ISLYLEYKPPVEELRYFLEFQIPRIWAPVQDK  258



>ref|XP_002532866.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29520.1| conserved hypothetical protein [Ricinus communis]
Length=563

 Score = 97.8 bits (242),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D  +IFRR GGDDLEQ++  WA+TVK+SPDVIEM+F PIT LL G  GKEHL+RAI LY
Sbjct  237  KDKAIIFRRTGGDDLEQNYTRWARTVKASPDVIEMTFSPITDLLNGTPGKEHLTRAIGLY  296

Query  194  LECK  183
            LE K
Sbjct  297  LEYK  300


 Score = 50.1 bits (118),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KPQ+EELRYFLEFQ+PR+WAP+Q+ 
Sbjct  300  KPQIEELRYFLEFQIPRVWAPVQEN  324



>ref|XP_008792214.1| PREDICTED: MACPF domain-containing protein CAD1-like [Phoenix 
dactylifera]
Length=587

 Score = 98.6 bits (244),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QS+ +WA+TV S+PDVIE++F+PI  LLE + GK+HL+RAI+LY
Sbjct  261  EDVTVIFRRRGGDDLVQSYTNWARTVYSAPDVIEITFFPIISLLESIPGKDHLTRAINLY  320

Query  194  LECK  183
            LE K
Sbjct  321  LEYK  324


 Score = 48.9 bits (115),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP LEELRYFLEFQVPRIWAP++D
Sbjct  324  KPPLEELRYFLEFQVPRIWAPIRD  347



>gb|KJB27685.1| hypothetical protein B456_005G004800 [Gossypium raimondii]
Length=585

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPIT LL+GV GKEHL+RAISLY
Sbjct  259  EDVTVIFRRRGGDDLEQNHTQWAKTVRSSPDVIEMTFYPITALLDGVAGKEHLTRAISLY  318

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  319  LEYKPPVEE  327


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+PRIWAP+QD+
Sbjct  315  ISLYLEYKPPVEELRYFLEFQIPRIWAPVQDK  346



>ref|XP_010922732.1| PREDICTED: MACPF domain-containing protein CAD1-like [Elaeis 
guineensis]
Length=582

 Score = 99.8 bits (247),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QS+ +WA+TV S+PDVIEM+F PIT LLE + G++HL+RAI+LY
Sbjct  256  EDVTVIFRRRGGDDLVQSYTNWARTVCSAPDVIEMTFNPITSLLESIPGRDHLTRAINLY  315

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  316  LEYKPPIEE  324


 Score = 46.6 bits (109),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQVPRIWAP+++
Sbjct  319  KPPIEELRYFLEFQVPRIWAPVRN  342



>gb|KHN47610.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=587

 Score = 98.6 bits (244),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W  T+KSSPD+IEM+F PIT LL+ +  KEHL+RAI LY
Sbjct  270  EDVTVIFRRRGGDDLEQNHSKWLSTIKSSPDIIEMTFCPITDLLDEIPAKEHLTRAIGLY  329

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  330  LEYKPPIEE  338


 Score = 47.8 bits (112),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+P +WAPLQD+
Sbjct  333  KPPIEELRYFLEFQIPCVWAPLQDK  357



>ref|XP_009396872.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=585

 Score =   103 bits (258),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSHV WA+TV S+PDVI+M+F PIT LLE + GK+HL+RAI+LY
Sbjct  260  EDVTVIFRRRGGDDLVQSHVEWARTVPSAPDVIQMTFLPITSLLESIPGKDHLTRAINLY  319

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  320  LEYKPPIEE  328


 Score = 42.0 bits (97),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EELRYFLEFQVP IWAP+++
Sbjct  323  KPPIEELRYFLEFQVPWIWAPVRE  346



>ref|XP_006573399.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Glycine max]
Length=581

 Score = 98.6 bits (244),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W  T+KSSPD+IEM+F PIT LL+ +  KEHL+RAI LY
Sbjct  257  EDVTVIFRRRGGDDLEQNHSKWLSTIKSSPDIIEMTFCPITDLLDEIPAKEHLTRAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 45.4 bits (106),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EEL YFLEFQ+P +WAPLQD+
Sbjct  320  KPPIEELTYFLEFQIPCVWAPLQDK  344



>ref|XP_006573398.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Glycine max]
Length=584

 Score = 98.2 bits (243),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
             DVTVIFRRRGGDDLEQ+H  W  T+KSSPD+IEM+F PIT LL+ +  KEHL+RAI LY
Sbjct  260  NDVTVIFRRRGGDDLEQNHSKWLSTIKSSPDIIEMTFCPITDLLDEIPAKEHLTRAIGLY  319

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  320  LEYKPPIEE  328


 Score = 45.4 bits (106),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EEL YFLEFQ+P +WAPLQD+
Sbjct  323  KPPIEELTYFLEFQIPCVWAPLQDK  347



>ref|XP_006449569.1| hypothetical protein CICLE_v10017858mg [Citrus clementina]
 gb|ESR62809.1| hypothetical protein CICLE_v10017858mg [Citrus clementina]
Length=1143

 Score =   100 bits (250),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  230  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  289

Query  194  LECK  183
            LE K
Sbjct  290  LEYK  293


 Score = 41.2 bits (95),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL++Q+PR+WAP
Sbjct  293  KPPIEDLQYFLDYQIPRVWAP  313



>ref|XP_006847772.1| hypothetical protein AMTR_s00162p00048220 [Amborella trichopoda]
 gb|ERN09353.1| hypothetical protein AMTR_s00162p00048220 [Amborella trichopoda]
Length=559

 Score = 99.0 bits (245),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  W  TV S+PDVI MSFYPIT LL+GV G +HL+RAI LY
Sbjct  231  KDVTVIFRRRGGDDLVQSHHKWVTTVYSTPDVINMSFYPITSLLDGVPGAKHLTRAIELY  290

Query  194  LECK  183
            LE K
Sbjct  291  LEYK  294


 Score = 43.1 bits (100),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP LEEL+YFLEFQ+PR WAP Q  
Sbjct  294  KPPLEELQYFLEFQIPRAWAPSQGN  318



>gb|KHG15967.1| MACPF domain-containing CAD1 -like protein [Gossypium arboreum]
 gb|KHG24382.1| MACPF domain-containing CAD1 -like protein [Gossypium arboreum]
Length=559

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WAKTV+SSPDVIEM+FYPI  LL+GV  KEHL+RAISLY
Sbjct  233  EDVTVIFRRRGGDDLEQNHTQWAKTVRSSPDVIEMTFYPINALLDGVARKEHLTRAISLY  292

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  293  LEYKPPVEE  301


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+PRIWAP+QD+
Sbjct  289  ISLYLEYKPPVEELRYFLEFQIPRIWAPVQDK  320



>ref|XP_010931356.1| PREDICTED: MACPF domain-containing protein CAD1-like [Elaeis 
guineensis]
Length=582

 Score = 96.3 bits (238),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QS+  WA+TV S+PDVIE++F PIT LLE + GK+HL RAI+LY
Sbjct  256  EDVTVIFRRRGGDDLVQSYTKWARTVYSAPDVIEITFCPITSLLESMPGKDHLMRAINLY  315

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  316  LEYKPPIEE  324


 Score = 44.7 bits (104),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EEL+YFLEFQVPRIWAP+++
Sbjct  319  KPPIEELQYFLEFQVPRIWAPVRN  342



>gb|KJB57350.1| hypothetical protein B456_009G159300 [Gossypium raimondii]
Length=573

 Score =   101 bits (252),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+S+PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  245  KDVTVIFRRRGGDDLEQSHARWAETVQSAPDVINMTFMPIVSLLEGVPGIKHLARAIELY  304

Query  194  LECK  183
            LE K
Sbjct  305  LEYK  308


 Score = 38.1 bits (87),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q  
Sbjct  308  KPPIEDLQYFLDFQIARVWAPEQSN  332



>gb|KJB57349.1| hypothetical protein B456_009G159300 [Gossypium raimondii]
Length=451

 Score =   101 bits (252),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+S+PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  123  KDVTVIFRRRGGDDLEQSHARWAETVQSAPDVINMTFMPIVSLLEGVPGIKHLARAIELY  182

Query  194  LECK  183
            LE K
Sbjct  183  LEYK  186


 Score = 37.7 bits (86),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q  
Sbjct  186  KPPIEDLQYFLDFQIARVWAPEQSN  210



>ref|XP_007025263.1| MAC/Perforin domain-containing protein [Theobroma cacao]
 gb|EOY27885.1| MAC/Perforin domain-containing protein [Theobroma cacao]
Length=571

 Score =   100 bits (249),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+S+PDVI M+F PI  LLEG+ G +HL+RAI LY
Sbjct  245  KDVTVIFRRRGGDDLEQSHARWAETVQSAPDVINMTFTPIVSLLEGMPGIKHLARAIELY  304

Query  194  LECK  183
            LE K
Sbjct  305  LEYK  308


 Score = 38.9 bits (89),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q +
Sbjct  308  KPPIEDLQYFLDFQIARVWAPEQSK  332



>emb|CDP19447.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   101 bits (251),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W KTV+++PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  229  KDVTVIFRRRGGDDLEQSHAKWVKTVETAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  288

Query  194  LECK  183
            LE K
Sbjct  289  LEYK  292


 Score = 38.1 bits (87),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R+WAP Q
Sbjct  292  KPPIEDLQYFLDFQIARVWAPEQ  314



>gb|KHF98742.1| MACPF domain-containing CAD1 -like protein [Gossypium arboreum]
Length=573

 Score =   100 bits (250),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+++PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  245  KDVTVIFRRRGGDDLEQSHARWAETVQAAPDVINMTFMPIVSLLEGVPGIKHLARAIELY  304

Query  194  LECK  183
            LE K
Sbjct  305  LEYK  308


 Score = 38.1 bits (87),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q  
Sbjct  308  KPPIEDLQYFLDFQIARVWAPEQSN  332



>ref|XP_008225415.1| PREDICTED: MACPF domain-containing protein CAD1 [Prunus mume]
Length=567

 Score =   101 bits (251),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSHV WA+TV+ +PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  237  KDVTVIFRRRGGDDLEQSHVKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  296

Query  194  LECK  183
            LE K
Sbjct  297  LEYK  300


 Score = 37.0 bits (84),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  300  KPPIEDLQYFLDFQIAQVWAPEQNN  324



>ref|XP_007213946.1| hypothetical protein PRUPE_ppa003545mg [Prunus persica]
 gb|EMJ15145.1| hypothetical protein PRUPE_ppa003545mg [Prunus persica]
Length=567

 Score =   101 bits (251),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSHV WA+TV+ +PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  237  KDVTVIFRRRGGDDLEQSHVKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  296

Query  194  LECK  183
            LE K
Sbjct  297  LEYK  300


 Score = 37.0 bits (84),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  300  KPPIEDLQYFLDFQIAQVWAPEQNN  324



>ref|XP_011102251.1| PREDICTED: MACPF domain-containing protein CAD1-like [Sesamum 
indicum]
Length=379

 Score = 99.0 bits (245),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQS+  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  252  KDVTVIFRRRGGDDLEQSYARWARTVEGAPDVINMTFTPIVSLLEGVPGIKHLTRAIELY  311

Query  194  LECK  183
            LE K
Sbjct  312  LEYK  315


 Score = 39.3 bits (90),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  315  KPPIEDLQYFLDFQISRVWAPEQNN  339



>gb|KDO77962.1| hypothetical protein CISIN_1g008646mg [Citrus sinensis]
Length=355

 Score = 99.0 bits (245),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  230  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  289

Query  194  LECK  183
            LE K
Sbjct  290  LEYK  293


 Score = 38.9 bits (89),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL++Q+PR+WAP
Sbjct  293  KPPIEDLQYFLDYQIPRVWAP  313



>gb|KDO77963.1| hypothetical protein CISIN_1g008646mg [Citrus sinensis]
Length=473

 Score = 99.0 bits (245),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  145  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  204

Query  194  LECK  183
            LE K
Sbjct  205  LEYK  208


 Score = 38.9 bits (89),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL++Q+PR+WAP
Sbjct  208  KPPIEDLQYFLDYQIPRVWAP  228



>ref|XP_006467583.1| PREDICTED: MACPF domain-containing protein CAD1-like [Citrus 
sinensis]
 gb|KDO77961.1| hypothetical protein CISIN_1g008646mg [Citrus sinensis]
Length=558

 Score = 99.0 bits (245),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  230  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  289

Query  194  LECK  183
            LE K
Sbjct  290  LEYK  293


 Score = 38.9 bits (89),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL++Q+PR+WAP
Sbjct  293  KPPIEDLQYFLDYQIPRVWAP  313



>ref|XP_011101924.1| PREDICTED: MACPF domain-containing protein CAD1 [Sesamum indicum]
Length=568

 Score = 98.6 bits (244),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQS+  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  246  KDVTVIFRRRGGDDLEQSYARWARTVEGAPDVINMTFTPIVSLLEGVPGIKHLTRAIELY  305

Query  194  LECK  183
            LE K
Sbjct  306  LEYK  309


 Score = 38.9 bits (89),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  309  KPPIEDLQYFLDFQISRVWAPEQNN  333



>ref|XP_008439705.1| PREDICTED: MACPF domain-containing protein CAD1 [Cucumis melo]
Length=573

 Score =   100 bits (250),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  WAKTVKS+PDVI M+F PI  +LEGV G +HL+RAI LY
Sbjct  246  KDVTVIFRRRGGDDLVQSHAQWAKTVKSAPDVINMTFTPIVSMLEGVPGVKHLARAIDLY  305

Query  194  LECK  183
            LE K
Sbjct  306  LEYK  309


 Score = 36.2 bits (82),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R WAP Q
Sbjct  309  KPPIEDLQYFLDFQIGRAWAPEQ  331



>ref|XP_002522282.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40140.1| conserved hypothetical protein [Ricinus communis]
Length=559

 Score = 98.2 bits (243),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  232  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIISLLEGVTGIKHLARAIDLY  291

Query  194  LECK  183
            LE K
Sbjct  292  LEYK  295


 Score = 38.9 bits (89),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  295  KPPIEDLQYFLDFQIARVWAPEQNN  319



>gb|EYU28130.1| hypothetical protein MIMGU_mgv1a004010mg [Erythranthe guttata]
Length=549

 Score = 96.7 bits (239),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQS+  W+ TV+ +PDVIEM+F P+  LLEGV G +HL+RAI LY
Sbjct  236  KDVTVIFRRRGGDDLEQSYAKWSTTVEGAPDVIEMTFMPLVSLLEGVTGIKHLTRAIDLY  295

Query  194  LECK  183
            LE K
Sbjct  296  LEYK  299


 Score = 40.4 bits (93),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +E+L+YFL+FQ+PR WAP Q+
Sbjct  299  KPPIEDLQYFLDFQIPRAWAPEQN  322



>emb|CDY35295.1| BnaC03g59280D [Brassica napus]
Length=553

 Score =   100 bits (249),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WAKTV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHTRWAKTVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.6 bits (83),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_009109654.1| PREDICTED: MACPF domain-containing protein CAD1 [Brassica rapa]
Length=566

 Score =   100 bits (249),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WAKTV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHTRWAKTVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>emb|CDX90203.1| BnaA08g17810D [Brassica napus]
Length=554

 Score =   100 bits (249),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WAKTV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHTRWAKTVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_003546052.1| PREDICTED: MACPF domain-containing protein CAD1-like [Glycine 
max]
 gb|KHN06923.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=559

 Score = 97.4 bits (241),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TVK +PD+I M+F PI  LLEGV G ++L+RAI LY
Sbjct  233  KDVTVIFRRRGGDDLEQSHTKWAETVKLAPDIINMNFTPIVSLLEGVPGVKYLARAIDLY  292

Query  194  LECK  183
            LE K
Sbjct  293  LEYK  296


 Score = 38.9 bits (89),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  296  KPPIEDLQYFLDFQITRVWAPEQNN  320



>ref|XP_004134924.1| PREDICTED: LOW QUALITY PROTEIN: MACPF domain-containing protein 
CAD1-like [Cucumis sativus]
Length=458

 Score = 99.8 bits (247),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            DVTVIFRRRGGDDL QSH  WAKTVKS+PDVI M+F PI  +LEGV G +HL RAI LYL
Sbjct  234  DVTVIFRRRGGDDLVQSHAQWAKTVKSAPDVINMTFTPIVSMLEGVPGVKHLVRAIDLYL  293

Query  191  ECK  183
            E K
Sbjct  294  EYK  296


 Score = 36.6 bits (83),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R WAP Q
Sbjct  296  KPPIEDLQYFLDFQIGRAWAPEQ  318



>ref|XP_004163345.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis 
sativus]
Length=573

 Score = 99.8 bits (247),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  WAKTVKS+PDVI M+F PI  +LEGV G +HL RAI LY
Sbjct  246  KDVTVIFRRRGGDDLVQSHAQWAKTVKSAPDVINMTFTPIVSMLEGVPGVKHLVRAIDLY  305

Query  194  LECK  183
            LE K
Sbjct  306  LEYK  309


 Score = 36.6 bits (83),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R WAP Q
Sbjct  309  KPPIEDLQYFLDFQIGRAWAPEQ  331



>gb|KGN49339.1| hypothetical protein Csa_6G520370 [Cucumis sativus]
Length=555

 Score = 99.8 bits (247),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  WAKTVKS+PDVI M+F PI  +LEGV G +HL RAI LY
Sbjct  228  KDVTVIFRRRGGDDLVQSHAQWAKTVKSAPDVINMTFTPIVSMLEGVPGVKHLVRAIDLY  287

Query  194  LECK  183
            LE K
Sbjct  288  LEYK  291


 Score = 36.2 bits (82),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R WAP Q
Sbjct  291  KPPIEDLQYFLDFQIGRAWAPEQ  313



>gb|KDP21158.1| hypothetical protein JCGZ_21629 [Jatropha curcas]
Length=558

 Score = 98.6 bits (244),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  232  KDVTVIFRRRGGDDLEQSHAKWAETVQFAPDVINMTFTPIVSLLEGVPGIKHLARAIDLY  291

Query  194  LECK  183
            LE K
Sbjct  292  LEYK  295


 Score = 37.0 bits (84),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R+WAP Q
Sbjct  295  KPPIEDLQYFLDFQIVRVWAPEQ  317



>ref|XP_009351881.1| PREDICTED: MACPF domain-containing protein CAD1 [Pyrus x bretschneideri]
Length=570

 Score = 98.6 bits (244),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  WA+TV+ +PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  249  KDVTVIFRRRGGDDLEQNHTKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  308

Query  194  LECK  183
            LE K
Sbjct  309  LEYK  312


 Score = 37.0 bits (84),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  312  KPPIEDLQYFLDFQIAQVWAPEQNN  336



>ref|XP_010665664.1| PREDICTED: MACPF domain-containing protein CAD1 [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score = 93.6 bits (231),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQS + WA++V  +PDVIEM+F PI  LLEG+ G +HL+ AI LY
Sbjct  234  KDVTVIFRRRGGDDLEQSSIKWAESVNLAPDVIEMTFEPIVSLLEGIPGLKHLAHAIELY  293

Query  194  LECK  183
            LE K
Sbjct  294  LEYK  297


 Score = 41.6 bits (96),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP LE+L+YFLEFQ+PR+WAP
Sbjct  297  KPPLEDLQYFLEFQIPRVWAP  317



>emb|CDY44294.1| BnaA07g07780D [Brassica napus]
Length=563

 Score = 99.0 bits (245),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  242  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  301

Query  194  LECK  183
            LE K
Sbjct  302  LEYK  305


 Score = 36.6 bits (83),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  305  KPPMEDLQYFLDFQIARAWAPEQSN  329



>ref|XP_006307132.1| hypothetical protein CARUB_v10008721mg [Capsella rubella]
 gb|EOA40030.1| hypothetical protein CARUB_v10008721mg [Capsella rubella]
Length=565

 Score = 99.0 bits (245),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.6 bits (83),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_008371521.1| PREDICTED: MACPF domain-containing protein CAD1 [Malus domestica]
Length=570

 Score = 98.2 bits (243),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HLSRA+ LY
Sbjct  249  KDVTVIFRRRGGDDLEQSHSKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLSRAVELY  308

Query  194  LECK  183
            LE K
Sbjct  309  LEYK  312


 Score = 37.0 bits (84),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  312  KPPIEDLQYFLDFQIAQVWAPEQNN  336



>ref|XP_009600903.1| PREDICTED: MACPF domain-containing protein CAD1 [Nicotiana tomentosiformis]
Length=572

 Score = 96.3 bits (238),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV++SPDVI M+F PI  LLE V G ++LSRAI LY
Sbjct  244  KDVTVIFRRRGGDDLEQSHEKWARTVETSPDVINMTFTPIVSLLEEVPGIKYLSRAIELY  303

Query  194  LECK  183
            LE K
Sbjct  304  LEYK  307


 Score = 38.9 bits (89),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  307  KPPIEDLQYFLDFQIARVWAPEQNN  331



>emb|CBI30755.3| unnamed protein product [Vitis vinifera]
Length=1252

 Score = 94.7 bits (234),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W++TV+ +PDVI M F PI  LL+ V G +HL+RA+ LY
Sbjct  250  KDVTVIFRRRGGDDLEQSHAKWSETVELAPDVINMKFVPIVSLLDSVPGLKHLARAVDLY  309

Query  194  LECK  183
            LE K
Sbjct  310  LEYK  313


 Score = 40.8 bits (94),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+ R+WAP
Sbjct  313  KPPIEDLQYFLEFQIARVWAP  333



>ref|XP_006415554.1| hypothetical protein EUTSA_v10007234mg [Eutrema salsugineum]
 gb|ESQ33907.1| hypothetical protein EUTSA_v10007234mg [Eutrema salsugineum]
Length=566

 Score = 99.0 bits (245),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>gb|EPS64598.1| hypothetical protein M569_10178 [Genlisea aurea]
Length=553

 Score = 97.8 bits (242),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGD+LEQS+V WA+TV+SSPDVI M+F PI   L+GV G +HL+RAI LY
Sbjct  242  KDVTVIFRRRGGDELEQSYVKWARTVESSPDVINMTFSPIVSFLQGVAGIKHLARAIDLY  301

Query  194  LECK  183
            LE K
Sbjct  302  LEYK  305


 Score = 37.0 bits (84),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL+FQ+ R+WAP
Sbjct  305  KPPIEDLQYFLDFQISRVWAP  325



>gb|KFK44796.1| hypothetical protein AALP_AA1G304500 [Arabis alpina]
Length=563

 Score = 99.0 bits (245),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  239  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  298

Query  194  LECKDIV  174
            LE K  +
Sbjct  299  LEYKPPI  305


 Score = 36.2 bits (82),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +E+L+YFL+FQ+ R WAP Q 
Sbjct  302  KPPIEDLQYFLDFQIARAWAPEQS  325



>ref|XP_008383581.1| PREDICTED: MACPF domain-containing protein CAD1-like [Malus domestica]
Length=420

 Score = 99.4 bits (246),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  240  KDVTVIFRRRGGDDLEQSHPKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  299

Query  194  LECK  183
            LE K
Sbjct  300  LEYK  303


 Score = 35.4 bits (80),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL+FQ+ ++WAP
Sbjct  303  KPPIEDLQYFLDFQIAQVWAP  323



>ref|XP_002317318.2| hypothetical protein POPTR_0011s03190g [Populus trichocarpa]
 gb|EEE97930.2| hypothetical protein POPTR_0011s03190g [Populus trichocarpa]
Length=561

 Score = 98.6 bits (244),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  236  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  295

Query  194  LECK  183
            LE K
Sbjct  296  LEYK  299


 Score = 35.8 bits (81),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ + WAP Q+ 
Sbjct  299  KPPIEDLQYFLDFQIAKGWAPEQNN  323



>ref|XP_011002038.1| PREDICTED: MACPF domain-containing protein CAD1-like [Populus 
euphratica]
Length=557

 Score = 98.6 bits (244),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  232  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLEGVPGIKHLARAIELY  291

Query  194  LECK  183
            LE K
Sbjct  292  LEYK  295


 Score = 35.8 bits (81),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ + WAP Q+ 
Sbjct  295  KPPIEDLQYFLDFQIAKGWAPEQNN  319



>ref|XP_002893574.1| hypothetical protein ARALYDRAFT_473172 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69833.1| hypothetical protein ARALYDRAFT_473172 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score = 97.8 bits (242),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LL+GV G +HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLKGVPGLQHLTRAIDLY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.6 bits (83),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_009758720.1| PREDICTED: MACPF domain-containing protein CAD1 [Nicotiana sylvestris]
Length=570

 Score = 96.3 bits (238),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV++SPDVI M+F PI  LLE V G ++LSRAI LY
Sbjct  242  KDVTVIFRRRGGDDLEQSHEKWARTVETSPDVINMTFTPIVSLLEEVPGIKYLSRAIELY  301

Query  194  LECK  183
            LE K
Sbjct  302  LEYK  305


 Score = 38.1 bits (87),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL++Q+ R+WAP Q+ 
Sbjct  305  KPPIEDLQYFLDYQIARVWAPEQNN  329



>ref|XP_010538230.1| PREDICTED: MACPF domain-containing protein CAD1 [Tarenaya hassleriana]
Length=568

 Score = 97.8 bits (242),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PDVI M+F PI  LLEGV G  HL+RAI LY
Sbjct  240  KDITVIFRRRGGDDLEQSHGRWAETVSTAPDVINMTFTPIVSLLEGVPGLRHLTRAIELY  299

Query  194  LECKDIV  174
            LE K  +
Sbjct  300  LEYKPPI  306


 Score = 36.2 bits (82),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  303  KPPIEDLQYFLDFQIARAWAPEQSN  327



>ref|NP_564333.1| protein constitutively activated cell death 1 [Arabidopsis thaliana]
 sp|Q9C7N2.1|CAD1_ARATH RecName: Full=MACPF domain-containing protein CAD1; AltName: 
Full=Protein CONSTITUTIVELY ACTIVATED CELL DEATH 1; Short=Protein 
CAD1 [Arabidopsis thaliana]
 gb|AAG51760.1|AC068667_39 unknown protein; 124288-121737 [Arabidopsis thaliana]
 gb|AAL75908.1| At1g29690/F15D2_24 [Arabidopsis thaliana]
 gb|ABO38750.1| At1g29690 [Arabidopsis thaliana]
 gb|AEE31118.1| MAC/Perforin domain-containing protein [Arabidopsis thaliana]
Length=561

 Score = 99.0 bits (245),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 35.4 bits (80),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL++Q+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDYQIARAWAPEQSN  328



>ref|XP_003542969.1| PREDICTED: MACPF domain-containing protein CAD1-like [Glycine 
max]
Length=559

 Score = 97.1 bits (240),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W +TVK +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  233  KDVTVIFRRRGGDDLEQSHTKWVETVKLAPDVINMNFTPIVSLLEGVPGIKHLARAIDLY  292

Query  194  LECK  183
            L+ K
Sbjct  293  LQYK  296


 Score = 37.0 bits (84),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  296  KPPIEDLQYFLDFQITQVWAPEQNN  320



>ref|XP_010499478.1| PREDICTED: LOW QUALITY PROTEIN: MACPF domain-containing protein 
CAD1 [Camelina sativa]
Length=565

 Score = 97.4 bits (241),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  W++TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWSETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>gb|KHN47374.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=493

 Score = 96.7 bits (239),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W +TVK +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  167  KDVTVIFRRRGGDDLEQSHTKWVETVKLAPDVINMNFTPIVSLLEGVPGIKHLARAIDLY  226

Query  194  LECK  183
            L+ K
Sbjct  227  LQYK  230


 Score = 37.0 bits (84),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  230  KPPIEDLQYFLDFQITQVWAPEQNN  254



>ref|XP_010478331.1| PREDICTED: MACPF domain-containing protein CAD1 [Camelina sativa]
Length=565

 Score = 97.4 bits (241),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  W++TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWSETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_004485949.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cicer arietinum]
Length=565

 Score = 94.7 bits (234),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W +TVK +PD+I M F PI  LLEGV+G + L+RAI LY
Sbjct  237  KDVTVIFRRRGGDDLEQSHTKWVETVKLAPDIINMKFTPIVSLLEGVQGVKFLARAIDLY  296

Query  194  LECK  183
            LE K
Sbjct  297  LEYK  300


 Score = 38.9 bits (89),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  300  KPPIEDLQYFLDFQITRVWAPEQNN  324



>ref|XP_010462976.1| PREDICTED: MACPF domain-containing protein CAD1-like [Camelina 
sativa]
Length=585

 Score = 97.4 bits (241),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  W++TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWSETVPAAPDIINMTFTPIVSLLEGVPGLRHLTRAIELY  300

Query  194  LECKDIV  174
            LE K  +
Sbjct  301  LEYKPPI  307


 Score = 36.2 bits (82),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  304  KPPIEDLQYFLDFQIARAWAPEQSN  328



>ref|XP_010052140.1| PREDICTED: MACPF domain-containing protein CAD1 [Eucalyptus grandis]
 gb|KCW76045.1| hypothetical protein EUGRSUZ_D00414 [Eucalyptus grandis]
Length=569

 Score = 95.5 bits (236),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+   WA TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  242  KDVTVIFRRRGGDDLEQNQAKWANTVRLAPDVINMTFTPIVSLLEGVPGIKHLARAIDLY  301

Query  194  LECK  183
            LE K
Sbjct  302  LEYK  305


 Score = 38.1 bits (87),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R+WAP Q
Sbjct  305  KPPIEDLQYFLDFQIARVWAPEQ  327



>emb|CDO96893.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W KTV+++PDVI M+F PI  LLEGV G +HLSRAI LY
Sbjct  157  KDVTVIFRRRGGDDLEQSHAKWVKTVETAPDVINMTFTPIVSLLEGVPGIKHLSRAIELY  216

Query  194  LECK  183
            L CK
Sbjct  217  LVCK  220



>gb|KCW76046.1| hypothetical protein EUGRSUZ_D00414 [Eucalyptus grandis]
Length=450

 Score = 95.5 bits (236),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+   WA TV+ +PDVI M+F PI  LLEGV G +HL+RAI LY
Sbjct  123  KDVTVIFRRRGGDDLEQNQAKWANTVRLAPDVINMTFTPIVSLLEGVPGIKHLARAIDLY  182

Query  194  LECK  183
            LE K
Sbjct  183  LEYK  186


 Score = 37.7 bits (86),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQ  10
            KP +E+L+YFL+FQ+ R+WAP Q
Sbjct  186  KPPIEDLQYFLDFQIARVWAPEQ  208



>gb|KHN40622.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=574

 Score = 90.9 bits (224),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            QDV VIFRRRGGDDLEQ H  W +TV SSPDVI+M+F PIT L++ V GKE L+ AI LY
Sbjct  259  QDVRVIFRRRGGDDLEQDHSMWLRTVWSSPDVIQMTFCPITDLIDEVPGKEQLTHAIGLY  318

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  319  LEYKPPIEE  327


 Score = 42.4 bits (98),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+  +WAPL +R
Sbjct  322  KPPIEELRYFLEFQIAHVWAPLHER  346



>ref|XP_007159499.1| hypothetical protein PHAVU_002G242800g [Phaseolus vulgaris]
 gb|ESW31493.1| hypothetical protein PHAVU_002G242800g [Phaseolus vulgaris]
Length=562

 Score = 94.7 bits (234),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGG+DLEQ+H  W +TVK +PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  236  KDVTVIFRRRGGNDLEQNHSKWVETVKMAPDIINMTFTPIVSLLEGVPGVNHLTRAIDLY  295

Query  194  LECK  183
            LE K
Sbjct  296  LEYK  299


 Score = 38.1 bits (87),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q  
Sbjct  299  KPPIEDLQYFLDFQIARVWAPEQSN  323



>emb|CDX94691.1| BnaC07g09670D [Brassica napus]
Length=547

 Score = 96.3 bits (238),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++ D+I M+F PI  LLEGV G  HLSRAI LY
Sbjct  235  KDITVIFRRRGGDDLEQSHARWAETVSAASDIINMTFTPIVSLLEGVPGLRHLSRAIELY  294

Query  194  LECK  183
            LE K
Sbjct  295  LEYK  298


 Score = 36.6 bits (83),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R WAP Q  
Sbjct  298  KPPMEDLQYFLDFQIARAWAPEQSN  322



>ref|XP_004232984.1| PREDICTED: MACPF domain-containing protein CAD1 [Solanum lycopersicum]
Length=564

 Score = 94.0 bits (232),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA TV++SPDVI M+F PI   LE V G ++LSRAI LY
Sbjct  240  KDVTVIFRRRGGDDLEQSHDKWASTVETSPDVINMTFTPIVSFLEEVPGIKYLSRAIELY  299

Query  194  LECK  183
            LE K
Sbjct  300  LEYK  303


 Score = 38.9 bits (89),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  303  KPPIEDLQYFLDFQIARVWAPEQNN  327



>ref|XP_006358073.1| PREDICTED: MACPF domain-containing protein CAD1-like [Solanum 
tuberosum]
Length=564

 Score = 94.0 bits (232),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA TV++SPDVI M+F PI   LE V G ++LSRAI LY
Sbjct  240  KDVTVIFRRRGGDDLEQSHDKWASTVETSPDVINMTFTPIVSFLEEVPGIKYLSRAIELY  299

Query  194  LECK  183
            LE K
Sbjct  300  LEYK  303


 Score = 38.9 bits (89),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  303  KPPIEDLQYFLDFQIARVWAPEQNN  327



>ref|XP_004307189.1| PREDICTED: MACPF domain-containing protein CAD1 [Fragaria vesca 
subsp. vesca]
Length=555

 Score = 95.5 bits (236),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F  I  LLEGV G +HLSRAI LY
Sbjct  235  KDVTVIFRRRGGDDLEQSHSKWAETVQLAPDVINMTFTSIVSLLEGVPGIKHLSRAIELY  294

Query  194  LECK  183
            LE K
Sbjct  295  LEYK  298


 Score = 37.0 bits (84),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ ++WAP Q+ 
Sbjct  298  KPPIEDLQYFLDFQIAQVWAPEQNN  322



>ref|XP_010088625.1| hypothetical protein L484_005084 [Morus notabilis]
 gb|EXB36787.1| hypothetical protein L484_005084 [Morus notabilis]
Length=549

 Score = 96.3 bits (238),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            VTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLEGV G +HL+RAI LYLE
Sbjct  223  VTVIFRRRGGDDLEQSHAKWAETVRLAPDVINMTFTPIVSLLEGVPGIKHLARAIDLYLE  282

Query  188  CK  183
             K
Sbjct  283  YK  284


 Score = 35.4 bits (80),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFL+FQ+ R WAP
Sbjct  284  KPPIEDLQYFLDFQIARAWAP  304



>ref|XP_006602711.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Glycine max]
Length=572

 Score = 89.4 bits (220),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV VIFRRRGGDDLEQ H  W +TV SSPDVI+M+F PIT L++ V GKE L+ AI LY
Sbjct  257  KDVRVIFRRRGGDDLEQDHSMWLRTVWSSPDVIQMTFCPITDLIDEVPGKEQLTHAIGLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 42.4 bits (98),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +EELRYFLEFQ+  +WAPL +R
Sbjct  320  KPPIEELRYFLEFQIAHVWAPLHER  344



>ref|XP_008792299.1| PREDICTED: MACPF domain-containing protein CAD1 [Phoenix dactylifera]
Length=585

 Score = 92.0 bits (227),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  TV S+PDVI+M+F PI  LL G+ G ++LSRAI LY
Sbjct  266  EDVTVIFRRRGGDDLVQNHAEWKNTVPSAPDVIKMTFIPIVSLLNGLPGIQYLSRAIDLY  325

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  326  LEYKPPIEE  334


 Score = 38.5 bits (88),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQ+ R+WAP
Sbjct  329  KPPIEELQYFLEFQIQRVWAP  349



>ref|XP_003593800.1| MAC/Perforin domain containing protein [Medicago truncatula]
 gb|AES64051.1| MACPF domain protein [Medicago truncatula]
Length=566

 Score = 92.0 bits (227),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH+ W +TVK +PD+I M F PI  LLEGV G + L RAI LY
Sbjct  239  KDVTVIFRRRGGDDLEQSHIKWVETVKLAPDIINMKFTPIVSLLEGVHGVKLLERAIDLY  298

Query  194  LECK  183
            L+ K
Sbjct  299  LQYK  302


 Score = 38.9 bits (89),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ R+WAP Q+ 
Sbjct  302  KPPIEDLQYFLDFQITRVWAPEQNN  326



>ref|XP_002305709.1| hypothetical protein POPTR_0004s06280g [Populus trichocarpa]
 gb|EEE86220.1| hypothetical protein POPTR_0004s06280g [Populus trichocarpa]
Length=557

 Score = 94.7 bits (234),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLE V G +HL+RA+ LY
Sbjct  232  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLERVPGIKHLARAVDLY  291

Query  194  LECK  183
            LE K
Sbjct  292  LEYK  295


 Score = 35.8 bits (81),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ + WAP Q+ 
Sbjct  295  KPPIEDLQYFLDFQIAKGWAPEQNN  319



>ref|XP_002264038.2| PREDICTED: MACPF domain-containing protein CAD1 isoform X2 [Vitis 
vinifera]
Length=577

 Score = 92.4 bits (228),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W++TV+ +PDVI M F PI  LL+ V G +HL+RA+ LY
Sbjct  250  KDVTVIFRRRGGDDLEQSHAKWSETVELAPDVINMKFVPIVSLLDSVPGLKHLARAVDLY  309

Query  194  LECK  183
            LE K
Sbjct  310  LEYK  313


 Score = 38.1 bits (87),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+ R+WAP
Sbjct  313  KPPIEDLQYFLEFQIARVWAP  333



>ref|XP_011009673.1| PREDICTED: MACPF domain-containing protein CAD1-like [Populus 
euphratica]
Length=557

 Score = 94.7 bits (234),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  WA+TV+ +PDVI M+F PI  LLE V G +HL+RA+ LY
Sbjct  232  KDVTVIFRRRGGDDLEQSHAKWAETVQLAPDVINMTFTPIVSLLERVPGIKHLARAVDLY  291

Query  194  LECK  183
            LE K
Sbjct  292  LEYK  295


 Score = 35.8 bits (81),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDR  4
            KP +E+L+YFL+FQ+ + WAP Q+ 
Sbjct  295  KPPIEDLQYFLDFQIAKGWAPEQNN  319



>ref|XP_010655591.1| PREDICTED: MACPF domain-containing protein CAD1 isoform X1 [Vitis 
vinifera]
Length=472

 Score = 92.0 bits (227),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQSH  W++TV+ +PDVI M F PI  LL+ V G +HL+RA+ LY
Sbjct  145  KDVTVIFRRRGGDDLEQSHAKWSETVELAPDVINMKFVPIVSLLDSVPGLKHLARAVDLY  204

Query  194  LECK  183
            LE K
Sbjct  205  LEYK  208


 Score = 37.7 bits (86),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+ R+WAP
Sbjct  208  KPPIEDLQYFLEFQIARVWAP  228



>gb|KHN43736.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=500

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            ++DVTVIFRRRGGDDLEQ+H  W  T++SSPD+IEM+F PIT LL+ V  KEHL+RAISL
Sbjct  175  LEDVTVIFRRRGGDDLEQNHSKWISTIQSSPDIIEMTFCPITDLLDEVPAKEHLTRAISL  234

Query  197  YLECKDIVTQ  168
            YLE K  + +
Sbjct  235  YLEYKPPIEE  244


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+P +WAPLQDR
Sbjct  232  ISLYLEYKPPIEELRYFLEFQIPCVWAPLQDR  263



>ref|XP_009406153.1| PREDICTED: MACPF domain-containing protein CAD1-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score = 89.7 bits (221),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  T+ S+PDVI M+F PI  LL G+ G ++LSRA+ LY
Sbjct  251  KDVTVIFRRRGGDDLVQNHAEWVHTISSAPDVINMTFLPIVSLLNGLPGIQNLSRAVDLY  310

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  311  LEYKPPIEE  319


 Score = 39.3 bits (90),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQV R+WAP
Sbjct  314  KPPIEELQYFLEFQVQRVWAP  334



>ref|XP_010273468.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Nelumbo nucifera]
Length=591

 Score = 89.4 bits (220),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  W +TV  +PDVI M+F PI  LL  + GK+HL+RAI LY
Sbjct  260  EDVTVIFRRRGGDDLVQSHAKWVETVNLAPDVISMTFSPIVSLLGELPGKKHLARAIDLY  319

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  320  LEYKPPIEE  328


 Score = 38.1 bits (87),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQ+ R+W+P
Sbjct  323  KPPIEELQYFLEFQIARVWSP  343



>ref|XP_010916394.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Elaeis guineensis]
Length=463

 Score = 88.2 bits (217),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  TV S+PDVI M+F PI  LL G+ G ++L+ ++ LY
Sbjct  145  KDVTVIFRRRGGDDLVQNHAEWKNTVPSAPDVINMTFLPIVFLLNGLPGLQYLAHSVDLY  204

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  205  LEYKPPVEE  213


 Score = 39.7 bits (91),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELRYFLEFQ+ R+WAP+
Sbjct  208  KPPVEELRYFLEFQMQRVWAPV  229



>ref|XP_010924700.1| PREDICTED: MACPF domain-containing protein CAD1-like [Elaeis 
guineensis]
Length=597

 Score = 89.7 bits (221),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  TV S+PDVI M+F PI  LL G+ G ++L+RAI LY
Sbjct  278  EDVTVIFRRRGGDDLVQNHDEWKNTVPSAPDVINMTFIPIVSLLNGLPGIQYLARAIDLY  337

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  338  LEYKPPIEE  346


 Score = 37.7 bits (86),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQ+ R+WAP
Sbjct  341  KPPIEELQYFLEFQMQRVWAP  361



>ref|XP_010916387.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Elaeis guineensis]
Length=558

 Score = 87.8 bits (216),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  TV S+PDVI M+F PI  LL G+ G ++L+ ++ LY
Sbjct  240  KDVTVIFRRRGGDDLVQNHAEWKNTVPSAPDVINMTFLPIVFLLNGLPGLQYLAHSVDLY  299

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  300  LEYKPPVEE  308


 Score = 39.7 bits (91),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELRYFLEFQ+ R+WAP+
Sbjct  303  KPPVEELRYFLEFQMQRVWAPV  324



>gb|AAL06838.1| At1g29690/F15D2_24 [Arabidopsis thaliana]
Length=383

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  WA+TV ++PD+I M+F PI  LLEGV G  HL+RAI LY
Sbjct  241  KDITVIFRRRGGDDLEQSHARWAETVPAAPDIINMTFTPIVSLLEGVPGLWHLTRAIELY  300

Query  194  LECK  183
            LE K
Sbjct  301  LEYK  304



>ref|XP_010273469.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X2 [Nelumbo nucifera]
Length=573

 Score = 89.4 bits (220),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  W +TV  +PDVI M+F PI  LL  + GK+HL+RAI LY
Sbjct  242  EDVTVIFRRRGGDDLVQSHAKWVETVNLAPDVISMTFSPIVSLLGELPGKKHLARAIDLY  301

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  302  LEYKPPIEE  310


 Score = 38.1 bits (87),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQ+ R+W+P
Sbjct  305  KPPIEELQYFLEFQIARVWSP  325



>ref|XP_006576450.1| PREDICTED: MACPF domain-containing protein CAD1-like [Glycine 
max]
Length=581

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDLEQ+H  W  T++SSPD+IEM+F PIT LL+ V  KEHL+RAISLY
Sbjct  257  EDVTVIFRRRGGDDLEQNHSKWISTIQSSPDIIEMTFCPITDLLDEVPAKEHLTRAISLY  316

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  317  LEYKPPIEE  325


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQ+P +WAPLQDR
Sbjct  313  ISLYLEYKPPIEELRYFLEFQIPCVWAPLQDR  344



>emb|CAN81643.1| hypothetical protein VITISV_012748 [Vitis vinifera]
Length=470

 Score = 87.4 bits (215),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D  +IFRRRGGDDLEQSH  W++TV+ +PDVI M F PI  LL+ V G +HL+RA+ LY
Sbjct  143  KDKAIIFRRRGGDDLEQSHAKWSETVELAPDVINMKFVPIVSLLDSVPGLKHLARAVDLY  202

Query  194  LECK  183
            LE K
Sbjct  203  LEYK  206


 Score = 37.7 bits (86),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+ R+WAP
Sbjct  206  KPPIEDLQYFLEFQIARVWAP  226



>ref|XP_009416434.1| PREDICTED: MACPF domain-containing protein CAD1-like [Musa acuminata 
subsp. malaccensis]
Length=561

 Score = 87.0 bits (214),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  T+ S+PD+I ++F PI  LL G+ G ++LSRA+ LY
Sbjct  244  KDVTVIFRRRGGDDLVQNHADWVHTILSAPDIINITFLPIVSLLNGLPGIQNLSRAVDLY  303

Query  194  LECKDIVTQ  168
            LE K  V +
Sbjct  304  LEYKPPVEE  312


 Score = 38.1 bits (87),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+FQV R+WAP
Sbjct  307  KPPVEELQYFLDFQVQRVWAP  327



>ref|XP_010272721.1| PREDICTED: MACPF domain-containing protein CAD1-like [Nelumbo 
nucifera]
Length=589

 Score = 85.1 bits (209),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL QSH  W +TV  +PDVI M+F P+  LL  + G +HL+RAI LY
Sbjct  259  EDVTVIFRRRGGDDLVQSHAKWLETVNLAPDVISMTFSPLVSLLGEMPGIKHLARAIDLY  318

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  319  LEYKPPIEE  327


 Score = 39.3 bits (90),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFLEFQ+ R+WAP
Sbjct  322  KPPIEELQYFLEFQIARVWAP  342



>ref|XP_010683518.1| PREDICTED: MACPF domain-containing protein CAD1-like [Beta vulgaris 
subsp. vulgaris]
Length=580

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGGDDLEQSH  W++TV+SSPDVI+MSF P+T L++    KE+LSRAISLY
Sbjct  255  EDITVIFRRRGGDDLEQSHKQWSRTVQSSPDVIDMSFVPVTDLIKDSARKEYLSRAISLY  314

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  315  LEYKPPIEE  323


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -3

Query  96   ISLFAD-KPQLEELRYFLEFQVPRIWAPLQDR  4
            ISL+ + KP +EELRYFLEFQVPR+WAPL DR
Sbjct  311  ISLYLEYKPPIEELRYFLEFQVPRVWAPLNDR  342



>emb|CDM83977.1| unnamed protein product [Triticum aestivum]
Length=552

 Score = 82.4 bits (202),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+ V W KTV S+PDVI M+F PI  L++ + GK+H++RAI LY
Sbjct  237  KDMTVIFRRRGGCDLVQNSVEWIKTVSSAPDVIGMTFLPIVSLVDDIPGKKHIARAIDLY  296

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  297  LTYKPPIEE  305


 Score = 38.5 bits (88),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+YFL+FQVP +WAP+
Sbjct  300  KPPIEELQYFLDFQVPLVWAPV  321



>gb|EEC71475.1| hypothetical protein OsI_03732 [Oryza sativa Indica Group]
Length=1182

 Score = 80.5 bits (197),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+   W KTV+S+PDVI M+F PI  L+  + GK+HL+RAI LY
Sbjct  237  KDMTVIFRRRGGCDLVQNFNDWIKTVQSAPDVIGMTFLPIVSLVGDMPGKKHLARAIELY  296

Query  194  LECK  183
            L+ K
Sbjct  297  LKYK  300


 Score = 40.4 bits (93),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KPQ+EEL+YFL+FQV  +WAP+
Sbjct  300  KPQIEELQYFLDFQVQLVWAPV  321



>gb|EMS67830.1| hypothetical protein TRIUR3_11035 [Triticum urartu]
Length=460

 Score = 82.4 bits (202),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+ V W KTV S+PDVI M+F PI  L++ + GK+H++RAI LY
Sbjct  145  KDMTVIFRRRGGCDLVQNSVEWIKTVSSAPDVIGMTFLPIVSLVDDIPGKKHIARAIDLY  204

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  205  LTYKPPIEE  213


 Score = 38.5 bits (88),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+YFL+FQVP +WAP+
Sbjct  208  KPPIEELQYFLDFQVPLVWAPV  229



>ref|XP_006646321.1| PREDICTED: MACPF domain-containing protein CAD1-like [Oryza brachyantha]
Length=536

 Score = 79.3 bits (194),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+   W KT+ S+PDVI M+F PI  L+  + GK+HL+RAI LY
Sbjct  220  KDMTVIFRRRGGCDLVQNFFDWIKTISSAPDVIAMTFLPIVSLVGDMPGKKHLARAIELY  279

Query  194  LECK  183
            L  K
Sbjct  280  LAYK  283


 Score = 42.0 bits (97),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  87   FADKPQLEELRYFLEFQVPRIWAPL  13
             A KPQ+EEL+YFL+FQVP +WAP+
Sbjct  280  LAYKPQIEELQYFLDFQVPLVWAPI  304



>gb|EMT19988.1| hypothetical protein F775_07281 [Aegilops tauschii]
Length=460

 Score = 82.4 bits (202),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+ V W KTV S+PDVI M+F PI  L++ + GK+H++RAI LY
Sbjct  145  KDMTVIFRRRGGCDLVQNSVEWIKTVSSAPDVIGMTFLPIVSLVDDIPGKKHIARAIDLY  204

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  205  LTYKPPIEE  213


 Score = 38.5 bits (88),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+YFL+FQVP +WAP+
Sbjct  208  KPPIEELQYFLDFQVPLVWAPV  229



>gb|EEE55380.1| hypothetical protein OsJ_03453 [Oryza sativa Japonica Group]
Length=1264

 Score = 80.5 bits (197),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+   W KTV+S+PDVI M+F PI  L+  + GK+HL+RAI LY
Sbjct  319  KDMTVIFRRRGGCDLVQNFNDWIKTVQSAPDVIGMTFLPIVSLVGDMPGKKHLARAIELY  378

Query  194  LECK  183
            L+ K
Sbjct  379  LKYK  382


 Score = 40.0 bits (92),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KPQ+EEL+YFL+FQV  +WAP+
Sbjct  382  KPQIEELQYFLDFQVQLVWAPV  403



>ref|XP_003569808.1| PREDICTED: MACPF domain-containing protein CAD1 [Brachypodium 
distachyon]
Length=552

 Score = 79.7 bits (195),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W +TV S+PDVI M+F PI  L++ + GK+H++RAI LY
Sbjct  237  KDMTVIFRRRGGCDLVQSSADWIRTVSSAPDVIGMTFLPIVSLVDDMPGKKHIARAIDLY  296

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  297  LTYKPPIEE  305


 Score = 38.9 bits (89),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+YFL+FQVP +WAP+
Sbjct  300  KPPIEELQYFLDFQVPLVWAPV  321



>dbj|BAJ95066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=552

 Score = 79.7 bits (195),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+   W KTV S+PDVI M+F PI  L++ + GK+H++RAI LY
Sbjct  237  KDMTVIFRRRGGCDLVQNSGEWIKTVSSAPDVIGMTFLPIVSLVDDIPGKKHIARAIDLY  296

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  297  LTYKPPIEE  305


 Score = 38.5 bits (88),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+YFL+FQVP +WAP+
Sbjct  300  KPPIEELQYFLDFQVPLVWAPV  321



>ref|NP_001044243.1| Os01g0748900 [Oryza sativa Japonica Group]
 dbj|BAB56041.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06157.1| Os01g0748900 [Oryza sativa Japonica Group]
 dbj|BAG92765.1| unnamed protein product [Oryza sativa Japonica Group]
Length=553

 Score = 79.3 bits (194),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL Q+   W KTV+S+PDVI M+F PI  L+  + GK+HL+RAI LY
Sbjct  237  KDMTVIFRRRGGCDLVQNFNDWIKTVQSAPDVIGMTFLPIVSLVGDMPGKKHLARAIELY  296

Query  194  LECK  183
            L+ K
Sbjct  297  LKYK  300


 Score = 37.7 bits (86),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KPQ+EEL+YFL+FQV  +WAP+
Sbjct  300  KPQIEELQYFLDFQVQLVWAPV  321



>gb|KHN29513.1| MACPF domain-containing protein CAD1 [Glycine soja]
Length=380

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV VIFRRRGGDDLEQ H  W +TV SSPDVI+M+F PIT L++ V GKEHL+  I LY
Sbjct  105  KDVRVIFRRRGGDDLEQDHSMWLRTVCSSPDVIQMTFCPITDLIDEVPGKEHLAHIIGLY  164

Query  194  LECKDIVTQ  168
            LE K  + +
Sbjct  165  LEYKPPIEE  173



>ref|XP_008673088.1| PREDICTED: uncharacterized protein LOC100381712 isoform X2 [Zea 
mays]
Length=360

 Score = 77.0 bits (188),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI M+F  I  L++ V GK+HL+RA+ LY
Sbjct  241  KDITVIFRRRGGCDLVQSFSDWKGTVASAPDVIGMTFLSIVSLVDDVPGKKHLARAVELY  300

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  301  LTYKPPIEE  309


 Score = 38.1 bits (87),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+FQVP +WAP
Sbjct  304  KPPIEELQYFLDFQVPLVWAP  324



>ref|XP_002963443.1| hypothetical protein SELMODRAFT_80474 [Selaginella moellendorffii]
 gb|EFJ35314.1| hypothetical protein SELMODRAFT_80474 [Selaginella moellendorffii]
Length=558

 Score = 77.8 bits (190),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV +IFRRRGG +L +SH  W KTV  +PDVI M+F PIT LL GV G   LS A++LY
Sbjct  232  KDVEIIFRRRGGSNLLKSHNEWLKTVADAPDVISMTFVPITSLLNGVLGSGFLSHAVNLY  291

Query  194  LECKDIV  174
            L  K  +
Sbjct  292  LRHKPPI  298


 Score = 37.4 bits (85),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+PR W+P
Sbjct  295  KPPIEDLQYFLEFQIPRQWSP  315



>ref|XP_002971577.1| hypothetical protein SELMODRAFT_95546 [Selaginella moellendorffii]
 gb|EFJ27326.1| hypothetical protein SELMODRAFT_95546 [Selaginella moellendorffii]
Length=558

 Score = 77.8 bits (190),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV +IFRRRGG +L +SH  W KTV  +PDVI M+F PIT LL GV G   LS A++LY
Sbjct  232  KDVEIIFRRRGGSNLLKSHNEWLKTVADAPDVISMTFVPITSLLNGVLGSGFLSHAVNLY  291

Query  194  LECKDIV  174
            L  K  +
Sbjct  292  LRHKPPI  298


 Score = 37.4 bits (85),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +E+L+YFLEFQ+PR W+P
Sbjct  295  KPPIEDLQYFLEFQIPRQWSP  315



>ref|XP_008673087.1| PREDICTED: uncharacterized protein LOC100381712 isoform X1 [Zea 
mays]
 tpg|DAA57642.1| TPA: hypothetical protein ZEAMMB73_628614 [Zea mays]
Length=557

 Score = 76.6 bits (187),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI M+F  I  L++ V GK+HL+RA+ LY
Sbjct  241  KDITVIFRRRGGCDLVQSFSDWKGTVASAPDVIGMTFLSIVSLVDDVPGKKHLARAVELY  300

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  301  LTYKPPIEE  309


 Score = 38.1 bits (87),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+FQVP +WAP
Sbjct  304  KPPIEELQYFLDFQVPLVWAP  324



>gb|ABF70092.1| hypothetical protein MBP_81C12.22 [Musa balbisiana]
Length=447

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  T+ S+PDVI M+F PI  LL G+ G ++LSRA+ LY
Sbjct  145  KDVTVIFRRRGGDDLVQNHAEWVHTISSAPDVINMTFLPIVSLLNGLPGIQNLSRAVDLY  204

Query  194  LE  189
            LE
Sbjct  205  LE  206



>ref|XP_004969946.1| PREDICTED: MACPF domain-containing protein CAD1-like [Setaria 
italica]
Length=558

 Score = 75.5 bits (184),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI M+F  I  L++ V GK+HL+RA+ LY
Sbjct  242  KDMTVIFRRRGGCDLVQSFSDWKGTVASAPDVIGMTFRSIVSLVDDVPGKKHLARAVELY  301

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  302  LTYKPPIEE  310


 Score = 38.1 bits (87),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+FQVP +WAP
Sbjct  305  KPPIEELQYFLDFQVPLVWAP  325



>gb|ABF72020.1| hypothetical protein MA4_82I11.22 [Musa acuminata]
Length=447

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DVTVIFRRRGGDDL Q+H  W  T+ S+PDVI M+F PI  LL G  G ++LSRA+ LY
Sbjct  145  KDVTVIFRRRGGDDLVQNHAEWVHTISSAPDVINMTFLPIVSLLNGQPGIQNLSRAVDLY  204

Query  194  LECKDIVTQKSV  159
            LE + +     V
Sbjct  205  LELQRVWAPAPV  216



>ref|XP_002456355.1| hypothetical protein SORBIDRAFT_03g034590 [Sorghum bicolor]
 gb|EES01475.1| hypothetical protein SORBIDRAFT_03g034590 [Sorghum bicolor]
Length=557

 Score = 75.5 bits (184),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI M+F  I  L++ + GK+HL+RA+ LY
Sbjct  241  KDMTVIFRRRGGCDLVQSFSDWKGTVASAPDVIGMTFLSIVSLVDDIPGKKHLARAVELY  300

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  301  LTYKPPIEE  309


 Score = 38.1 bits (87),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+FQVP +WAP
Sbjct  304  KPPIEELQYFLDFQVPLVWAP  324



>ref|XP_004156931.1| PREDICTED: MACPF domain-containing protein NSL1-like [Cucumis 
sativus]
Length=607

 Score = 73.2 bits (178),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            ++T I+ RRGG D+ QSH  W  T+  SP+VI MSF PIT L+ GV+G   LS A++LYL
Sbjct  262  ELTAIYIRRGGVDVGQSHNQWLSTISQSPNVISMSFVPITSLMNGVRGNGFLSHAVNLYL  321

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  322  RYKPPIEE  329


 Score = 40.0 bits (92),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLEFQ+PR WAP+
Sbjct  324  KPPIEELQQFLEFQLPRQWAPV  345



>ref|XP_006602710.1| PREDICTED: MACPF domain-containing protein CAD1-like isoform 
X1 [Glycine max]
Length=573

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +DV VIFRRRGGDDLEQ H  W +TV SSPDVI+M+F PIT L++ V GKE L+ AI LY
Sbjct  257  KDVRVIFRRRGGDDLEQDHSMWLRTVWSSPDVIQMTFCPITDLIDEVPGKEQLTHAIGLY  316

Query  194  LE  189
            LE
Sbjct  317  LE  318



>ref|XP_002263223.2| PREDICTED: MACPF domain-containing protein At4g24290 isoform 
X2 [Vitis vinifera]
Length=613

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            D+  I +RRGG D +  SH  W +TV+S+PDVI MSF PIT LL GV+G   LS AI+LY
Sbjct  268  DIVSICKRRGGSDNKNLSHNEWLQTVQSAPDVISMSFIPITSLLNGVQGSGFLSHAINLY  327

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  328  LRYKPPIEE  336


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELR FLEFQ+PR WAP+
Sbjct  331  KPPIEELRQFLEFQLPRQWAPV  352



>emb|CBI29699.3| unnamed protein product [Vitis vinifera]
Length=603

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            D+  I +RRGG D +  SH  W +TV+S+PDVI MSF PIT LL GV+G   LS AI+LY
Sbjct  258  DIVSICKRRGGSDNKNLSHNEWLQTVQSAPDVISMSFIPITSLLNGVQGSGFLSHAINLY  317

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  318  LRYKPPIEE  326


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELR FLEFQ+PR WAP+
Sbjct  321  KPPIEELRQFLEFQLPRQWAPV  342



>ref|XP_004146657.1| PREDICTED: MACPF domain-containing protein NSL1-like [Cucumis 
sativus]
 gb|KGN64702.1| hypothetical protein Csa_1G075560 [Cucumis sativus]
Length=610

 Score = 72.0 bits (175),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            ++T I+ RRGG D+ QSH  W  T+  SP+VI MSF PIT L+ GV+G   LS A++LYL
Sbjct  265  ELTAIYIRRGGVDVGQSHNQWLSTISQSPNVISMSFVPITSLMNGVRGNGFLSHAVNLYL  324

Query  191  ECK  183
              K
Sbjct  325  RYK  327


 Score = 40.0 bits (92),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLEFQ+PR WAP+
Sbjct  327  KPPIEELQQFLEFQLPRQWAPV  348



>ref|XP_010657979.1| PREDICTED: MACPF domain-containing protein At4g24290 isoform 
X1 [Vitis vinifera]
Length=616

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            D+  I +RRGG D +  SH  W +TV+S+PDVI MSF PIT LL GV+G   LS AI+LY
Sbjct  271  DIVSICKRRGGSDNKNLSHNEWLQTVQSAPDVISMSFIPITSLLNGVQGSGFLSHAINLY  330

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  331  LRYKPPIEE  339


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELR FLEFQ+PR WAP+
Sbjct  334  KPPIEELRQFLEFQLPRQWAPV  355



>ref|XP_003592917.1| hypothetical protein MTR_2g005730 [Medicago truncatula]
Length=626

 Score = 70.5 bits (171),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+    +RRGG DD   SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  259  EDIVSFCKRRGGSDDKNLSHNQWLQTVQLEPDVISMSFIPITSLLNGVPGSGFLSHAINL  318

Query  197  YLEC  186
            YL C
Sbjct  319  YLRC  322


 Score = 41.2 bits (95),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -3

Query  90   LFADKPQLEELRYFLEFQVPRIWAPL  13
            +  DKP +EEL  FLEFQ+PR WAP+
Sbjct  335  ILTDKPPIEELHQFLEFQLPRQWAPV  360



>gb|KDP21000.1| hypothetical protein JCGZ_21471 [Jatropha curcas]
Length=600

 Score = 71.2 bits (173),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+  I  RRGG D+ QSH  W  T+  SP+VI MSF PIT LL GV+G   LS A++LY
Sbjct  255  EDILSISIRRGGVDIGQSHNQWLSTISQSPNVISMSFVPITSLLSGVRGSGFLSHAVNLY  314

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  315  LRYKPPIEE  323


 Score = 40.0 bits (92),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQVPR WAP+
Sbjct  318  KPPIEELHQFLEFQVPRQWAPV  339



>ref|XP_008649986.1| PREDICTED: MACPF domain-containing protein NSL1-like isoform 
X1 [Zea mays]
Length=630

 Score = 67.8 bits (164),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            QD+  I  RRGG D  Q H  W  T+   PDVI MSF PIT LL GV+G   L+ A++LY
Sbjct  279  QDMVCIHVRRGGVDSGQGHGKWLSTITGFPDVISMSFVPITSLLTGVRGSGFLNHAVNLY  338

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  339  LRYKPAIEE  347


 Score = 43.1 bits (100),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR+WAP
Sbjct  342  KPAIEELQQFLEFQVPRLWAP  362



>ref|XP_007041214.1| MAC/Perforin domain-containing protein [Theobroma cacao]
 gb|EOX97045.1| MAC/Perforin domain-containing protein [Theobroma cacao]
Length=603

 Score = 72.0 bits (175),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIISIYKRRGGSDNRNLSHNDWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_010087924.1| hypothetical protein L484_001374 [Morus notabilis]
 gb|EXB30759.1| hypothetical protein L484_001374 [Morus notabilis]
Length=604

 Score = 71.6 bits (174),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  258  EDIVTICKRRGGSDVRNLSHHEWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  317

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  318  YLRYKPPIEE  327


 Score = 38.9 bits (89),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  322  KPPIEELHQFLEFQLPRQWAPV  343



>gb|KHG20066.1| MACPF domain-containing NSL1 -like protein [Gossypium arboreum]
Length=607

 Score = 67.8 bits (164),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
             D+  ++ RRGG D  QSH  W  T+  SP+VI M F PIT LL G +G   LS A++LY
Sbjct  260  NDIVNVYIRRGGVDYGQSHSQWLSTISQSPNVISMKFVPITSLLGGSRGNGFLSHAVNLY  319

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  320  LRYKPPIEE  328


 Score = 42.0 bits (97),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELR FLEFQVPR WAP+
Sbjct  323  KPPIEELREFLEFQVPRQWAPV  344



>gb|ACN33627.1| unknown [Zea mays]
 gb|AFW85102.1| MAC/Perforin domain containing protein [Zea mays]
Length=558

 Score = 73.6 bits (179),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI ++F  I  L++ + GK+HL+RA+ LY
Sbjct  242  KDMTVIFRRRGGCDLVQSFSDWRGTVASAPDVIGITFLSIVSLVDDIPGKKHLARAVELY  301

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  302  LTYKPPIEE  310


 Score = 36.2 bits (82),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+F+VP +WAP
Sbjct  305  KPPIEELQYFLDFRVPLVWAP  325



>ref|NP_001149965.1| MAC/Perforin domain containing protein [Zea mays]
 gb|ACG37359.1| MAC/Perforin domain containing protein [Zea mays]
Length=558

 Score = 73.6 bits (179),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+TVIFRRRGG DL QS   W  TV S+PDVI ++F  I  L++ + GK+HL+RA+ LY
Sbjct  242  KDMTVIFRRRGGCDLVQSFSDWRGTVASAPDVIGITFLSIVSLVDDIPGKKHLARAVELY  301

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  302  LTYKPPIEE  310


 Score = 36.2 bits (82),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+YFL+F+VP +WAP
Sbjct  305  KPPIEELQYFLDFRVPLVWAP  325



>ref|XP_010912654.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X2 [Elaeis guineensis]
Length=515

 Score = 73.9 bits (180),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IF+RRGG D+ + SH  W  TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  172  EDIVKIFKRRGGKDNKDLSHNEWLNTVQSEPDVISMSFLPITSLLNGVPGSGFLSHAINL  231

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  232  YLRYKPPIEE  241


 Score = 35.4 bits (80),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  236  KPPIEELHQFLEFQLPRQWAPV  257



>ref|XP_010243889.1| PREDICTED: MACPF domain-containing protein At4g24290 [Nelumbo 
nucifera]
 ref|XP_010243890.1| PREDICTED: MACPF domain-containing protein At4g24290 [Nelumbo 
nucifera]
 ref|XP_010243891.1| PREDICTED: MACPF domain-containing protein At4g24290 [Nelumbo 
nucifera]
Length=600

 Score = 73.2 bits (178),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+T I++RRGG DD+  SH  W  TV+  PDVI MSF PIT LL GV G   LS A++L
Sbjct  258  EDITFIYKRRGGTDDIALSHNLWLNTVQQHPDVISMSFIPITSLLNGVPGSGFLSHAVNL  317

Query  197  YLECK  183
            YL  K
Sbjct  318  YLRYK  322


 Score = 35.8 bits (81),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  322  KPHIEELHQFLEFQLPRPWAPV  343



>ref|XP_010681765.1| PREDICTED: MACPF domain-containing protein At4g24290 [Beta vulgaris 
subsp. vulgaris]
Length=600

 Score = 73.2 bits (178),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+T I +RRGG D    H  W +TV+  PDVI MSF PIT LL GV G   LS AI+LY
Sbjct  257  EDITTICKRRGGSDKRSPHYEWLQTVQIEPDVISMSFIPITSLLNGVPGSGFLSHAINLY  316

Query  194  LECK  183
            L  K
Sbjct  317  LRYK  320


 Score = 36.2 bits (82),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP LEEL  FLEFQ+PR WAP+
Sbjct  320  KPPLEELHQFLEFQLPRQWAPV  341



>ref|XP_010912652.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010912653.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Elaeis guineensis]
Length=600

 Score = 73.9 bits (180),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IF+RRGG D+ + SH  W  TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIVKIFKRRGGKDNKDLSHNEWLNTVQSEPDVISMSFLPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.4 bits (80),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_011027785.1| PREDICTED: MACPF domain-containing protein NSL1 [Populus euphratica]
Length=605

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +T I  RRGG D+ QSH  W  T+  SP+VI MSF PIT LL G++G   LS A++LYL 
Sbjct  260  ITSICIRRGGVDVGQSHNQWLSTISQSPNVISMSFVPITSLLSGIRGNGFLSHAVNLYLR  319

Query  188  CKDIVTQ  168
             K  + +
Sbjct  320  YKPPIEE  326


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPI  342



>ref|XP_007041213.1| MAC/Perforin domain-containing protein [Theobroma cacao]
 gb|EOX97044.1| MAC/Perforin domain-containing protein [Theobroma cacao]
Length=601

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS  I+L
Sbjct  253  EDILSIYKRRGGSDNRNLSHNDWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHVINL  312

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  313  YLRYKPPIEE  322


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  317  KPPIEELHQFLEFQLPRQWAPV  338



>ref|XP_008649987.1| PREDICTED: MACPF domain-containing protein NSL1-like isoform 
X2 [Zea mays]
 gb|AFW79108.1| hypothetical protein ZEAMMB73_446527 [Zea mays]
Length=623

 Score = 65.5 bits (158),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  T+   PDVI MSF PIT LL GV+G   L+ A++LYL
Sbjct  273  DMVCIHVRRGGVDSGQGHGKWLSTITGFPDVISMSFVPITSLLTGVRGSGFLNHAVNLYL  332

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  333  RYKPAIEE  340


 Score = 43.1 bits (100),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR+WAP
Sbjct  335  KPAIEELQQFLEFQVPRLWAP  355



>ref|XP_008795255.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795256.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795257.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795258.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795259.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795260.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795261.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
 ref|XP_008795262.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Phoenix 
dactylifera]
Length=601

 Score = 73.6 bits (179),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IFRRRGG D+ + SH  W  TV+S PDV+ MSF PIT LL G+ G   LS AI+L
Sbjct  257  EDIMKIFRRRGGKDNKDLSHNEWLNTVQSEPDVVSMSFLPITSLLTGIPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.4 bits (80),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_010057373.1| PREDICTED: MACPF domain-containing protein NSL1 [Eucalyptus grandis]
 gb|KCW74540.1| hypothetical protein EUGRSUZ_E03252 [Eucalyptus grandis]
Length=607

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+  I  R+GG D+ QSH HW  T+  SP+VI MSF PIT LL GV+G   L  A++LY
Sbjct  258  KDLESIPVRKGGIDVGQSHNHWLSTISRSPNVISMSFVPITSLLSGVRGNGFLGHAVNLY  317

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  318  LRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_002305779.2| hypothetical protein POPTR_0004s04730g [Populus trichocarpa]
 gb|EEE86290.2| hypothetical protein POPTR_0004s04730g [Populus trichocarpa]
Length=605

 Score = 69.7 bits (169),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +T I  RRGG D+ QSH  W  T+  SP+VI MSF PIT LL G++G   LS A++LYL 
Sbjct  260  ITSICIRRGGVDVGQSHNQWLSTISQSPNVISMSFVPITSLLSGIRGSGFLSHAVNLYLR  319

Query  188  CKDIVTQ  168
             K  + +
Sbjct  320  YKPPIEE  326


 Score = 38.9 bits (89),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPI  342



>ref|XP_002526447.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35942.1| conserved hypothetical protein [Ricinus communis]
Length=603

 Score = 69.7 bits (169),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG DD   SH  W  TV+  PDVI MSF PIT LL G+ G   LS AI+L
Sbjct  257  EDIVRIYKRRGGNDDKRLSHSEWLYTVQFEPDVISMSFIPITSLLNGIPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>gb|KHN39672.1| MACPF domain-containing protein [Glycine soja]
Length=604

 Score = 70.1 bits (170),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG +D   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIVSICKRRGGREDRNISHNEWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.1 bits (87),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_003548336.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Glycine max]
 ref|XP_006598796.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X2 [Glycine max]
 ref|XP_006598797.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X3 [Glycine max]
Length=604

 Score = 70.1 bits (170),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG +D   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIVSICKRRGGREDRNISHNEWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.1 bits (87),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_002441497.1| hypothetical protein SORBIDRAFT_09g028080 [Sorghum bicolor]
 gb|EES19927.1| hypothetical protein SORBIDRAFT_09g028080 [Sorghum bicolor]
Length=622

 Score = 65.1 bits (157),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  T+   PDVI MSF PIT LL GV+G   L+ A++LYL
Sbjct  273  DMVCIHIRRGGVDSGQCHSKWLSTITGFPDVISMSFVPITSLLTGVRGSGFLNHAVNLYL  332

Query  191  ECK  183
              K
Sbjct  333  RYK  335


 Score = 43.1 bits (100),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR+WAP
Sbjct  335  KPPIEELQQFLEFQVPRLWAP  355



>ref|XP_008801493.1| PREDICTED: MACPF domain-containing protein NSL1 [Phoenix dactylifera]
Length=610

 Score = 66.6 bits (161),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG + + SH  W  T+  SP VI MSF PIT LL GV+G   LS A++LYL
Sbjct  268  DIVSIHVRRGGSNTKHSHNQWLSTIPQSPSVISMSFVPITSLLGGVRGSGFLSHAVNLYL  327

Query  191  ECK  183
              K
Sbjct  328  RYK  330


 Score = 41.2 bits (95),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP LEELR FLEFQ+PR WAP
Sbjct  330  KPPLEELRQFLEFQLPRQWAP  350



>ref|XP_004293800.1| PREDICTED: MACPF domain-containing protein NSL1 [Fragaria vesca 
subsp. vesca]
Length=606

 Score = 68.6 bits (166),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D+ QSH  W  T+  +P+VI MSF PIT LL G++G   LS A++LYL
Sbjct  262  DIVTISVRRGGVDVGQSHNQWLSTISQAPNVISMSFVPITSLLGGIQGNGFLSHAVNLYL  321

Query  191  ECK  183
              K
Sbjct  322  RYK  324


 Score = 39.3 bits (90),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLEFQ+PR WAP+
Sbjct  324  KPPIEELQQFLEFQLPRQWAPV  345



>ref|XP_007158662.1| hypothetical protein PHAVU_002G172000g [Phaseolus vulgaris]
 gb|ESW30656.1| hypothetical protein PHAVU_002G172000g [Phaseolus vulgaris]
Length=609

 Score = 65.9 bits (159),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +T+I  +RGGD  + SH +W +TV S+PD I   F PI+ LL G+ G  +LS AI+LYL 
Sbjct  260  LTIICSKRGGDMFKHSHSNWLQTVPSNPDAILFKFVPISSLLTGIPGSGYLSHAINLYLR  319

Query  188  CK  183
             K
Sbjct  320  YK  321


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP L++L+YFLEFQ+PR WAP+
Sbjct  321  KPSLDDLQYFLEFQIPRQWAPM  342



>gb|KJB16207.1| hypothetical protein B456_002G217400 [Gossypium raimondii]
Length=603

 Score = 72.4 bits (176),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIISIYKRRGGSDNRNLSHNDWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  V +
Sbjct  317  YLRYKPPVEE  326


 Score = 35.4 bits (80),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPVEELHQFLEFQLPRQWAPV  342



>gb|AFW79106.1| hypothetical protein ZEAMMB73_446527 [Zea mays]
Length=435

 Score = 68.2 bits (165),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            QD+  I  RRGG D  Q H  W  T+   PDVI MSF PIT LL GV+G   L+ A++LY
Sbjct  84   QDMVCIHVRRGGVDSGQGHGKWLSTITGFPDVISMSFVPITSLLTGVRGSGFLNHAVNLY  143

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  144  LRYKPAIEE  152


 Score = 39.7 bits (91),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR+WAP
Sbjct  147  KPAIEELQQFLEFQVPRLWAP  167



>ref|XP_007148565.1| hypothetical protein PHAVU_006G219200g [Phaseolus vulgaris]
 gb|ESW20559.1| hypothetical protein PHAVU_006G219200g [Phaseolus vulgaris]
Length=602

 Score = 70.9 bits (172),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG DD   SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  255  EDIVSICKRRGGSDDRNLSHNEWLQTVQCEPDVISMSFIPITSLLNGVPGSGFLSHAINL  314

Query  197  YLECKDIVTQ  168
            YL  K  V +
Sbjct  315  YLRYKPPVQE  324


 Score = 37.0 bits (84),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP ++EL  FLEFQ+PR WAP+
Sbjct  319  KPPVQELHQFLEFQLPRQWAPV  340



>ref|XP_009612090.1| PREDICTED: MACPF domain-containing protein NSL1 [Nicotiana tomentosiformis]
Length=613

 Score = 69.3 bits (168),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QSH  W  TV  SP+VI MSF PI  LL GV+G   LS AI+LYL
Sbjct  268  DLLSIHIRRGGLDFGQSHSQWLPTVSQSPNVISMSFVPIASLLSGVRGSGFLSHAINLYL  327

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  328  RYKPPIEE  335


 Score = 38.1 bits (87),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  330  KPPIEELEQFLEFQLPRQWAP  350



>gb|KEH18767.1| MAC/perforin domain protein [Medicago truncatula]
Length=127

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -1

Query  350  RRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLECKDIVT  171
            RRGGDDLEQSH+ W +TVK +PD+I M F PI  LLEGV G + L RAI LYL+   I +
Sbjct  55   RRGGDDLEQSHIKWVETVKLAPDIINMKFTPIVSLLEGVHGVKLLERAIDLYLQFDRITS  114

Query  170  QKS  162
              +
Sbjct  115  GNN  117



>ref|XP_003630391.1| hypothetical protein MTR_8g095090 [Medicago truncatula]
 gb|AET04867.1| MACPF domain protein [Medicago truncatula]
Length=599

 Score = 67.8 bits (164),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            +QD+  + +R+GG+  +  SH  W +TV S PDVI MSF PIT LL G+ G  +L+ AI+
Sbjct  252  VQDIKFMCKRKGGNGKQNLSHNEWCQTVLSQPDVISMSFIPITSLLGGINGSGYLTHAIN  311

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  312  LYLRYKPAIEE  322


 Score = 40.0 bits (92),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  317  KPAIEELHQFLEFQLPRQWAPV  338



>dbj|BAJ92777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score = 66.6 bits (161),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            DV  I  RRGG D  Q H  W  TV  SPDVI M+F PIT LL GV G+  L+ A++LYL
Sbjct  265  DVVGIHVRRGGVDDGQGHDEWLTTVAGSPDVISMAFVPITSLLTGVPGRGFLNHAVNLYL  324

Query  191  ECK  183
              K
Sbjct  325  RYK  327


 Score = 40.8 bits (94),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQVPR WAP
Sbjct  327  KPPIEELEQFLEFQVPRQWAP  347



>ref|XP_002273740.2| PREDICTED: MACPF domain-containing protein NSL1 [Vitis vinifera]
 emb|CBI30600.3| unnamed protein product [Vitis vinifera]
Length=612

 Score = 68.9 bits (167),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QSH  W  T+  SP+VI MSF PIT LL GV+G   LS AI+LYL
Sbjct  267  DLLSIQVRRGGIDNGQSHKQWLSTISQSPNVISMSFVPITSLLSGVRGSGFLSHAINLYL  326

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  327  RYKPPIEE  334


 Score = 38.5 bits (88),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  329  KPPIEELHQFLEFQLPRQWAP  349



>gb|KHF99071.1| hypothetical protein F383_17143 [Gossypium arboreum]
Length=603

 Score = 72.0 bits (175),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG+D    SH  W +TV+S PD+I MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIISIYKRRGGNDNRNLSHNDWLQTVQSEPDLISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  V +
Sbjct  317  YLRYKPPVEE  326


 Score = 35.4 bits (80),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPVEELHQFLEFQLPRQWAPV  342



>ref|XP_008225135.1| PREDICTED: MACPF domain-containing protein NSL1 [Prunus mume]
Length=600

 Score = 67.8 bits (164),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  350  RRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLECKDIVT  171
            RRGG D+ QSH  W  TV  SP+VI MSF PIT LL GV+G   LS A++LYL  K  + 
Sbjct  261  RRGGVDVGQSHNKWLSTVSESPNVISMSFVPITSLLGGVQGNGFLSHAVNLYLRYKPPIE  320

Query  170  Q  168
            +
Sbjct  321  E  321


 Score = 39.3 bits (90),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  316  KPPIEELHQFLEFQLPRQWAPV  337



>ref|XP_006655579.1| PREDICTED: MACPF domain-containing protein NSL1-like [Oryza brachyantha]
Length=629

 Score = 66.2 bits (160),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  T+ SSPDVI M+F P+T LL GV+G   L+ A++LYL
Sbjct  277  DIVSIHIRRGGIDNGQGHGKWISTINSSPDVISMAFVPLTSLLTGVRGCGFLNHAVNLYL  336

Query  191  ECK  183
              K
Sbjct  337  RYK  339


 Score = 41.2 bits (95),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR WAP
Sbjct  339  KPPIEELQQFLEFQVPRQWAP  359



>gb|KHG13926.1| hypothetical protein F383_06111 [Gossypium arboreum]
Length=603

 Score = 72.0 bits (175),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDILSIYKRRGGSDNRNLSHNDWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.4 bits (80),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>gb|KJB68646.1| hypothetical protein B456_010G256700 [Gossypium raimondii]
Length=607

 Score = 65.1 bits (157),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +  ++ RRGG D  QSH  W  T+  SP+VI M F PIT LL G +G   LS A++LYL 
Sbjct  262  IVNVYIRRGGVDYGQSHSQWLSTISQSPNVISMKFVPITSLLGGSRGNGFLSHAVNLYLR  321

Query  188  CKDIVTQ  168
             K  + +
Sbjct  322  YKPPIEE  328


 Score = 42.4 bits (98),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EELR FLEFQVPR WAP+
Sbjct  323  KPPIEELREFLEFQVPRQWAPV  344



>ref|XP_004503876.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Cicer 
arietinum]
Length=600

 Score = 67.4 bits (163),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            +QD+  +++R+GG+  +  SH  W +TV S PDVI MSF PIT LL G+ G  +L+ AI+
Sbjct  253  VQDIKFMYKRKGGNGKKYLSHNEWCQTVLSQPDVISMSFIPITSLLGGINGSGYLTHAIN  312

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  313  LYLRYKPAIEE  323


 Score = 40.0 bits (92),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  318  KPAIEELHQFLEFQLPRQWAPV  339



>ref|XP_006449390.1| hypothetical protein CICLE_v10014498mg [Citrus clementina]
 gb|ESR62630.1| hypothetical protein CICLE_v10014498mg [Citrus clementina]
Length=673

 Score = 67.8 bits (164),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
             D+  I  RRGG D+ Q+H  W  TV  SP+VI MSF PIT LL GV+G   L+ A++LY
Sbjct  323  NDMISISSRRGGVDICQTHNRWLSTVSHSPNVISMSFVPITSLLAGVQGNGFLTHAVNLY  382

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  383  LRYKPPIEE  391


 Score = 39.3 bits (90),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  386  KPPIEELHQFLEFQLPRQWAPV  407



>ref|XP_009352871.1| PREDICTED: MACPF domain-containing protein NSL1 [Pyrus x bretschneideri]
Length=605

 Score = 68.9 bits (167),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -1

Query  377  MQD-VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            M D +  +  RRGG D++QSH  W  TV  SP+VI MSF PIT LL GV+G   LS A++
Sbjct  258  MNDGIVTVCVRRGGVDIDQSHNQWLSTVSQSPNVISMSFVPITSLLCGVQGIGFLSHAVN  317

Query  200  LYLECKDIVTQ  168
            LYL  K  V +
Sbjct  318  LYLRYKPPVEE  328


 Score = 38.5 bits (88),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLE+Q+PR WAP+
Sbjct  323  KPPVEELQQFLEYQLPRQWAPV  344



>ref|XP_008347922.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Malus domestica]
Length=610

 Score = 68.2 bits (165),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG D    SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  264  EDIVSICKRRGGSDTRNLSHNEWLQTVQLEPDVITMSFIPITTLLNGVPGSGFLSHAINL  323

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  324  YLRYKPPIEE  333


 Score = 38.9 bits (89),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  328  KPPIEELHQFLEFQLPRQWAPV  349



>ref|XP_008347923.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X2 [Malus domestica]
Length=604

 Score = 68.2 bits (165),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG D    SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  258  EDIVSICKRRGGSDTRNLSHNEWLQTVQLEPDVITMSFIPITTLLNGVPGSGFLSHAINL  317

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  318  YLRYKPPIEE  327


 Score = 38.9 bits (89),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  322  KPPIEELHQFLEFQLPRQWAPV  343



>ref|XP_009410910.1| PREDICTED: MACPF domain-containing protein NSL1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 67.0 bits (162),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG +  QSH  W  T+  SPD++ MSF PIT LL GV G   LS A++LYL
Sbjct  271  DIVSIVVRRGGINNNQSHNKWLATIPQSPDLVTMSFVPITSLLNGVTGSGFLSHAVNLYL  330

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  331  RYKPPIEE  338


 Score = 39.7 bits (91),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL +FLEFQ+PR WAP
Sbjct  333  KPPIEELGHFLEFQIPRQWAP  353



>ref|XP_008218721.1| PREDICTED: MACPF domain-containing protein At4g24290 [Prunus 
mume]
Length=602

 Score = 68.2 bits (165),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG D    SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDIVSICKRRGGSDTRNLSHNEWLQTVQFEPDVIAMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_010917949.1| PREDICTED: MACPF domain-containing protein NSL1 isoform X2 [Elaeis 
guineensis]
Length=606

 Score = 65.5 bits (158),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG +  QSH  W  T+  SP VI MSF PIT LL GV+G   LS A++LYL
Sbjct  264  DIVSIHVRRGGINTNQSHNQWLSTIPESPWVISMSFVPITSLLGGVQGSGFLSHAVNLYL  323

Query  191  ECK  183
              K
Sbjct  324  RYK  326


 Score = 41.2 bits (95),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP LEELR FLEFQ+PR WAP
Sbjct  326  KPPLEELRQFLEFQLPRQWAP  346



>gb|KJB47872.1| hypothetical protein B456_008G045500 [Gossypium raimondii]
Length=603

 Score = 71.2 bits (173),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W +TV+S PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDMISIYKRRGGSDNRNLSHNDWLQTVQSEPDVISMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.4 bits (80),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_010917939.1| PREDICTED: MACPF domain-containing protein NSL1 isoform X1 [Elaeis 
guineensis]
Length=610

 Score = 65.5 bits (158),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG +  QSH  W  T+  SP VI MSF PIT LL GV+G   LS A++LYL
Sbjct  268  DIVSIHVRRGGINTNQSHNQWLSTIPESPWVISMSFVPITSLLGGVQGSGFLSHAVNLYL  327

Query  191  ECK  183
              K
Sbjct  328  RYK  330


 Score = 41.2 bits (95),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP LEELR FLEFQ+PR WAP
Sbjct  330  KPPLEELRQFLEFQLPRQWAP  350



>emb|CAN74094.1| hypothetical protein VITISV_023707 [Vitis vinifera]
Length=843

 Score = 68.6 bits (166),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QSH  W  T+  SP+VI MSF PIT LL GV+G   LS AI+LYL
Sbjct  498  DLLSIQVRRGGIDNGQSHKQWLSTISQSPNVISMSFVPITSLLSGVRGSGFLSHAINLYL  557

Query  191  ECK  183
              K
Sbjct  558  RYK  560


 Score = 38.1 bits (87),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  560  KPPIEELHQFLEFQLPRQWAP  580



>ref|XP_004232912.1| PREDICTED: MACPF domain-containing protein NSL1 [Solanum lycopersicum]
Length=613

 Score = 68.2 bits (165),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QSH  W  TV  SP+ I MSF PI  LL GV+G   LS AI+LYL
Sbjct  268  DLLSIHIRRGGLDFGQSHSQWLPTVSQSPNAISMSFVPIASLLSGVRGSGFLSHAINLYL  327

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  328  RYKPPIEE  335


 Score = 38.5 bits (88),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  330  KPPIEELEQFLEFQLPRQWAP  350



>ref|XP_006467748.1| PREDICTED: MACPF domain-containing protein NSL1-like [Citrus 
sinensis]
Length=608

 Score = 67.4 bits (163),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
             D+  I  RRGG D  Q+H  W  TV  SP+VI MSF PIT LL GV+G   L+ A++LY
Sbjct  258  NDLISISSRRGGVDTGQTHNRWLSTVSHSPNVISMSFVPITSLLAGVQGNGFLTHAVNLY  317

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  318  LRYKPPIEE  326


 Score = 38.9 bits (89),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_010111186.1| hypothetical protein L484_015070 [Morus notabilis]
 gb|EXC30577.1| hypothetical protein L484_015070 [Morus notabilis]
Length=611

 Score = 67.0 bits (162),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
             D+  I  R GG D+ QSH  W  TV  SP+V+ MSF PIT LL GV+G   LS A++LY
Sbjct  264  NDILGICIRSGGIDIGQSHNAWLSTVSQSPNVVSMSFVPITSLLGGVQGNGFLSHAVNLY  323

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  324  LRYKPPIEE  332


 Score = 39.7 bits (91),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  327  KPPIEELHQFLEFQLPRQWAPV  348



>ref|XP_008339399.1| PREDICTED: MACPF domain-containing protein At4g24290 [Malus domestica]
Length=603

 Score = 67.0 bits (162),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG ++   SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDILSICKRRGGSEMRNISHNEWLQTVQLEPDVITMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECK  183
            YL  K
Sbjct  317  YLRYK  321


 Score = 39.3 bits (90),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP  EEL  FLEFQ+PR WAP+
Sbjct  321  KPPJEELHQFLEFQLPRQWAPV  342



>ref|XP_006364290.1| PREDICTED: MACPF domain-containing protein NSL1-like [Solanum 
tuberosum]
Length=613

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QSH  W  TV  SP+ I MSF PI  LL GV+G   LS AI+LYL
Sbjct  268  DLLSIHIRRGGLDFGQSHSQWLPTVSQSPNAISMSFVPIASLLSGVRGSGFLSHAINLYL  327

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  328  RYKPPIEE  335


 Score = 38.1 bits (87),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  330  KPPIEELEQFLEFQLPRQWAP  350



>ref|XP_011043424.1| PREDICTED: MACPF domain-containing protein NSL1-like [Populus 
euphratica]
Length=608

 Score = 68.9 bits (167),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+T I  RRGG D+ QSH  W  T+  SP+VI MS  PIT LL G++G   L+ A++LY
Sbjct  262  EDLTSICIRRGGVDVGQSHNQWLSTISQSPNVISMSLVPITSLLNGIRGNGFLNHAVNLY  321

Query  194  LECK  183
            L  K
Sbjct  322  LRYK  325


 Score = 37.4 bits (85),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP  EEL  FLEFQ+PR WAP+
Sbjct  325  KPPTEELHQFLEFQLPRQWAPV  346



>ref|XP_008786477.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008786478.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008786479.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Phoenix dactylifera]
Length=600

 Score = 71.6 bits (174),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IF+RRGG D +  SH  W  TV+S PDVI MSF PIT LL GV G   L+ AI+L
Sbjct  257  EDIVKIFKRRGGKDNKGLSHNEWLNTVQSEPDVISMSFLPITSLLNGVPGSGFLNHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.0 bits (79),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  321  KPPIEELHQFLEFQLPRQWAP  341



>ref|XP_002439105.1| hypothetical protein SORBIDRAFT_09g000570 [Sorghum bicolor]
 gb|EES17535.1| hypothetical protein SORBIDRAFT_09g000570 [Sorghum bicolor]
Length=607

 Score = 66.2 bits (160),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -1

Query  374  QDVTVIFRRRGGD--DLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            +D+ ++ +RRGG   D +  H  W  TV+S PDVI MSF PIT LL GV G   L+ AI+
Sbjct  259  EDLVMVVKRRGGKEWDKDMPHSEWINTVQSEPDVISMSFLPITSLLNGVPGCGFLNHAIN  318

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  319  LYLRYKPPIEE  329


 Score = 40.0 bits (92),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EEL  FLEFQ+PR WAP+   H
Sbjct  324  KPPIEELHQFLEFQLPRQWAPVYSDH  349



>ref|XP_010930567.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Elaeis 
guineensis]
 ref|XP_010930569.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Elaeis 
guineensis]
Length=600

 Score = 70.1 bits (170),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IF+RRGG D+ + SH  W  TV+S PDVI MSF PIT LL GV G   L+ AI+L
Sbjct  257  EDIMKIFKRRGGKDNKDLSHNEWLNTVQSEPDVISMSFLPITSLLIGVLGSGFLNHAINL  316

Query  197  YLECK  183
            YL  K
Sbjct  317  YLRYK  321


 Score = 36.2 bits (82),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP LEEL  FLEFQ+PR WAP+
Sbjct  321  KPPLEELHQFLEFQLPRQWAPV  342



>ref|XP_003540144.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Glycine max]
 ref|XP_006592658.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X2 [Glycine max]
 ref|XP_006592659.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X3 [Glycine max]
 ref|XP_006592660.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X4 [Glycine max]
 gb|KHN31593.1| MACPF domain-containing protein [Glycine soja]
Length=605

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I +RRGG DD   SH  W +TV+S PDVI MSF PIT +L GV G   LS AI+L
Sbjct  257  EDIVSICKRRGGRDDRNLSHNEWLQTVQSEPDVISMSFIPITSVLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIVE  326


 Score = 35.4 bits (80),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP + EL  FLEFQ+PR WAP+
Sbjct  321  KPPIVELHQFLEFQLPRQWAPV  342



>ref|XP_008786480.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X2 [Phoenix dactylifera]
Length=374

 Score = 71.2 bits (173),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  IF+RRGG D +  SH  W  TV+S PDVI MSF PIT LL GV G   L+ AI+L
Sbjct  257  EDIVKIFKRRGGKDNKGLSHNEWLNTVQSEPDVISMSFLPITSLLNGVPGSGFLNHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 35.0 bits (79),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  321  KPPIEELHQFLEFQLPRQWAP  341



>ref|XP_007222050.1| hypothetical protein PRUPE_ppa003112mg [Prunus persica]
 gb|EMJ23249.1| hypothetical protein PRUPE_ppa003112mg [Prunus persica]
Length=602

 Score = 67.8 bits (164),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +DV  I +RRGG D    SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDVVSICKRRGGIDTRNLSHNEWLQTVQFEPDVIAMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>gb|ACN36806.1| unknown [Zea mays]
 gb|AFW85101.1| hypothetical protein ZEAMMB73_537134 [Zea mays]
Length=315

 Score = 70.1 bits (170),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +TVIFRRRGG DL QS   W  TV S+PDVI ++F  I  L++ + GK+HL+RA+ LYL 
Sbjct  1    MTVIFRRRGGCDLVQSFSDWRGTVASAPDVIGITFLSIVSLVDDIPGKKHLARAVELYLT  60

Query  188  CKDIVTQ  168
             K  + +
Sbjct  61   YKPPIEE  67


 Score = 36.2 bits (82),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78  KPQLEELRYFLEFQVPRIWAP  16
           KP +EEL+YFL+F+VP +WAP
Sbjct  62  KPPIEELQYFLDFRVPLVWAP  82



>ref|XP_002509441.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50828.1| conserved hypothetical protein [Ricinus communis]
Length=600

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            Q++  +  R+GG D  QSH  W  T+  SP+VI MSF PIT LL GV+G   LS AI+LY
Sbjct  251  QEILSVAIRKGGLDTGQSHNQWLSTILQSPNVISMSFVPITSLLSGVRGNGFLSHAINLY  310

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  311  LRYKPPIEE  319


 Score = 38.1 bits (87),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  314  KPPIEELYQFLEFQLPRQWAPV  335



>gb|KHN15479.1| MACPF domain-containing protein NSL1 [Glycine soja]
Length=611

 Score = 63.9 bits (154),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QS+  W  T+  SP VI MSF PIT LL  V G   LS A++LYL
Sbjct  264  DIVSISVRRGGIDNGQSYSQWLSTISQSPSVISMSFVPITSLLNSVPGNGFLSHAVNLYL  323

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  324  RYKPAIEE  331


 Score = 42.4 bits (98),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EEL  FLEFQ+PR WAP+ D
Sbjct  326  KPAIEELHQFLEFQLPRQWAPMYD  349



>gb|EEC79676.1| hypothetical protein OsI_20937 [Oryza sativa Indica Group]
Length=626

 Score = 65.5 bits (158),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  T+  SPDVI M+F PIT LL GV+G   L+ A++LYL
Sbjct  271  DIVSIHIRRGGVDNGQGHSKWLSTISGSPDVISMAFVPITSLLTGVRGCGFLNHAVNLYL  330

Query  191  ECK  183
              K
Sbjct  331  RYK  333


 Score = 40.8 bits (94),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQVPR WAP
Sbjct  333  KPPIEELHQFLEFQVPRQWAP  353



>ref|XP_003528464.1| PREDICTED: MACPF domain-containing protein NSL1-like [Glycine 
max]
Length=611

 Score = 63.9 bits (154),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  QS+  W  T+  SP VI MSF PIT LL  V G   LS A++LYL
Sbjct  264  DIVSISVRRGGIDNGQSYSQWLSTISQSPSVISMSFVPITSLLNSVPGNGFLSHAVNLYL  323

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  324  RYKPAIEE  331


 Score = 42.4 bits (98),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQD  7
            KP +EEL  FLEFQ+PR WAP+ D
Sbjct  326  KPAIEELHQFLEFQLPRQWAPMYD  349



>ref|XP_004961258.1| PREDICTED: MACPF domain-containing protein NSL1-like [Setaria 
italica]
Length=614

 Score = 65.1 bits (157),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  T+   PDVI MSF PIT LL GV+G   L+ A++LYL
Sbjct  264  DIVCIHIRRGGVDSGQGHGKWLSTITGYPDVISMSFVPITSLLSGVRGCGFLNHAVNLYL  323

Query  191  ECK  183
              K
Sbjct  324  RYK  326


 Score = 40.8 bits (94),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQVPR WAP
Sbjct  326  KPPIEELQQFLEFQVPRHWAP  346



>gb|ABE79564.1| Membrane attack complex component/perforin/complement C9 [Medicago 
truncatula]
 gb|AES63168.2| MACPF domain protein [Medicago truncatula]
Length=610

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+    +RRGG DD   SH  W +TV+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  259  EDIVSFCKRRGGSDDKNLSHNQWLQTVQLEPDVISMSFIPITSLLNGVPGSGFLSHAINL  318

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  319  YLRYKPPIEE  328


 Score = 38.1 bits (87),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  323  KPPIEELHQFLEFQLPRQWAPV  344



>ref|NP_001056288.1| Os05g0557400 [Oryza sativa Japonica Group]
 gb|AAT58716.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18202.1| Os05g0557400 [Oryza sativa Japonica Group]
 dbj|BAG91491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64651.1| hypothetical protein OsJ_19505 [Oryza sativa Japonica Group]
Length=628

 Score = 65.9 bits (159),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H +W  T+  SPDVI M+F PIT LL GV+G   L+ A++LYL
Sbjct  273  DILSIHIRRGGVDNGQGHSNWLSTISGSPDVISMAFVPITSLLTGVRGCGFLNHAVNLYL  332

Query  191  ECK  183
              K
Sbjct  333  RYK  335


 Score = 40.4 bits (93),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQVPR WAP
Sbjct  335  KPPIEELHQFLEFQVPRQWAP  355



>ref|XP_009109731.1| PREDICTED: MACPF domain-containing protein NSL1-like [Brassica 
rapa]
Length=609

 Score = 65.9 bits (159),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+  I  RRGG D+ QSH  W  T+  SP+ I M F PIT LL G+ G   LS A++LY
Sbjct  262  EDIVSICIRRGGVDMGQSHDRWLSTISQSPNAISMCFVPITSLLSGLPGTGFLSHAVNLY  321

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  322  LRYKPPIEE  330


 Score = 40.0 bits (92),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLEFQ+PR WAP+
Sbjct  325  KPPIEELQQFLEFQLPRQWAPV  346



>emb|CDX90147.1| BnaA08g18370D [Brassica napus]
Length=609

 Score = 65.9 bits (159),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +D+  I  RRGG D+ QSH  W  T+  SP+ I M F PIT LL G+ G   LS A++LY
Sbjct  262  EDIVSICIRRGGVDMGQSHDRWLSTISQSPNAISMCFVPITSLLSGLPGTGFLSHAVNLY  321

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  322  LRYKPPIEE  330


 Score = 40.0 bits (92),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL+ FLEFQ+PR WAP+
Sbjct  325  KPPIEELQQFLEFQLPRQWAPV  346



>gb|KJB75520.1| hypothetical protein B456_012G045100 [Gossypium raimondii]
Length=598

 Score = 69.3 bits (168),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = -1

Query  377  MQDVTVIFRRRGGD-DLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
             QD+  I +R+GG  +   SH  W +TV+S PDVI MSF PIT LL GV G  +L+ AI+
Sbjct  249  FQDIKFICKRKGGKLNSNLSHSEWCQTVQSEPDVISMSFIPITSLLSGVNGSGYLTHAIN  308

Query  200  LYLECK  183
            LYL  K
Sbjct  309  LYLRYK  314


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP ++EL  FLEFQ+P+ WAP+
Sbjct  314  KPSIDELHQFLEFQLPKQWAPV  335



>emb|CAN60694.1| hypothetical protein VITISV_007560 [Vitis vinifera]
Length=614

 Score = 64.7 bits (156),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +T+I+ +RGGD   QSH  W +TV + P+ I   F PIT LL G+ G  +LS AI+LYL 
Sbjct  262  LTIIWSKRGGDVFLQSHSKWLQTVSAKPEAILFKFVPITSLLTGIPGSGYLSHAINLYLR  321

Query  188  CK  183
             K
Sbjct  322  YK  323


 Score = 41.2 bits (95),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP LE+L+YFLEFQVP  WAP+
Sbjct  323  KPTLEDLQYFLEFQVPSQWAPM  344



>ref|XP_002264053.1| PREDICTED: MACPF domain-containing protein At4g24290 [Vitis vinifera]
Length=614

 Score = 64.7 bits (156),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  VTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLE  189
            +T+I+ +RGGD   QSH  W +TV + P+ I   F PIT LL G+ G  +LS AI+LYL 
Sbjct  262  LTIIWSKRGGDVFLQSHSKWLQTVSAKPEAILFKFVPITSLLTGIPGSGYLSHAINLYLR  321

Query  188  CK  183
             K
Sbjct  322  YK  323


 Score = 41.2 bits (95),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP LE+L+YFLEFQVP  WAP+
Sbjct  323  KPTLEDLQYFLEFQVPSQWAPM  344



>ref|XP_011047918.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Populus euphratica]
 ref|XP_011047919.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform 
X1 [Populus euphratica]
Length=605

 Score = 67.4 bits (163),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGG-DDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+  I++RRGG D+   SH  W  +V+S PDVI MSF P+T LL GV G   LS AI+L
Sbjct  257  EDIVRIYKRRGGWDNGILSHTEWLHSVQSEPDVISMSFIPVTSLLYGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_009353765.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Pyrus 
x bretschneideri]
Length=603

 Score = 67.4 bits (163),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+ +I +RRGG ++   SH  W ++V+  PDVI MSF PIT LL GV G   LS AI+L
Sbjct  257  EDILIICKRRGGSEMRNISHNEWLQSVQLEPDVITMSFIPITSLLNGVPGSGFLSHAINL  316

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  317  YLRYKPPIEE  326


 Score = 38.5 bits (88),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  321  KPPIEELHQFLEFQLPRQWAPV  342



>ref|XP_007211855.1| hypothetical protein PRUPE_ppa003413mg [Prunus persica]
 gb|EMJ13054.1| hypothetical protein PRUPE_ppa003413mg [Prunus persica]
Length=577

 Score = 70.1 bits (170),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            M+    I  RRGG D+ QSH  W  TV  SP+VI MSF PIT LL GV+G   LS A++L
Sbjct  229  MKGTVTICVRRGGVDVGQSHNKWLSTVSESPNVISMSFVPITSLLGGVQGNGFLSHAVNL  288

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  289  YLRYKPPIEE  298


 Score = 35.8 bits (81),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  293  KPPIEELHQFLEFQLPRQWAPV  314



>ref|XP_009779321.1| PREDICTED: MACPF domain-containing protein NSL1 [Nicotiana sylvestris]
Length=613

 Score = 67.4 bits (163),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -1

Query  371  DVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYL  192
            D+  I  RRGG D  Q H  W  TV  SP+VI MSF PI  LL GV+G   LS AI+LYL
Sbjct  268  DLLSIHIRRGGLDFGQRHSQWLPTVSQSPNVISMSFVPIASLLSGVRGSGFLSHAINLYL  327

Query  191  ECKDIVTQ  168
              K  + +
Sbjct  328  RYKPPIEE  335


 Score = 38.1 bits (87),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL  FLEFQ+PR WAP
Sbjct  330  KPPIEELEQFLEFQLPRQWAP  350



>ref|XP_008452249.1| PREDICTED: MACPF domain-containing protein At4g24290 [Cucumis 
melo]
 ref|XP_008452250.1| PREDICTED: MACPF domain-containing protein At4g24290 [Cucumis 
melo]
Length=604

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDD-LEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            ++D+  I +RRGG D +   H  W +TV+  PDVI MSF PIT LL GV G   LS AI+
Sbjct  257  LKDIVPICKRRGGSDRISLPHHEWLQTVQLEPDVISMSFIPITSLLNGVPGSGFLSHAIN  316

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  317  LYLRYKPPIEE  327


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  322  KPPIEELHQFLEFQLPRQWAPI  343



>ref|XP_004133715.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Cucumis 
sativus]
Length=604

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  377  MQDVTVIFRRRGGDD-LEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            ++D+  I +RRGG D +   H  W +TV+  PDVI MSF PIT LL GV G   LS AI+
Sbjct  257  LKDIVPICKRRGGSDRISLPHHEWLQTVQLEPDVISMSFIPITSLLNGVPGSGFLSHAIN  316

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  317  LYLRYKPPIEE  327


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  322  KPPIEELHQFLEFQLPRQWAPI  343



>ref|NP_001130673.1| uncharacterized protein LOC100191776 [Zea mays]
 gb|ACF78983.1| unknown [Zea mays]
 gb|ACL54525.1| unknown [Zea mays]
 gb|AFW75063.1| hypothetical protein ZEAMMB73_919359 [Zea mays]
Length=610

 Score = 65.9 bits (159),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -1

Query  374  QDVTVIFRRRGGD--DLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAIS  201
            +D+ ++ +RRGG   D +  H  W  TV+S PDVI MSF PIT LL GV G   L+ AI+
Sbjct  259  EDLVMVVKRRGGKEWDKDMPHSEWINTVQSEPDVISMSFLPITSLLSGVPGCGFLNHAIN  318

Query  200  LYLECKDIVTQ  168
            LYL  K  + +
Sbjct  319  LYLRYKPPIEE  329


 Score = 39.7 bits (91),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPLQDRH  1
            KP +EEL  FLEFQ+PR WAP+   H
Sbjct  324  KPPIEELHQFLEFQLPRQWAPVYSDH  349



>ref|XP_004971326.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Setaria 
italica]
Length=608

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQ-SHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISL  198
            +D+ ++ +RRGG D E  SH  W  TV++ PDVI MSF PIT LL GV G   L+ AI+L
Sbjct  259  EDLVMMPKRRGGKDKEFISHSEWLNTVQAEPDVISMSFIPITSLLNGVPGSGFLNHAINL  318

Query  197  YLECKDIVTQ  168
            YL  K  + +
Sbjct  319  YLRHKPPIEE  328


 Score = 38.5 bits (88),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  323  KPPIEELHQFLEFQLPRQWAPV  344



>ref|XP_001770394.1| predicted protein [Physcomitrella patens]
 gb|EDQ64731.1| predicted protein [Physcomitrella patens]
Length=574

 Score = 72.8 bits (177),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            + V +IFRRRGGD++  SH  W  TV  +PDVI M+F PI+ L+ G+ G  +LS A++LY
Sbjct  252  KGVEIIFRRRGGDNMVDSHQGWLATVSETPDVIAMTFVPISSLISGIPGNGYLSHAVNLY  311

Query  194  LECKDIVTQ  168
            +  K  + +
Sbjct  312  MRYKPPIEE  320


 Score = 32.3 bits (72),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EEL+ FLEFQ+P  W+P
Sbjct  315  KPPIEELQNFLEFQLPTQWSP  335



>ref|XP_002890774.1| hypothetical protein ARALYDRAFT_473053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67033.1| hypothetical protein ARALYDRAFT_473053 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 65.9 bits (159),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +++  +  RRGG DL QSH  W  TV  SP+VI M F PIT LL G+ G   LS A++LY
Sbjct  265  EEIVRVCIRRGGVDLGQSHERWLSTVSQSPNVISMCFVPITSLLSGLPGTGFLSHAVNLY  324

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  325  LRYKPPIEE  333


 Score = 39.3 bits (90),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  328  KPPIEELHQFLEFQLPRQWAPV  349



>ref|XP_006859050.1| hypothetical protein AMTR_s00068p00188520 [Amborella trichopoda]
 gb|ERN20517.1| hypothetical protein AMTR_s00068p00188520 [Amborella trichopoda]
Length=597

 Score = 62.8 bits (151),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -1

Query  374  QDVTVIFRRRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLY  195
            +++  I  RRGG D+ Q H  W  T+  +PDVI MS  PI  LL G+ G   L+ A++LY
Sbjct  259  EEIVSISIRRGGIDIGQGHTQWLGTISQAPDVISMSLVPIASLLHGISGSGFLTHAVNLY  318

Query  194  LECKDIVTQ  168
            L  K  + +
Sbjct  319  LRYKPPIEE  327


 Score = 42.4 bits (98),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAP  16
            KP +EELRYFLEFQVPR WAP
Sbjct  322  KPPIEELRYFLEFQVPRQWAP  342



>ref|XP_008345898.1| PREDICTED: MACPF domain-containing protein NSL1-like [Malus domestica]
Length=603

 Score = 65.9 bits (159),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  350  RRGGDDLEQSHVHWAKTVKSSPDVIEMSFYPITMLLEGVKGKEHLSRAISLYLECKDIVT  171
            RRGG D+ QSH  W  TV  SPDV+ MSF P+T LL GV+G   LS A++LYL  K  + 
Sbjct  265  RRGGVDISQSHNKWLSTVSESPDVVLMSFVPLTSLLGGVQGIGFLSHAVNLYLRYKPPIE  324

Query  170  Q  168
            +
Sbjct  325  E  325


 Score = 39.3 bits (90),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  78   KPQLEELRYFLEFQVPRIWAPL  13
            KP +EEL  FLEFQ+PR WAP+
Sbjct  320  KPPIEELHQFLEFQLPRQWAPV  341



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510