BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP003A01 624 bp,:Filtered

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774410.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    177   5e-49   Nicotiana sylvestris
ref|XP_009774409.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    177   1e-48   Nicotiana sylvestris
ref|XP_009611654.1|  PREDICTED: leukotriene A-4 hydrolase homolog       177   2e-48   Nicotiana tomentosiformis
ref|XP_009591946.1|  PREDICTED: leukotriene A-4 hydrolase homolog       172   7e-47   Nicotiana tomentosiformis
gb|EYU39803.1|  hypothetical protein MIMGU_mgv1a003035mg                164   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_002311120.2|  peptidase M1 family protein                        162   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011004432.1|  PREDICTED: leukotriene A-4 hydrolase homolog       160   1e-42   Populus euphratica
ref|XP_011084383.1|  PREDICTED: leukotriene A-4 hydrolase homolog       160   2e-42   Sesamum indicum [beniseed]
ref|XP_004237529.1|  PREDICTED: leukotriene A-4 hydrolase homolog       160   3e-42   Solanum lycopersicum
ref|XP_006340549.1|  PREDICTED: leukotriene A-4 hydrolase-like          159   6e-42   Solanum tuberosum [potatoes]
ref|XP_010693094.1|  PREDICTED: leukotriene A-4 hydrolase homolog       158   8e-42   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011084382.1|  PREDICTED: leukotriene A-4 hydrolase homolog       157   2e-41   Sesamum indicum [beniseed]
ref|XP_011027038.1|  PREDICTED: leukotriene A-4 hydrolase homolog       157   3e-41   Populus euphratica
ref|XP_010032239.1|  PREDICTED: leukotriene A-4 hydrolase homolog       156   6e-41   Eucalyptus grandis [rose gum]
ref|XP_002281209.1|  PREDICTED: leukotriene A-4 hydrolase homolog       155   8e-41   Vitis vinifera
emb|CAN78027.1|  hypothetical protein VITISV_017527                     155   1e-40   Vitis vinifera
emb|CDP04332.1|  unnamed protein product                                154   3e-40   Coffea canephora [robusta coffee]
ref|XP_002316336.1|  peptidase M1 family protein                        153   5e-40   Populus trichocarpa [western balsam poplar]
emb|CDY09805.1|  BnaC09g43560D                                          151   3e-39   Brassica napus [oilseed rape]
gb|KDO67881.1|  hypothetical protein CISIN_1g0098532mg                  145   4e-39   Citrus sinensis [Valencia orange]
ref|XP_010558779.1|  PREDICTED: leukotriene A-4 hydrolase homolog       150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_006287291.1|  hypothetical protein CARUB_v10000485mg             149   2e-38   Capsella rubella
ref|NP_196856.1|  peptidase M1 family protein                           149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260146.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    148   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010260145.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    148   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010101488.1|  Leukotriene A-4 hydrolase-like protein             147   7e-38   Morus notabilis
ref|XP_002873616.1|  peptidase M1 family protein                        147   8e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_006436185.1|  hypothetical protein CICLE_v10030974mg             146   2e-37   Citrus clementina
ref|XP_010453430.1|  PREDICTED: leukotriene A-4 hydrolase homolog       145   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010492111.1|  PREDICTED: leukotriene A-4 hydrolase homolog       145   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004307431.1|  PREDICTED: leukotriene A-4 hydrolase homolog       145   5e-37   Fragaria vesca subsp. vesca
ref|XP_010032240.1|  PREDICTED: leukotriene A-4 hydrolase homolog       144   6e-37   Eucalyptus grandis [rose gum]
ref|XP_010424081.1|  PREDICTED: leukotriene A-4 hydrolase homolog       142   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009357603.1|  PREDICTED: leukotriene A-4 hydrolase homolog       144   8e-37   Pyrus x bretschneideri [bai li]
gb|KJB78902.1|  hypothetical protein B456_013G024500                    144   9e-37   Gossypium raimondii
ref|XP_010419936.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    142   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002523930.1|  leukotriene A-4 hydrolase, putative                142   3e-36   Ricinus communis
ref|XP_008233387.1|  PREDICTED: leukotriene A-4 hydrolase homolog       142   6e-36   Prunus mume [ume]
ref|XP_007220632.1|  hypothetical protein PRUPE_ppa003396mg             141   9e-36   Prunus persica
gb|KHG18031.1|  leukotriene a-4 hydrolase                               141   1e-35   Gossypium arboreum [tree cotton]
emb|CDX69635.1|  BnaA10g19840D                                          141   1e-35   Brassica napus [oilseed rape]
ref|XP_009121758.1|  PREDICTED: leukotriene A-4 hydrolase homolog       141   1e-35   Brassica rapa
ref|XP_009378140.1|  PREDICTED: leukotriene A-4 hydrolase homolog       141   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_003592804.1|  Leukotriene-A4 hydrolase-like protein              140   2e-35   Medicago truncatula
ref|XP_008384306.1|  PREDICTED: leukotriene A-4 hydrolase homolog       140   2e-35   Malus domestica [apple tree]
ref|XP_008463564.1|  PREDICTED: leukotriene A-4 hydrolase homolog       140   3e-35   Cucumis melo [Oriental melon]
ref|XP_004497366.1|  PREDICTED: leukotriene A-4 hydrolase-like          139   4e-35   Cicer arietinum [garbanzo]
ref|XP_007009681.1|  Peptidase M1 family protein isoform 2              138   9e-35   Theobroma cacao [chocolate]
ref|XP_007009680.1|  Peptidase M1 family protein isoform 1              138   1e-34   Theobroma cacao [chocolate]
gb|KDP46145.1|  hypothetical protein JCGZ_06656                         137   2e-34   Jatropha curcas
ref|XP_008369777.1|  PREDICTED: leukotriene A-4 hydrolase homolog       137   5e-34   
ref|XP_006399845.1|  hypothetical protein EUTSA_v10012982mg             136   5e-34   Eutrema salsugineum
ref|XP_006485956.1|  PREDICTED: leukotriene A-4 hydrolase homolog       135   2e-33   Citrus sinensis [Valencia orange]
ref|XP_004143812.1|  PREDICTED: leukotriene A-4 hydrolase homolog       134   5e-33   
emb|CDX85643.1|  BnaA02g01700D                                          134   6e-33   Brassica napus [oilseed rape]
ref|XP_004164966.1|  PREDICTED: leukotriene A-4 hydrolase homolog       133   7e-33   
ref|XP_006828276.1|  hypothetical protein AMTR_s00023p00220060          131   9e-33   
gb|KGN51243.1|  hypothetical protein Csa_5G503560                       133   9e-33   Cucumis sativus [cucumbers]
ref|XP_004149822.1|  PREDICTED: leukotriene A-4 hydrolase homolog       133   1e-32   
ref|XP_009125918.1|  PREDICTED: leukotriene A-4 hydrolase homolog       132   3e-32   Brassica rapa
gb|KFK25582.1|  hypothetical protein AALP_AA8G133600                    130   8e-32   Arabis alpina [alpine rockcress]
ref|XP_009378139.1|  PREDICTED: leukotriene A-4 hydrolase homolog       130   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_009396855.1|  PREDICTED: leukotriene A-4 hydrolase homolog       128   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008465548.1|  PREDICTED: leukotriene A-4 hydrolase homolog       125   7e-31   
gb|KGN51242.1|  hypothetical protein Csa_5G497060                       128   8e-31   Cucumis sativus [cucumbers]
gb|ADE75697.1|  unknown                                                 126   3e-30   Picea sitchensis
dbj|BAK01914.1|  predicted protein                                      120   6e-28   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008783659.1|  PREDICTED: leukotriene A-4 hydrolase homolog       118   2e-27   Phoenix dactylifera
ref|XP_003563705.1|  PREDICTED: leukotriene A-4 hydrolase homolog       118   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_006650799.1|  PREDICTED: leukotriene A-4 hydrolase homolog       117   8e-27   Oryza brachyantha
ref|XP_010922491.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    115   1e-26   Elaeis guineensis
ref|XP_010922490.1|  PREDICTED: leukotriene A-4 hydrolase homolog...    115   2e-26   Elaeis guineensis
tpg|DAA52184.1|  TPA: hypothetical protein ZEAMMB73_681220              112   2e-25   Zea mays [maize]
ref|XP_008644156.1|  PREDICTED: uncharacterized protein LOC100382...    112   3e-25   Zea mays [maize]
gb|ACN28213.1|  unknown                                                 112   3e-25   Zea mays [maize]
ref|XP_002466200.1|  hypothetical protein SORBIDRAFT_01g003380          112   4e-25   Sorghum bicolor [broomcorn]
ref|NP_001168832.1|  uncharacterized protein LOC100382637               111   6e-25   Zea mays [maize]
gb|EAY92357.1|  hypothetical protein OsI_14085                          111   8e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001051710.1|  Os03g0819100                                       111   9e-25   
ref|XP_004981267.1|  PREDICTED: leukotriene A-4 hydrolase homolog       109   3e-24   Setaria italica
gb|KHN27095.1|  Leukotriene A-4 hydrolase                               103   6e-22   Glycine soja [wild soybean]
ref|XP_002967717.1|  hypothetical protein SELMODRAFT_88325              100   6e-21   Selaginella moellendorffii
ref|XP_002964317.1|  hypothetical protein SELMODRAFT_82151              100   6e-21   Selaginella moellendorffii
ref|XP_003556555.1|  PREDICTED: leukotriene A-4 hydrolase homolog       100   8e-21   Glycine max [soybeans]
gb|KFB46576.1|  AGAP009907-PA-like protein                            89.0    5e-17   Anopheles sinensis
ref|WP_002613661.1|  peptidase M1                                     88.2    1e-16   Stigmatella aurantiaca
ref|XP_319027.4|  AGAP009907-PA                                       88.2    1e-16   Anopheles gambiae str. PEST
ref|XP_004173299.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  87.8    1e-16   
gb|ETN67323.1|  leukotriene A-4 hydrolase                             87.0    2e-16   Anopheles darlingi [American malaria mosquito]
ref|WP_015351169.1|  M1 family peptidase                              86.3    5e-16   Myxococcus stipitatus
ref|WP_044181511.1|  peptidase M1                                     85.9    5e-16   Hyalangium minutum
ref|WP_026939150.1|  peptidase M1                                     85.9    6e-16   Holophaga foetida
ref|WP_002634079.1|  peptidase M1                                     84.0    2e-15   Myxococcus hansupus
ref|WP_011555110.1|  peptidase M1                                     83.2    4e-15   Myxococcus xanthus
ref|WP_014395190.1|  peptidase M1                                     83.2    4e-15   Corallococcus coralloides
ref|WP_013941692.1|  peptidase M1                                     83.2    5e-15   Myxococcus fulvus
gb|KJB80870.1|  hypothetical protein B456_013G157100                  77.8    1e-14   Gossypium raimondii
ref|WP_002621207.1|  hypothetical protein                             81.6    2e-14   Cystobacter fuscus
ref|WP_043411402.1|  peptidase M1                                     81.3    2e-14   Cystobacter violaceus
ref|XP_001657127.1|  AAEL003666-PA                                    81.3    2e-14   Aedes aegypti
gb|EFX86132.1|  putative leukotriene A4 hydrolase                     80.9    3e-14   Daphnia pulex
ref|XP_001861493.1|  leukotriene A-4 hydrolase                        79.7    7e-14   Culex quinquefasciatus
ref|WP_026852922.1|  peptidase M1                                     79.3    1e-13   Geothrix fermentans
ref|WP_022976719.1|  aminopeptidase                                   79.0    1e-13   Nevskia ramosa
ref|XP_008176974.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  79.0    1e-13   Chrysemys picta bellii
ref|XP_005306570.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  79.0    1e-13   Chrysemys picta bellii
ref|WP_044513799.1|  aminopeptidase                                   77.8    3e-13   Hymenobacter sp. DG25B
ref|NP_001040416.1|  leukotriene A4 hydrolase                         77.4    4e-13   Bombyx mori [silk moth]
gb|KGO39732.1|  Leukotriene A4 hydrolase                              77.0    5e-13   Penicillium expansum
gb|KGO62758.1|  Leukotriene A4 hydrolase                              77.0    5e-13   Penicillium expansum
ref|XP_011295445.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  77.4    5e-13   Musca domestica
ref|WP_032096781.1|  MULTISPECIES: aminopeptidase                     77.0    7e-13   Alteromonas
emb|CDM26923.1|  Leukotriene A-4 hydrolase homolog                    76.6    7e-13   Penicillium roqueforti FM164
gb|EKV10701.1|  Leukotriene A4 hydrolase                              76.6    7e-13   Penicillium digitatum PHI26
gb|KGO65010.1|  Leukotriene A4 hydrolase                              76.6    7e-13   Penicillium italicum
ref|WP_007623272.1|  leukotriene A-4 hydrolase                        76.3    1e-12   Paraglaciecola arctica
ref|XP_002558974.1|  Pc13g05400                                       76.3    1e-12   Penicillium rubens Wisconsin 54-1255
gb|KFM57734.1|  Leukotriene A-4 hydrolase                             75.9    1e-12   Stegodyphus mimosarum
ref|XP_002090623.1|  GE12699                                          75.5    2e-12   Drosophila yakuba
ref|WP_006006805.1|  aminopeptidase                                   75.5    2e-12   Glaciecola punicea
dbj|BAD92977.1|  leukotriene A4 hydrolase variant                     72.4    2e-12   Homo sapiens [man]
gb|AAK93169.1|  LD27070p                                              75.5    2e-12   Drosophila melanogaster
ref|XP_002507406.1|  predicted protein                                75.1    2e-12   Micromonas commoda
ref|XP_001974335.1|  GG21678                                          75.1    3e-12   Drosophila erecta
ref|XP_008255137.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  74.7    3e-12   Oryctolagus cuniculus [European rabbit]
ref|XP_002711258.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  75.1    3e-12   Oryctolagus cuniculus [European rabbit]
ref|WP_010392291.1|  aminopeptidase                                   75.1    3e-12   Pseudoalteromonas undina
ref|XP_004748554.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  74.7    3e-12   
ref|XP_004400314.1|  PREDICTED: leukotriene A-4 hydrolase             74.7    3e-12   Odobenus rosmarus divergens
gb|EPS29094.1|  hypothetical protein PDE_04043                        74.7    3e-12   Penicillium oxalicum 114-2
ref|XP_004583325.1|  PREDICTED: leukotriene A-4 hydrolase             74.3    3e-12   Ochotona princeps [southern American pika]
ref|WP_018981430.1|  hypothetical protein                             74.7    4e-12   
ref|XP_004748553.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  74.7    4e-12   Mustela putorius furo [black ferret]
ref|XP_002132587.1|  GA25817                                          74.7    4e-12   Drosophila pseudoobscura pseudoobscura
ref|XP_002014673.1|  GL18827                                          74.7    4e-12   Drosophila persimilis
ref|XP_539728.3|  PREDICTED: leukotriene A-4 hydrolase                74.7    4e-12   Canis lupus familiaris [dogs]
ref|WP_024015773.1|  putative cold-active aminopeptidase              72.8    4e-12   
ref|XP_002064528.1|  GK23897                                          74.3    4e-12   
gb|EDM16914.1|  leukotriene A4 hydrolase, isoform CRA_b               73.6    4e-12   Rattus norvegicus [brown rat]
ref|XP_001965345.1|  GF20677                                          74.3    4e-12   Drosophila ananassae
ref|XP_004650252.1|  PREDICTED: leukotriene A-4 hydrolase             74.3    4e-12   Jaculus jaculus
ref|XP_006741958.1|  PREDICTED: leukotriene A-4 hydrolase-like        73.9    4e-12   Leptonychotes weddellii
ref|WP_036957061.1|  aminopeptidase                                   74.3    5e-12   Pseudoalteromonas sp. A2
ref|WP_025538538.1|  aminopeptidase                                   74.3    5e-12   
ref|XP_006241313.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.9    5e-12   Rattus norvegicus [brown rat]
gb|KIX01374.1|  leukotriene A-4 hydrolase/aminopeptidase              74.3    5e-12   Rhinocladiella mackenziei CBS 650.93
ref|XP_004418035.1|  PREDICTED: leukotriene A-4 hydrolase             74.3    5e-12   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_001025202.1|  leukotriene A-4 hydrolase                        73.9    5e-12   Rattus norvegicus [brown rat]
gb|EDM16913.1|  leukotriene A4 hydrolase, isoform CRA_a               73.6    5e-12   Rattus norvegicus [brown rat]
ref|WP_010558065.1|  aminopeptidase                                   73.9    6e-12   Pseudoalteromonas marina
ref|XP_008514827.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  73.9    6e-12   Equus przewalskii [Przewalski horse]
ref|NP_724139.1|  CG10602, isoform C                                  73.9    6e-12   Drosophila melanogaster
gb|ERE91837.1|  leukotriene A-4 hydrolase                             73.6    6e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_006988522.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  73.9    6e-12   Peromyscus maniculatus bairdii
gb|EGW08381.1|  Leukotriene A-4 hydrolase                             73.6    6e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_004451587.1|  PREDICTED: leukotriene A-4 hydrolase             73.9    6e-12   Dasypus novemcinctus
ref|WP_039038487.1|  aminopeptidase                                   73.9    6e-12   Pseudoalteromonas sp. ECSMB14103
ref|XP_006988523.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  73.6    6e-12   Peromyscus maniculatus bairdii
ref|WP_008132263.1|  aminopeptidase                                   73.9    6e-12   Pseudoalteromonas sp. BSi20480
ref|XP_008514825.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.9    6e-12   Equus przewalskii [Przewalski horse]
ref|WP_024602237.1|  aminopeptidase                                   73.9    6e-12   Pseudoalteromonas atlantica
ref|WP_013466183.1|  MULTISPECIES: aminopeptidase                     73.9    6e-12   Pseudoalteromonas
ref|XP_005068057.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.9    6e-12   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007640272.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  73.6    7e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_002601783.1|  hypothetical protein BRAFLDRAFT_215361           73.9    7e-12   Branchiostoma floridae
gb|KEF63390.1|  leukotriene A-4 hydrolase                             73.9    7e-12   Exophiala aquamarina CBS 119918
ref|XP_003501464.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.9    7e-12   Cricetulus griseus [Chinese hamsters]
ref|WP_028834677.1|  MULTISPECIES: aminopeptidase                     73.9    7e-12   Pseudoalteromonas
ref|WP_036980588.1|  aminopeptidase                                   73.9    7e-12   Pseudoalteromonas sp. SCSIO_11900
ref|XP_006513349.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.6    7e-12   
ref|WP_033103521.1|  MULTISPECIES: aminopeptidase                     73.6    7e-12   Alteromonadales
ref|WP_008108511.1|  MULTISPECIES: aminopeptidase                     73.6    7e-12   Pseudoalteromonas
ref|XP_006988521.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.6    8e-12   Peromyscus maniculatus bairdii
ref|XP_005358218.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  73.6    8e-12   Microtus ochrogaster [prairie voles]
ref|WP_039224613.1|  aminopeptidase                                   73.6    8e-12   Alteromonas macleodii
ref|XP_008830286.1|  PREDICTED: leukotriene A-4 hydrolase             73.6    8e-12   Nannospalax galili
ref|WP_039230763.1|  aminopeptidase                                   73.6    8e-12   Alteromonas macleodii
gb|AAH21417.1|  Lta4h protein                                         73.6    8e-12   Mus musculus [mouse]
ref|NP_032543.2|  leukotriene A-4 hydrolase                           73.6    8e-12   Mus musculus [mouse]
gb|AAB59675.1|  leukotriene A-4 hydrolase                             73.6    8e-12   Mus musculus [mouse]
ref|XP_005358217.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.6    9e-12   Microtus ochrogaster [prairie voles]
ref|XP_002001748.1|  GI17019                                          73.6    9e-12   Drosophila mojavensis
ref|XP_004675850.1|  PREDICTED: leukotriene A-4 hydrolase             73.6    9e-12   Condylura cristata
ref|XP_001494815.3|  PREDICTED: leukotriene A-4 hydrolase isoform X1  73.6    9e-12   
ref|XP_005606585.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  73.2    9e-12   
gb|ERE91834.1|  leukotriene A-4 hydrolase                             73.9    9e-12   Cricetulus griseus [Chinese hamsters]
gb|ERE91836.1|  leukotriene A-4 hydrolase                             73.9    9e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_005606584.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  73.6    9e-12   
ref|WP_025256395.1|  aminopeptidase                                   73.6    9e-12   Alteromonas sp. ALT199
ref|XP_007232319.1|  PREDICTED: leukotriene A-4 hydrolase             73.6    9e-12   Astyanax mexicanus [blind cave fish]
sp|Q2TZ99.1|LKHA4_ASPOR  RecName: Full=Leukotriene A-4 hydrolase ...  73.6    9e-12   Aspergillus oryzae RIB40
ref|XP_003783386.1|  PREDICTED: leukotriene A-4 hydrolase             73.2    1e-11   Otolemur garnettii
ref|XP_003054759.1|  predicted protein                                73.6    1e-11   Micromonas pusilla CCMP1545
ref|XP_002079842.1|  GD21803                                          73.2    1e-11   
ref|XP_006914655.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.8    1e-11   Pteropus alecto
ref|XP_001260272.1|  leukotriene A4 hydrolase                         73.2    1e-11   Aspergillus fischeri NRRL 181
gb|EHJ63222.1|  leukotriene A4 hydrolase                              73.2    1e-11   Danaus plexippus [American monarch]
ref|WP_012517391.1|  aminopeptidase                                   73.2    1e-11   Alteromonas mediterranea
ref|WP_020745407.1|  putative cold-active aminopeptidase              73.2    1e-11   
ref|WP_029774313.1|  aminopeptidase                                   73.2    1e-11   
ref|WP_024033946.1|  aminopeptidase                                   73.2    1e-11   Pseudoalteromonas sp. NW 4327
ref|XP_007724601.1|  leukotriene A-4 hydrolase                        73.2    1e-11   Capronia coronata CBS 617.96
ref|WP_004587495.1|  cold-active aminopeptidase                       73.2    1e-11   Pseudoalteromonas agarivorans
ref|WP_020742960.1|  putative cold-active aminopeptidase              73.2    1e-11   Alteromonas mediterranea
ref|XP_002378195.1|  leukotriene A4 hydrolase                         73.2    1e-11   Aspergillus flavus NRRL3357
ref|XP_001826499.2|  leukotriene A-4 hydrolase                        73.2    1e-11   Aspergillus oryzae RIB40
ref|WP_015066316.1|  cold-active aminopeptidase                       73.2    1e-11   Alteromonas mediterranea
ref|XP_011364220.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.8    1e-11   Pteropus vampyrus
ref|XP_006914654.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.8    1e-11   Pteropus alecto
ref|XP_004623860.1|  PREDICTED: leukotriene A-4 hydrolase             72.8    1e-11   Octodon degus
ref|NP_001269293.1|  leukotriene A-4 hydrolase                        72.8    1e-11   Chinchilla lanigera
ref|XP_002051925.1|  GJ24461                                          72.8    1e-11   Drosophila virilis
ref|WP_014978452.1|  aminopeptidase                                   72.8    1e-11   Alteromonas macleodii
gb|EAW97560.1|  leukotriene A4 hydrolase, isoform CRA_d               72.4    1e-11   Homo sapiens [man]
ref|WP_014948415.1|  aminopeptidase                                   72.8    1e-11   Alteromonas macleodii
ref|XP_005324508.1|  PREDICTED: leukotriene A-4 hydrolase             72.8    1e-11   Ictidomys tridecemlineatus
ref|WP_014975769.1|  aminopeptidase                                   72.8    2e-11   Alteromonas macleodii
ref|XP_008685945.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.8    2e-11   Ursus maritimus [white bear]
emb|CDQ64461.1|  unnamed protein product                              72.8    2e-11   Oncorhynchus mykiss
ref|XP_002919280.1|  PREDICTED: leukotriene A-4 hydrolase             72.8    2e-11   Ailuropoda melanoleuca
gb|KIW92424.1|  leukotriene A-4 hydrolase/aminopeptidase              72.8    2e-11   Cladophialophora bantiana CBS 173.52
ref|XP_005882424.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.4    2e-11   Myotis brandtii
ref|XP_008143170.1|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   Eptesicus fuscus
ref|XP_005268928.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Homo sapiens [man]
ref|XP_006757685.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.4    2e-11   Myotis davidii
ref|XP_006109766.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  72.4    2e-11   Myotis lucifugus
ref|XP_008567281.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.4    2e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010778729.1|  PREDICTED: leukotriene A-4 hydrolase             68.9    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005882423.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Myotis brandtii
gb|EAW97558.1|  leukotriene A4 hydrolase, isoform CRA_b               72.4    2e-11   Homo sapiens [man]
ref|XP_007796836.1|  putative leukotriene a-4 hydrolase protein       72.4    2e-11   Eutypa lata UCREL1
ref|WP_005493302.1|  Cold-active aminopeptidase (Neutral zinc met...  72.4    2e-11   Pseudoalteromonas luteoviolacea
ref|WP_034733151.1|  aminopeptidase                                   72.4    2e-11   
gb|KFZ28492.1|  aminopeptidase                                        72.4    2e-11   Idiomarina atlantica
ref|XP_011282463.1|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   Felis catus [cat]
gb|KFE72324.1|  hypothetical protein DB31_0586                        72.4    2e-11   Hyalangium minutum
ref|XP_010338482.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.4    2e-11   Saimiri boliviensis boliviensis
gb|EAW97557.1|  leukotriene A4 hydrolase, isoform CRA_a               72.4    2e-11   Homo sapiens [man]
ref|XP_006757684.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Myotis davidii
ref|XP_004053757.1|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   Gorilla gorilla gorilla [lowland gorilla]
pdb|3CHO|A  Chain A, Crystal Structure Of Leukotriene A4 Hydrolas...  72.4    2e-11   Homo sapiens [man]
pdb|2R59|A  Chain A, Leukotriene A4 Hydrolase Complexed With Inhi...  72.4    2e-11   Homo sapiens [man]
ref|XP_008567280.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Galeopterus variegatus [Malayan flying lemur]
pdb|1SQM|A  Chain A, Structure Of [r563a] Leukotriene A4 Hydrolase    72.4    2e-11   Homo sapiens [man]
pdb|1GW6|A  Chain A, Structure Of Leukotriene A4 Hydrolase D375n ...  72.4    2e-11   Homo sapiens [man]
ref|XP_007085703.1|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   Panthera tigris altaica
ref|XP_010627469.1|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   Fukomys damarensis [Damara mole rat]
ref|NP_000886.1|  leukotriene A-4 hydrolase isoform 1                 72.4    2e-11   Homo sapiens [man]
pdb|3U9W|A  Chain A, Structure Of Human Leukotriene A4 Hydrolase ...  72.4    2e-11   Homo sapiens [man]
pdb|3B7S|A  Chain A, [e296q]lta4h In Complex With Rsr Substrate       72.4    2e-11   Homo sapiens [man]
pdb|1H19|A  Chain A, Structure Of [e271q] Leukotriene A4 Hydrolase    72.4    2e-11   Homo sapiens [man]
ref|WP_039388967.1|  aminopeptidase                                   72.4    2e-11   Novosphingobium sp. MBES04
ref|XP_003259550.2|  PREDICTED: leukotriene A-4 hydrolase             72.4    2e-11   
ref|XP_005068058.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.0    2e-11   
ref|XP_004844968.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  72.4    2e-11   Heterocephalus glaber [naked mole rat]
ref|WP_007990093.1|  MULTISPECIES: aminopeptidase                     72.4    2e-11   Alteromonadaceae
ref|XP_008685944.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Ursus maritimus [white bear]
ref|XP_003929636.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.4    2e-11   Saimiri boliviensis boliviensis
ref|XP_001989080.1|  GH11524                                          72.4    2e-11   Drosophila grimshawi
ref|XP_009073246.1|  PREDICTED: leukotriene A-4 hydrolase-like        70.9    2e-11   Acanthisitta chloris
ref|XP_004904142.1|  PREDICTED: leukotriene A-4 hydrolase             72.0    2e-11   
ref|WP_015808261.1|  aminopeptidase                                   72.0    2e-11   Pedobacter heparinus
ref|XP_005664290.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.0    2e-11   Sus scrofa [pigs]
ref|XP_005963282.1|  PREDICTED: leukotriene A-4 hydrolase-like        71.2    2e-11   Pantholops hodgsonii
ref|WP_008304298.1|  leukotriene A-4 hydrolase                        72.0    2e-11   Paraglaciecola agarilytica
ref|XP_002039030.1|  GM17056                                          72.0    3e-11   Drosophila sechellia
ref|XP_005664289.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.0    3e-11   Sus scrofa [pigs]
dbj|BAJ14788.1|  aminopeptidase T                                     72.0    3e-11   Sus scrofa [pigs]
ref|NP_001172061.1|  leukotriene A-4 hydrolase                        72.0    3e-11   Sus scrofa [pigs]
ref|WP_026318065.1|  aminopeptidase                                   72.0    3e-11   Algicola sagamiensis
ref|XP_005190708.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  72.0    3e-11   Musca domestica
ref|XP_007523246.1|  PREDICTED: leukotriene A-4 hydrolase             72.0    3e-11   Erinaceus europaeus [European hedgehog]
ref|NP_001124802.1|  leukotriene A-4 hydrolase                        72.0    3e-11   Pongo abelii [Orang-utan]
ref|XP_009002650.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  71.6    3e-11   Callithrix jacchus [common marmoset]
ref|WP_016710516.1|  aminopeptidase                                   72.0    3e-11   Pseudoalteromonas
ref|XP_011331958.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  72.0    3e-11   Cerapachys biroi
ref|WP_028081168.1|  aminopeptidase                                   71.6    3e-11   Solimonas soli
ref|WP_038622239.1|  aminopeptidase                                   71.6    3e-11   Dyella jiangningensis
ref|XP_011331959.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  71.6    3e-11   Cerapachys biroi
ref|WP_039219494.1|  aminopeptidase                                   71.6    4e-11   
ref|XP_004328393.1|  PREDICTED: leukotriene A-4 hydrolase             71.6    4e-11   
ref|XP_004269568.1|  PREDICTED: leukotriene A-4 hydrolase             71.6    4e-11   
ref|XP_002752928.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  71.6    4e-11   
ref|XP_001625593.1|  predicted protein                                71.6    4e-11   
gb|KIV95457.1|  leukotriene A-4 hydrolase/aminopeptidase              71.6    4e-11   
ref|WP_014997453.1|  aminopeptidase                                   71.6    4e-11   
ref|XP_006073605.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  71.2    4e-11   
ref|WP_024610779.1|  aminopeptidase                                   71.6    4e-11   
ref|WP_024597286.1|  aminopeptidase                                   71.2    4e-11   
ref|WP_010555455.1|  aminopeptidase                                   71.2    4e-11   
ref|NP_001029452.1|  leukotriene A-4 hydrolase                        71.2    4e-11   
ref|XP_010803438.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  71.2    4e-11   
ref|WP_013785296.1|  aminopeptidase                                   71.2    4e-11   
ref|XP_007783563.1|  leukotriene A-4 hydrolase                        71.2    4e-11   
ref|XP_010803439.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  71.2    4e-11   
ref|WP_024593806.1|  aminopeptidase                                   71.2    4e-11   
ref|XP_005680528.1|  PREDICTED: leukotriene A-4 hydrolase             71.2    4e-11   
ref|XP_004006678.1|  PREDICTED: leukotriene A-4 hydrolase isoform 1   71.2    4e-11   
gb|KIW64892.1|  leukotriene A-4 hydrolase/aminopeptidase              71.2    4e-11   
ref|XP_010834595.1|  PREDICTED: leukotriene A-4 hydrolase             71.2    5e-11   
ref|WP_011329542.1|  aminopeptidase                                   71.2    5e-11   
gb|KIX92852.1|  hypothetical protein Z520_11516                       71.2    5e-11   
ref|XP_006073604.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  71.2    5e-11   
gb|KFP21535.1|  Leukotriene A-4 hydrolase                             71.2    5e-11   
ref|XP_003771094.1|  PREDICTED: leukotriene A-4 hydrolase             71.2    5e-11   
ref|XP_755088.1|  leukotriene A4 hydrolase                            71.2    5e-11   
ref|XP_007737427.1|  leukotriene A-4 hydrolase                        71.2    5e-11   
gb|EPQ14125.1|  Leukotriene A-4 hydrolase                             67.8    5e-11   
ref|NP_001133592.1|  Leukotriene A-4 hydrolase                        71.2    5e-11   
ref|WP_007081291.1|  aminopeptidase                                   71.2    5e-11   
gb|KFQ46560.1|  Leukotriene A-4 hydrolase                             70.9    5e-11   
ref|XP_007503302.1|  PREDICTED: leukotriene A-4 hydrolase             71.2    5e-11   
ref|WP_041296176.1|  aminopeptidase                                   71.2    5e-11   
gb|ACV26884.1|  Peptidase M1 membrane alanine aminopeptidase          71.2    5e-11   
ref|WP_008482515.1|  aminopeptidase                                   70.9    5e-11   
ref|XP_004053759.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    5e-11   
gb|EHA25095.1|  hypothetical protein ASPNIDRAFT_202191                70.9    5e-11   
gb|ELT87749.1|  hypothetical protein CAPTEDRAFT_162472                70.9    6e-11   
sp|A2QKF8.2|LKHA4_ASPNC  RecName: Full=Leukotriene A-4 hydrolase ...  70.9    6e-11   
gb|KIW38225.1|  leukotriene A-4 hydrolase/aminopeptidase              71.2    6e-11   
ref|WP_006793875.1|  aminopeptidase                                   70.9    6e-11   
ref|XP_010008943.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    6e-11   
ref|XP_007165920.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  70.9    6e-11   
ref|XP_001509819.2|  PREDICTED: leukotriene A-4 hydrolase             70.9    6e-11   
ref|WP_038028335.1|  aminopeptidase                                   70.9    6e-11   
dbj|BAG60321.1|  unnamed protein product                              70.9    6e-11   
ref|NP_001243573.1|  leukotriene A-4 hydrolase isoform 3              70.9    6e-11   
ref|XP_009643928.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    6e-11   
ref|NP_001267011.1|  leukotriene A-4 hydrolase                        70.9    6e-11   
ref|WP_007378047.1|  leukotriene A-4 hydrolase                        70.9    6e-11   
ref|WP_034899287.1|  aminopeptidase                                   70.9    6e-11   
gb|KEQ81863.1|  hypothetical protein M438DRAFT_302010                 70.9    6e-11   
ref|XP_007165918.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.9    6e-11   
ref|WP_024599730.1|  aminopeptidase                                   70.9    6e-11   
ref|NP_001243572.1|  leukotriene A-4 hydrolase isoform 2              70.9    6e-11   
ref|WP_033038562.1|  aminopeptidase                                   70.9    6e-11   
ref|XP_004053758.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    6e-11   
ref|WP_024606309.1|  aminopeptidase                                   70.9    6e-11   
dbj|GAC37506.1|  leukotriene A-4 hydrolase                            70.9    7e-11   
ref|WP_033031159.1|  aminopeptidase                                   70.9    7e-11   
ref|WP_008167383.1|  aminopeptidase                                   70.9    7e-11   
gb|EJK66105.1|  hypothetical protein THAOC_12994                      70.9    7e-11   
ref|WP_033185991.1|  aminopeptidase                                   70.9    7e-11   
ref|WP_039488662.1|  MULTISPECIES: aminopeptidase                     70.9    7e-11   
ref|WP_004334919.1|  aminopeptidase                                   70.9    7e-11   
ref|NP_001166450.1|  leukotriene A-4 hydrolase                        70.9    7e-11   
ref|XP_005571973.1|  PREDICTED: leukotriene A-4 hydrolase isoform X4  70.5    7e-11   
ref|XP_005571972.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  70.5    7e-11   
ref|XP_005519499.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    7e-11   
ref|XP_005143199.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    7e-11   
ref|WP_043320091.1|  aminopeptidase                                   70.9    7e-11   
ref|XP_010382192.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  70.5    7e-11   
ref|XP_008002499.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  70.5    7e-11   
ref|XP_002189060.1|  PREDICTED: leukotriene A-4 hydrolase isoform 1   70.9    7e-11   
ref|XP_001390581.1|  leukotriene A-4 hydrolase                        70.9    7e-11   
gb|KEQ92168.1|  hypothetical protein AUEXF2481DRAFT_68987             70.9    7e-11   
gb|EYE97311.1|  leukotriene A-4 hydrolase                             70.9    7e-11   
ref|WP_027494047.1|  aminopeptidase                                   70.9    7e-11   
ref|XP_010988276.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    7e-11   
ref|XP_008002500.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  70.5    7e-11   
ref|XP_009084900.1|  PREDICTED: leukotriene A-4 hydrolase             70.9    7e-11   
gb|KFP78012.1|  Leukotriene A-4 hydrolase                             70.1    7e-11   
sp|Q0CFY9.2|LKHA4_ASPTN  RecName: Full=Leukotriene A-4 hydrolase ...  70.9    7e-11   
ref|XP_009871874.1|  PREDICTED: leukotriene A-4 hydrolase-like        70.1    7e-11   
ref|XP_006197986.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.5    7e-11   
ref|XP_005480748.1|  PREDICTED: leukotriene A-4 hydrolase             70.5    7e-11   
ref|XP_006187526.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.5    7e-11   
ref|XP_011199548.1|  PREDICTED: leukotriene A-4 hydrolase             70.5    7e-11   
ref|XP_007758965.1|  leukotriene A-4 hydrolase                        70.5    7e-11   
ref|XP_005039984.1|  PREDICTED: leukotriene A-4 hydrolase             70.5    8e-11   
ref|WP_042455582.1|  aminopeptidase                                   70.5    8e-11   
ref|XP_008002498.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.5    8e-11   
ref|XP_007125194.1|  PREDICTED: leukotriene A-4 hydrolase             70.5    8e-11   
ref|XP_005421717.1|  PREDICTED: leukotriene A-4 hydrolase             70.5    8e-11   
ref|XP_005571970.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.5    8e-11   
gb|EHH21090.1|  Leukotriene A-4 hydrolase                             70.5    8e-11   
ref|XP_010382191.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  70.5    8e-11   
sp|Q5B0W8.2|LKHA4_EMENI  RecName: Full=Leukotriene A-4 hydrolase ...  70.5    8e-11   
gb|KIW50822.1|  leukotriene A-4 hydrolase/aminopeptidase              70.5    8e-11   
ref|XP_009160209.1|  leukotriene-A4 hydrolase                         70.5    8e-11   
ref|XP_663416.1|  hypothetical protein AN5812.2                       70.5    8e-11   
ref|WP_042151872.1|  aminopeptidase                                   70.5    9e-11   
gb|KIW21306.1|  leukotriene A-4 hydrolase/aminopeptidase              70.5    9e-11   
ref|XP_001209547.1|  conserved hypothetical protein                   70.5    9e-11   
ref|XP_008725899.1|  leukotriene A-4 hydrolase/aminopeptidase         70.5    9e-11   
ref|XP_009571161.1|  PREDICTED: leukotriene A-4 hydrolase-like        68.6    9e-11   
emb|CDQ67393.1|  unnamed protein product                              70.5    1e-10   
ref|WP_037433214.1|  aminopeptidase                                   70.1    1e-10   
ref|XP_009554562.1|  PREDICTED: leukotriene A-4 hydrolase             70.1    1e-10   
gb|KFO11801.1|  Leukotriene A-4 hydrolase                             70.1    1e-10   
ref|WP_033414014.1|  aminopeptidase                                   70.1    1e-10   
gb|KFH70882.1|  hypothetical protein MVEG_03729                       70.1    1e-10   
ref|XP_005898471.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  70.1    1e-10   
gb|AFU99094.1|  cold-active aminopeptidase                            70.1    1e-10   
ref|WP_024607298.1|  aminopeptidase                                   70.1    1e-10   
ref|XP_010302701.1|  PREDICTED: leukotriene A-4 hydrolase             70.1    1e-10   
dbj|GAA86337.1|  leukotriene A-4 hydrolase                            70.1    1e-10   
ref|XP_007741681.1|  leukotriene A-4 hydrolase                        70.1    1e-10   
gb|KFO72735.1|  Leukotriene A-4 hydrolase                             70.1    1e-10   
ref|XP_006888556.1|  PREDICTED: leukotriene A-4 hydrolase             70.1    1e-10   
ref|WP_020386197.1|  hypothetical protein                             70.1    1e-10   
ref|XP_004006679.1|  PREDICTED: leukotriene A-4 hydrolase isoform 2   70.1    1e-10   
ref|WP_002694751.1|  aminopeptidase                                   70.1    1e-10   
ref|XP_004700814.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  70.1    1e-10   
ref|WP_033230539.1|  aminopeptidase                                   70.1    1e-10   
gb|KFO92059.1|  Leukotriene A-4 hydrolase                             69.7    1e-10   
gb|KDB14978.1|  Leukotriene A-4 hydrolase                             70.1    1e-10   
ref|XP_011189168.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  70.1    1e-10   
ref|XP_010138168.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    1e-10   
ref|XP_007069302.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    1e-10   
ref|WP_010562287.1|  aminopeptidase                                   69.7    1e-10   
ref|XP_009916673.1|  PREDICTED: leukotriene A-4 hydrolase-like        66.6    1e-10   
ref|XP_001267695.1|  leukotriene A4 hydrolase                         69.7    1e-10   
gb|KFV09400.1|  Leukotriene A-4 hydrolase                             69.7    1e-10   
ref|XP_006633419.1|  PREDICTED: leukotriene A-4 hydrolase-like        69.7    1e-10   
dbj|BAG62860.1|  unnamed protein product                              69.7    1e-10   
gb|KFQ15804.1|  Leukotriene A-4 hydrolase                             69.7    1e-10   
ref|XP_009976616.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    1e-10   
dbj|GAM35544.1|  leucyl aminopeptidase                                69.7    1e-10   
ref|XP_006871864.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    1e-10   
ref|XP_003852560.1|  hypothetical protein MYCGRDRAFT_41538            69.7    2e-10   
ref|WP_006993090.1|  leukotriene A-4 hydrolase                        69.7    2e-10   
ref|WP_007804176.1|  aminopeptidase                                   69.7    2e-10   
ref|WP_024589454.1|  MULTISPECIES: aminopeptidase                     69.7    2e-10   
gb|KIW22628.1|  leukotriene A-4 hydrolase/aminopeptidase              69.7    2e-10   
ref|XP_009956854.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    2e-10   
ref|WP_007579889.1|  aminopeptidase                                   69.7    2e-10   
ref|XP_006118384.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    2e-10   
ref|XP_005809750.1|  PREDICTED: leukotriene A-4 hydrolase-like        69.7    2e-10   
ref|XP_007453406.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  69.7    2e-10   
ref|XP_008399874.1|  PREDICTED: leukotriene A-4 hydrolase             69.7    2e-10   
ref|WP_038638950.1|  aminopeptidase                                   69.3    2e-10   
gb|AFM03065.1|  aminopeptidase N                                      69.3    2e-10   
ref|XP_004381299.1|  PREDICTED: leukotriene A-4 hydrolase             69.3    2e-10   
gb|KFQ36485.1|  Leukotriene A-4 hydrolase                             69.3    2e-10   
gb|KIW77532.1|  leukotriene A-4 hydrolase/aminopeptidase              69.3    2e-10   
ref|WP_008897373.1|  aminopeptidase                                   69.3    2e-10   
ref|XP_004991286.1|  hypothetical protein PTSG_12699                  69.3    2e-10   
ref|WP_031564801.1|  aminopeptidase                                   69.3    2e-10   
gb|KEQ59906.1|  leukotriene A-4 hydrolase                             69.3    2e-10   
ref|XP_006187527.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  69.3    2e-10   
ref|XP_009064916.1|  hypothetical protein LOTGIDRAFT_222151           69.3    2e-10   
ref|XP_010338483.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  68.9    2e-10   
ref|WP_026635033.1|  aminopeptidase                                   69.3    2e-10   
ref|XP_008945652.1|  PREDICTED: leukotriene A-4 hydrolase             69.3    2e-10   
ref|XP_006197987.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  69.3    2e-10   
gb|EIL88927.1|  aminopeptidase N                                      68.6    2e-10   
ref|XP_011397335.1|  Leukotriene A-4 hydrolase                        69.3    2e-10   
ref|XP_005571971.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  68.9    2e-10   
ref|WP_011575855.1|  aminopeptidase                                   68.9    2e-10   
ref|XP_008002501.1|  PREDICTED: leukotriene A-4 hydrolase isoform X4  68.9    2e-10   
ref|XP_004602811.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  68.9    2e-10   
gb|KJE92810.1|  leukotriene A4 hydrolase                              68.9    2e-10   
ref|XP_006154952.1|  PREDICTED: leukotriene A-4 hydrolase             68.9    2e-10   
ref|XP_001693612.1|  leukotriene A-4 hydrolase                        68.9    2e-10   
ref|XP_004084996.1|  PREDICTED: leukotriene A-4 hydrolase             68.9    2e-10   
ref|WP_007513709.1|  MULTISPECIES: aminopeptidase                     68.9    3e-10   
ref|XP_005848279.1|  hypothetical protein CHLNCDRAFT_22427            68.9    3e-10   
ref|XP_009179727.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2  68.6    3e-10   
ref|WP_027490464.1|  aminopeptidase                                   68.9    3e-10   
gb|EQL28080.1|  leukotriene A-4 hydrolase, variant 1                  68.9    3e-10   
ref|XP_009179728.1|  PREDICTED: leukotriene A-4 hydrolase isoform X3  68.6    3e-10   
dbj|BAM19239.1|  leukotriene a-4 hydrolase                            68.6    3e-10   
sp|A6RCT2.2|LKHA4_AJECN  RecName: Full=Leukotriene A-4 hydrolase ...  68.9    3e-10   
sp|P30349.2|LKHA4_RAT  RecName: Full=Leukotriene A-4 hydrolase; S...  68.9    3e-10   
gb|EEH07795.1|  leukotriene A4 hydrolase                              68.9    3e-10   
ref|XP_008195767.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  68.9    3e-10   
gb|AII53571.1|  hypothetical protein N008_16510                       68.9    3e-10   
gb|KFW77948.1|  Leukotriene A-4 hydrolase                             68.9    3e-10   
ref|XP_001538018.1|  conserved hypothetical protein                   68.9    3e-10   
gb|KFQ96087.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
ref|WP_035564363.1|  aminopeptidase                                   68.9    3e-10   
ref|XP_009179726.1|  PREDICTED: leukotriene A-4 hydrolase isoform X1  68.6    3e-10   
emb|CCT68475.1|  related to leukotriene-A4 hydrolase long isoform     68.9    3e-10   
gb|KEZ40663.1|  Leukotriene A-4 hydrolase-like protein                68.9    3e-10   
gb|KFP40043.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
ref|XP_010114672.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  68.6    3e-10   
gb|KFW65232.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
gb|EWG40563.1|  leukotriene A-4 hydrolase                             68.9    3e-10   
gb|KGL91309.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
ref|WP_044017463.1|  aminopeptidase                                   68.6    3e-10   
ref|XP_009488118.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|WP_008136567.1|  aminopeptidase                                   68.9    3e-10   
ref|WP_013634544.1|  aminopeptidase                                   68.9    3e-10   
ref|XP_008048760.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
gb|KFQ65160.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
ref|XP_010748546.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|XP_972968.1|  PREDICTED: leukotriene A-4 hydrolase isoform X2     68.6    3e-10   
ref|XP_009880943.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|XP_008720590.1|  leukotriene A-4 hydrolase/aminopeptidase         68.6    3e-10   
ref|WP_028831222.1|  hypothetical protein                             65.1    3e-10   
ref|XP_008918522.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|XP_009319623.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|XP_004363438.2|  leukotriene A4 hydrolase                         68.6    3e-10   
gb|KFO61420.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
gb|KFU85483.1|  Leukotriene A-4 hydrolase                             68.6    3e-10   
ref|XP_011259417.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    3e-10   
ref|XP_010006375.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    4e-10   
ref|XP_008634895.1|  PREDICTED: leukotriene A-4 hydrolase             68.6    4e-10   
ref|XP_009817108.1|  PREDICTED: LOW QUALITY PROTEIN: leukotriene ...  68.6    4e-10   



>ref|XP_009774410.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X2 [Nicotiana 
sylvestris]
Length=531

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDSAHP T HISLTL+FDFPSSTIS+ATLLSL  PY+G LT DTRSLS+S+
Sbjct  1    MAPIDPHSFTDSAHPLTTHISLTLFFDFPSSTISSATLLSLPTPYTGPLTFDTRSLSVSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP+SLSPLPFSLSP  P   +GQS+TVSLS Q Q+L+LSKTSPSSSALQWLSPPQTFN
Sbjct  61   VLDPLSLSPLPFSLSPDSPI--LGQSLTVSLSNQTQILILSKTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQSIHARSIFPCQD
Sbjct  119  KTHPFVYTQCQSIHARSIFPCQD  141



>ref|XP_009774409.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X1 [Nicotiana 
sylvestris]
Length=611

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDSAHP T HISLTL+FDFPSSTIS+ATLLSL  PY+G LT DTRSLS+S+
Sbjct  1    MAPIDPHSFTDSAHPLTTHISLTLFFDFPSSTISSATLLSLPTPYTGPLTFDTRSLSVSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP+SLSPLPFSLSP  P   +GQS+TVSLS Q Q+L+LSKTSPSSSALQWLSPPQTFN
Sbjct  61   VLDPLSLSPLPFSLSPDSPI--LGQSLTVSLSNQTQILILSKTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQSIHARSIFPCQD
Sbjct  119  KTHPFVYTQCQSIHARSIFPCQD  141



>ref|XP_009611654.1| PREDICTED: leukotriene A-4 hydrolase homolog [Nicotiana tomentosiformis]
Length=612

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDSAHP T HISLTL+FDFPSSTIS+ATLLSL  PY G LTLDTRSLSIS+
Sbjct  1    MAPIDPHSFTDSAHPLTTHISLTLFFDFPSSTISSATLLSLPTPYIGPLTLDTRSLSISS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP+SLSPLPFSLS   P   +GQS++VSLS Q Q+L+LSKTSPSSSALQWLSPPQTFN
Sbjct  61   VLDPLSLSPLPFSLSSPDPI--LGQSLSVSLSNQTQILILSKTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQSIHARSIFPCQD
Sbjct  119  KTHPFVYTQCQSIHARSIFPCQD  141



>ref|XP_009591946.1| PREDICTED: leukotriene A-4 hydrolase homolog [Nicotiana tomentosiformis]
 ref|XP_009591947.1| PREDICTED: leukotriene A-4 hydrolase homolog [Nicotiana tomentosiformis]
Length=613

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T HISLT YFDFPSSTIS+ATLLSL  PY+G LTLDTRSLS+S+
Sbjct  1    MAPIDPHSFTDSTHPLTTHISLTFYFDFPSSTISSATLLSLPTPYTGPLTLDTRSLSVSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP+SLSPLPFSLSP      +GQS+TVSLS Q Q+L+LSKTSPSSSALQWLSPPQTFN
Sbjct  61   VLDPLSLSPLPFSLSPDSRV--LGQSLTVSLSNQTQILILSKTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYT CQ IHARSIFPCQD
Sbjct  119  KTHPYVYTHCQPIHARSIFPCQD  141



>gb|EYU39803.1| hypothetical protein MIMGU_mgv1a003035mg [Erythranthe guttata]
Length=613

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHS+TDS HP T HISL+ YFDFPSSTI +A +LSL+AP+SG  TLD RSLSISA
Sbjct  1    MAPIDPHSYTDSTHPLTTHISLSFYFDFPSSTIHSAAVLSLSAPHSGPFTLDLRSLSISA  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP +L+PLPF+  P+ PD V+GQS+TV+LS  +Q+LV+ KTSPSSSALQWL+PPQTFN
Sbjct  61   VVDPATLAPLPFTFHPASPDAVLGQSITVALSNHSQLLVVFKTSPSSSALQWLTPPQTFN  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+ PFVYTQCQ+IHARSIFPCQD
Sbjct  121  KSFPFVYTQCQAIHARSIFPCQD  143



>ref|XP_002311120.2| peptidase M1 family protein [Populus trichocarpa]
 gb|EEE88487.2| peptidase M1 family protein [Populus trichocarpa]
Length=622

 Score =   162 bits (411),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T HI+LTLYF FPSSTI A  LL+L  P++G L+LDTRSL+I  
Sbjct  1    MAPVDPHSFTDSTHPLTTHIALTLYFHFPSSTIHATALLTLQTPHTGQLSLDTRSLTIHK  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L+PLPF+LS S      G+ +TVSL+  + +L+L  TSPSSSALQWLSPPQTF 
Sbjct  61   ILDPETLTPLPFTLSSSEHQIN-GRHLTVSLNNHSSILILYSTSPSSSALQWLSPPQTFK  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQS+HARS+FPCQD
Sbjct  120  KIHPFVYTQCQSVHARSVFPCQD  142



>ref|XP_011004432.1| PREDICTED: leukotriene A-4 hydrolase homolog [Populus euphratica]
Length=622

 Score =   160 bits (406),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 96/143 (67%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T HI+LTLYF FPSSTI A  LL+L  P++G L+LDTR L+I  
Sbjct  1    MAPVDPHSFTDSTHPLTTHIALTLYFHFPSSTIHATALLTLQTPHTGQLSLDTRFLTIHK  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L+ LPF+LS S      G  +TVSL+  + +LVL  TSPSSSALQWLSPPQTF 
Sbjct  61   ILDPETLTTLPFTLSSSEHPIK-GHHLTVSLNNHSSILVLYSTSPSSSALQWLSPPQTFK  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQS+HARS+FPCQD
Sbjct  120  KIHPFVYTQCQSVHARSVFPCQD  142



>ref|XP_011084383.1| PREDICTED: leukotriene A-4 hydrolase homolog [Sesamum indicum]
Length=613

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS+TDS HP T HISL+ YFDF SSTI ++ +LSLAAPYSG  TLD+RSLSIS 
Sbjct  1    MALIDPHSYTDSTHPLTTHISLSFYFDFASSTILSSAVLSLAAPYSGAFTLDSRSLSISQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLD  +L+PLPF+L P+ PD ++GQS+TV+LS  +Q+LV+ KT+PSSSALQWLSPPQTFN
Sbjct  61   VLDIATLTPLPFTLQPTSPDAILGQSLTVTLSNHSQLLVIFKTAPSSSALQWLSPPQTFN  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+ PFVYTQCQ+IHARSIFPCQD
Sbjct  121  KSFPFVYTQCQAIHARSIFPCQD  143



>ref|XP_004237529.1| PREDICTED: leukotriene A-4 hydrolase homolog [Solanum lycopersicum]
Length=612

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T HISLT YFDFPSSTIS+ATL+S + PY+G LTLDTRSLS+S+
Sbjct  1    MAPIDPHSFTDSTHPLTTHISLTFYFDFPSSTISSATLVSFSTPYTGPLTLDTRSLSVSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQA-QVLVLSKTSPSSSALQWLSPPQTF  75
            VLDP+SLSPLPFSLSP+ P   +GQS+ +S+S Q  Q+L+LSKTSPSSSALQWLSP QTF
Sbjct  61   VLDPLSLSPLPFSLSPTDPI--LGQSLNISISKQTHQILILSKTSPSSSALQWLSPTQTF  118

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            NK HPF+YT CQ IHARSIFPCQD
Sbjct  119  NKNHPFLYTHCQPIHARSIFPCQD  142



>ref|XP_006340549.1| PREDICTED: leukotriene A-4 hydrolase-like [Solanum tuberosum]
Length=612

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 114/144 (79%), Gaps = 3/144 (2%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T HISLT YFDFPSSTIS+ATLLS + PY+G LTLDTRSLS+S 
Sbjct  1    MAPIDPHSFTDSTHPLTTHISLTFYFDFPSSTISSATLLSFSTPYTGPLTLDTRSLSVS-  59

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQA-QVLVLSKTSPSSSALQWLSPPQTF  75
                  LS  P   S S  DP++GQS+ +S+S Q  Q+L+LSKTSPSSSALQWLSP QTF
Sbjct  60   -YVLDPLSLSPLPFSLSPTDPILGQSLNISISKQTHQILILSKTSPSSSALQWLSPTQTF  118

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            NK HPF+YT CQ IHARSIFPCQD
Sbjct  119  NKNHPFLYTHCQPIHARSIFPCQD  142



>ref|XP_010693094.1| PREDICTED: leukotriene A-4 hydrolase homolog [Beta vulgaris subsp. 
vulgaris]
Length=612

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHS+TDS HPFT HISL+LYFDFPSSTI A+ LLSL++P+SG+L+LDTRSLSI++
Sbjct  1    MAPIDPHSYTDSTHPFTTHISLSLYFDFPSSTIHASALLSLSSPHSGNLSLDTRSLSITS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            ++DP +L+P+PFSLS        G  +TVSLS Q++ LV  KTS +SSALQWLSPPQTFN
Sbjct  61   IVDPKTLAPIPFSLSSETDAIK-GTLLTVSLSDQSEFLVSFKTSSNSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARSIFPCQD
Sbjct  120  KTSPFVYTQCQAIHARSIFPCQD  142



>ref|XP_011084382.1| PREDICTED: leukotriene A-4 hydrolase homolog [Sesamum indicum]
Length=613

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHS+ DS HP T HISL+LYFDF SSTI ++ +LSLAAPYSG  TLD+RSL IS 
Sbjct  1    MAPIDPHSYADSTHPLTTHISLSLYFDFASSTILSSAVLSLAAPYSGSFTLDSRSLLISD  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLD  +L+PLPF+L P+ PD ++GQS+TV+LS  +Q+LV+ KT+PSSSALQWLSP QTFN
Sbjct  61   VLDLATLTPLPFTLQPTSPDAILGQSLTVTLSDHSQLLVIFKTAPSSSALQWLSPAQTFN  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+ PFVYTQCQ+IHARS+FPCQD
Sbjct  121  KSFPFVYTQCQAIHARSVFPCQD  143



>ref|XP_011027038.1| PREDICTED: leukotriene A-4 hydrolase homolog [Populus euphratica]
Length=620

 Score =   157 bits (396),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISAvld  243
            +DPHSFTDS HP T H+SLTLYF FPSS I A  LL+L  PY+G L+LDTRSL+I  +LD
Sbjct  2    IDPHSFTDSTHPLTTHVSLTLYFRFPSSIIHATALLTLQTPYTGPLSLDTRSLTIHKILD  61

Query  242  pvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTH  63
            P + +PLPF+LS S      G+ +TV L   + VL+L  T PSSSALQWLSPPQTFNKTH
Sbjct  62   PATPAPLPFTLSSSEHPIK-GRLLTVYLDNNSSVLILYSTPPSSSALQWLSPPQTFNKTH  120

Query  62   PFVYTQCQSIHARSIFPCQD  3
            PFVYTQCQS+HARS+FPCQD
Sbjct  121  PFVYTQCQSVHARSVFPCQD  140



>ref|XP_010032239.1| PREDICTED: leukotriene A-4 hydrolase homolog [Eucalyptus grandis]
Length=612

 Score =   156 bits (394),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDSAHPFT HI L+ YFDFPSSTI ++ LLSL++P+SG L LDTRSL++ +
Sbjct  1    MAPVDPHSFTDSAHPFTTHIHLSFYFDFPSSTIHSSALLSLSSPHSGPLFLDTRSLTLLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP + +PLP+SLS   P    GQ++ VSLS  + VLV+  T+P+SSALQWL+PPQTFN
Sbjct  61   VLDPQTRNPLPYSLSDPDPIK--GQNLVVSLSNHSSVLVVYSTTPASSALQWLNPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K  PFVYTQCQSIHAR++FPCQD
Sbjct  119  KAFPFVYTQCQSIHARAVFPCQD  141



>ref|XP_002281209.1| PREDICTED: leukotriene A-4 hydrolase homolog [Vitis vinifera]
Length=611

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HPFT H+SL+LYFDF SSTI A+ LLS   P++G ++LD R+L+I +
Sbjct  1    MAPLDPHSFTDSTHPFTTHVSLSLYFDFASSTIHASALLSFQNPHTGPISLDARTLTIVS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V DPV+L+PLPFSLSP  P    G  +TVSLS  + +L+   TSP SSALQWL+PPQTFN
Sbjct  61   VTDPVTLAPLPFSLSPPDPIK--GCHLTVSLSNHSSILISYSTSPQSSALQWLTPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQSIHARS+FPCQD
Sbjct  119  KTHPFVYTQCQSIHARSVFPCQD  141



>emb|CAN78027.1| hypothetical protein VITISV_017527 [Vitis vinifera]
Length=611

 Score =   155 bits (392),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HPFT H+SL+LYFDF SSTI A+ LLS   P++G ++LD R+L+I +
Sbjct  1    MAPLDPHSFTDSTHPFTTHVSLSLYFDFASSTIHASALLSFQNPHTGPISLDARTLTIVS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V DPV+L+PLPFSLSP  P    G  +TVSLS  + +L+   TSP SSALQWL+PPQTFN
Sbjct  61   VTDPVTLAPLPFSLSPPDPIK--GCHLTVSLSNHSSILISYSTSPQSSALQWLTPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQSIHARS+FPCQD
Sbjct  119  KTHPFVYTQCQSIHARSVFPCQD  141



>emb|CDP04332.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA VDPHSFTDS HP T HISL+LYFDFPSSTI A+TL+SL   +SG  TLDTRSLSI++
Sbjct  1    MAAVDPHSFTDSTHPLTTHISLSLYFDFPSSTILASTLISLPTTHSGPFTLDTRSLSITS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L+PLPF+L+P +P PV GQS+ ++LS  +QV+++SKTS SSSALQWLSPPQTFN
Sbjct  61   VLDPTTLTPLPFTLTPPIPHPVFGQSLIITLSNHSQVIIISKTSASSSALQWLSPPQTFN  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            +  PFVYTQCQSIHARSIFPCQD
Sbjct  121  QAFPFVYTQCQSIHARSIFPCQD  143



>ref|XP_002316336.1| peptidase M1 family protein [Populus trichocarpa]
 gb|EEF02507.1| peptidase M1 family protein [Populus trichocarpa]
Length=620

 Score =   153 bits (387),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 93/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISAvld  243
            +DPHSFTDS HP T H+SLTLYF FPSSTI A  LL+L  P++G L+LDTRSL+I  +LD
Sbjct  2    IDPHSFTDSTHPLTTHVSLTLYFHFPSSTIHATALLTLQTPHTGPLSLDTRSLTIHKILD  61

Query  242  pvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTH  63
            P +L+PLPF+LS S      G+ +TV L   + VL+L  TSPSSSALQWLSPPQTFNKTH
Sbjct  62   PATLAPLPFTLSSSEHPIK-GRLLTVYLDNNSSVLILYSTSPSSSALQWLSPPQTFNKTH  120

Query  62   PFVYTQCQSIHARSIFPCQD  3
            PFVYTQC  +HARS+FPCQD
Sbjct  121  PFVYTQCHPVHARSVFPCQD  140



>emb|CDY09805.1| BnaC09g43560D [Brassica napus]
Length=614

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF +STI A+ LLSL++P+SG+L+LD+RS+SI +
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNASTIHASALLSLSSPFSGNLSLDSRSISIKS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L PL FS+SPS      G  V V L+GQ+Q+L+L  TSPS+SALQWLSP QTF+
Sbjct  61   ILDPQTLIPLHFSVSPSPDPIK-GSEVVVVLAGQSQILILYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>gb|KDO67881.1| hypothetical protein CISIN_1g0098532mg, partial [Citrus sinensis]
Length=238

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFT+S HP T HISL+LYFDF SSTI AA +L+LA+P++G L+LDTRSL+I  
Sbjct  1    MAPIDPHSFTESTHPLTTHISLSLYFDFSSSTIHAAAILTLASPHAGPLSLDTRSLTIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L+PLPF+LSP+      G+ + V+LS  + VL++  TSPSSSALQWLSPPQTFN
Sbjct  61   VLDPQTLTPLPFTLSPTDDPIK-GRHLIVTLSDHSSVLIVFSTSPSSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQ+IHARS+FPCQD
Sbjct  120  KLHPFVYTQCQAIHARSVFPCQD  142



>ref|XP_010558779.1| PREDICTED: leukotriene A-4 hydrolase homolog [Tarenaya hassleriana]
Length=614

 Score =   150 bits (379),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 89/143 (62%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T H++L+LY DF  STI  + +LSL+A +SGDL+LD+RS+SI  
Sbjct  1    MAPIDPHSFTDSTHPLTTHVALSLYLDFAISTIHGSAVLSLSAAFSGDLSLDSRSISIRK  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L+PLPF++S S      G  + VSLSG + +L++  TSPS+SALQWLSP QTF+
Sbjct  61   ILDPKTLTPLPFTVSSSPDPIR-GTQIVVSLSGHSSLLIVYSTSPSASALQWLSPAQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT P+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTQPYVYTQCQAIHARSIFPCQD  142



>ref|XP_006287291.1| hypothetical protein CARUB_v10000485mg [Capsella rubella]
 gb|EOA20189.1| hypothetical protein CARUB_v10000485mg [Capsella rubella]
Length=616

 Score =   149 bits (376),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 87/143 (61%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H++L+LY DF SS I  + LL+L++ ++G+L+LDTRS+SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVALSLYLDFNSSIIHGSALLTLSSAFNGELSLDTRSISIDM  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L PLP+ +S +      G  V V LSGQ+ +L++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLDPLPYRVSTTPDRIR-GTEVVVVLSGQSSLLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+HP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KSHPYVYTQCQAIHARSIFPCQD  142



>ref|NP_196856.1| peptidase M1 family protein [Arabidopsis thaliana]
 sp|Q9FY49.1|LKHA4_ARATH RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 
hydrolase; AltName: Full=Leukotriene A(4) hydrolase [Arabidopsis 
thaliana]
 emb|CAC05429.1| leukotriene-A4 hydrolase-like protein [Arabidopsis thaliana]
 gb|AAL67031.1| putative leukotriene-A4 hydrolase [Arabidopsis thaliana]
 gb|AAM91766.1| putative leukotriene-A4 hydrolase [Arabidopsis thaliana]
 gb|AED91907.1| peptidase M1 family protein [Arabidopsis thaliana]
Length=616

 Score =   149 bits (376),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 80/143 (56%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H++L+LY DF +S I  + LL+L++ +SG+L+LDTR +SI A
Sbjct  1    MAPIDPHSFTDSSHPLTTHVALSLYLDFNTSIIHGSALLTLSSAFSGELSLDTRCISI-A  59

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            ++              + PD + G  V V LSGQ+ +L++  TSPS+SALQWLSP QTF+
Sbjct  60   MVLDPLTLEPIPYSVSTTPDRIRGTEVVVVLSGQSSLLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KLHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_010260146.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X2 [Nelumbo 
nucifera]
Length=503

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS+HPF  H+SL++YFDF SSTI A++LL+L  PYSG ++LD RSLSI +
Sbjct  1    MAPVDPHSFTDSSHPFATHVSLSMYFDFASSTIHASSLLTLPTPYSGPISLDVRSLSIIS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP +L+PLPFSLS        GQ +TVSLS  +  LV   TSPSSSALQWLSPPQTF 
Sbjct  61   VVDPQTLTPLPFSLSTVPEPIK-GQHLTVSLSNHSSFLVAFSTSPSSSALQWLSPPQTFK  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  120  KTFPFVYTQCQAIHARSVFPCQD  142



>ref|XP_010260145.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X1 [Nelumbo 
nucifera]
Length=612

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS+HPF  H+SL++YFDF SSTI A++LL+L  PYSG ++LD RSLSI +
Sbjct  1    MAPVDPHSFTDSSHPFATHVSLSMYFDFASSTIHASSLLTLPTPYSGPISLDVRSLSIIS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP +L+PLPFSLS        GQ +TVSLS  +  LV   TSPSSSALQWLSPPQTF 
Sbjct  61   VVDPQTLTPLPFSLSTVPEPIK-GQHLTVSLSNHSSFLVAFSTSPSSSALQWLSPPQTFK  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  120  KTFPFVYTQCQAIHARSVFPCQD  142



>ref|XP_010101488.1| Leukotriene A-4 hydrolase-like protein [Morus notabilis]
 gb|EXB88485.1| Leukotriene A-4 hydrolase-like protein [Morus notabilis]
Length=608

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSF DS H F  HISL+LY DF SSTI  + LLSL  P+SG L+LD RSLSI +
Sbjct  1    MAPVDPHSFADSTHQFANHISLSLYLDFASSTIHGSALLSLPNPHSGPLSLDARSLSIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP S SPL FSLSP       G  +TVSLSG A  LV+  TSPSSSALQWLSPPQTFN
Sbjct  61   VLDPQSSSPLSFSLSPPDQIK--GCHLTVSLSGHASFLVVFSTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT+PFVYTQCQ+IHARS+FPCQD
Sbjct  119  KTYPFVYTQCQAIHARSVFPCQD  141



>ref|XP_002873616.1| peptidase M1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49875.1| peptidase M1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=616

 Score =   147 bits (371),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 86/143 (60%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H++L+LY DF +S I  + LL+L++ +SG+L+LDTR +SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVALSLYLDFNTSIIHGSALLTLSSAFSGELSLDTRCISIHM  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L PLP+ +S +      G  V V LSGQ+ +L++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLEPLPYRVSTTPDRIR-GTEVVVVLSGQSSLLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KLHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_006436185.1| hypothetical protein CICLE_v10030974mg [Citrus clementina]
 gb|ESR49425.1| hypothetical protein CICLE_v10030974mg [Citrus clementina]
Length=620

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFT+S HP T HISL+LYFDF SSTI AA +L+LA+P++G L+LDTRSL+I  
Sbjct  1    MAPIDPHSFTESTHPLTTHISLSLYFDFSSSTIHAAAILTLASPHAGPLSLDTRSLTIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L+ LPF+LSP+      G+ + V+LS  + VL++  TSPSSSALQWLSPPQTFN
Sbjct  61   VLDPQTLTQLPFTLSPTDDPIK-GRHLIVTLSDHSSVLIVFSTSPSSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQ+IHARS+FPCQD
Sbjct  120  KLHPFVYTQCQAIHARSVFPCQD  142



>ref|XP_010453430.1| PREDICTED: leukotriene A-4 hydrolase homolog [Camelina sativa]
Length=616

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF SS I  + LL+L++ +SG+L+LDTRS+SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNSSIIHGSALLTLSSAFSGELSLDTRSISIDT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L+PLP+ +S +      G  V V LSGQ+ VL++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLAPLPYRVSATPDPIR-GTQVVVVLSGQSSVLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+HP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KSHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_010492111.1| PREDICTED: leukotriene A-4 hydrolase homolog [Camelina sativa]
Length=616

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H++L+LY DF SS I  + LL+L++ +SG+L+LDTRS+SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVALSLYLDFNSSIIHGSALLTLSSAFSGELSLDTRSISIDT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L+ LP  +S +      G  V V LSGQ+ VL++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLASLPHRVSATPDPIR-GTQVIVVLSGQSSVLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+HP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KSHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_004307431.1| PREDICTED: leukotriene A-4 hydrolase homolog [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   145 bits (365),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+L+FDF SS I A+ LL+L +PYSG L+LD R L++ +
Sbjct  1    MAPIDPHSFTDSTHPLATHISLSLFFDFSSSLIHASALLTLPSPYSGPLSLDARGLTVLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++ SPLPFSLS   P    G  +T++LS  + V+++  T+P++SALQWLSPPQTFN
Sbjct  61   VLDPLTSSPLPFSLSSPEPIK--GCHLTLTLSNHSSVVIVYTTAPTASALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  119  KTLPFVYTQCQAIHARSVFPCQD  141



>ref|XP_010032240.1| PREDICTED: leukotriene A-4 hydrolase homolog [Eucalyptus grandis]
Length=612

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T HI L+ YFDFPSSTI ++ LLSL++P+SG L LDTRSL++ +
Sbjct  1    MAPVDPHSFTDSGHPLTTHIHLSFYFDFPSSTIHSSALLSLSSPHSGPLFLDTRSLTLLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP + +PLPFSLS   P    G+++ VSLS  + +LV+  T+P+SSALQWL+PPQTFN
Sbjct  61   VLDPQTRNPLPFSLSEPDPIK--GRNLVVSLSNHSSILVVYSTTPASSALQWLNPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K  PFVYTQCQSIHARS+FPCQD
Sbjct  119  KAFPFVYTQCQSIHARSVFPCQD  141



>ref|XP_010424081.1| PREDICTED: leukotriene A-4 hydrolase homolog [Camelina sativa]
Length=355

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF S  I  + LL+L++ +SG+L+LDTRS+SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNSFIIHGSALLTLSSAFSGELSLDTRSISIDT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L+ LP+ +S +      G  V V LSGQ+ VL++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLASLPYRVSATPDPIR-GTQVVVVLSGQSSVLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+H +VYTQCQ+IHARSIFPCQD
Sbjct  120  KSHHYVYTQCQAIHARSIFPCQD  142



>ref|XP_009357603.1| PREDICTED: leukotriene A-4 hydrolase homolog [Pyrus x bretschneideri]
Length=613

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+ +FDFPSSTI A+ LL+L APYSG L+LD R+L++ +
Sbjct  1    MAPIDPHSFTDSTHPLATHISLSFFFDFPSSTIHASALLTLPAPYSGPLSLDIRALTVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP   S     +         G  +T +LS  A VL+L  TSPSSSALQWLSPPQTFN
Sbjct  61   VIDPHKPSRPLSYVISHPDPIK-GCHLTFTLSNAASVLILYSTSPSSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  120  KTLPFVYTQCQAIHARSVFPCQD  142



>gb|KJB78902.1| hypothetical protein B456_013G024500 [Gossypium raimondii]
Length=619

 Score =   144 bits (363),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 92/146 (63%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T  ISL+LY DFPS+TI       L +P+ G L+ DTRSLSI  
Sbjct  1    MAPLDPHSFTDSHHPLTTDISLSLYLDFPSATIHGVAFFILKSPHVGQLSFDTRSLSIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQ---AQVLVLSKTSPSSSALQWLSPPQ  81
            VL P++LSPLPFSLS S      G  +++SL G    +   ++  TSPSSSALQWLSPPQ
Sbjct  61   VLSPITLSPLPFSLSSSPDPIK-GTQLSISLPGGDVLSSFFIVFSTSPSSSALQWLSPPQ  119

Query  80   TFNKTHPFVYTQCQSIHARSIFPCQD  3
            TFNK HPFVYTQCQ IHARSIFPCQD
Sbjct  120  TFNKKHPFVYTQCQCIHARSIFPCQD  145



>ref|XP_010419936.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X1 [Camelina 
sativa]
 ref|XP_010419937.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X2 [Camelina 
sativa]
Length=616

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF S  I  + LL+L++ +SG+L+LDTRS+SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNSFIIHGSALLTLSSAFSGELSLDTRSISIDT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP++L+ LP+ +S +      G  V V LSGQ+ VL++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPLTLASLPYRVSATPDPIR-GTQVVVVLSGQSSVLIVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K+H +VYTQCQ+IHARSIFPCQD
Sbjct  120  KSHHYVYTQCQAIHARSIFPCQD  142



>ref|XP_002523930.1| leukotriene A-4 hydrolase, putative [Ricinus communis]
 gb|EEF38499.1| leukotriene A-4 hydrolase, putative [Ricinus communis]
Length=619

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS HP T HISL+LYFDF +STI    L SL+ P++G ++LDTRSL++  
Sbjct  1    MAPVDPHSYTDSTHPLTTHISLSLYFDFSASTIHGTALFSLSTPHTGHISLDTRSLTVHK  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            + DPV+ + +PFSLSP +     G  +T+SL  Q+  L+L  TSPSSSALQWLSPPQTF 
Sbjct  61   IADPVTRALIPFSLSPEIDPIK-GCHLTLSLQNQSSFLILYSTSPSSSALQWLSPPQTFG  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K  PFVYTQCQSIHARS+FPCQD
Sbjct  120  KAQPFVYTQCQSIHARSVFPCQD  142



>ref|XP_008233387.1| PREDICTED: leukotriene A-4 hydrolase homolog [Prunus mume]
Length=589

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFT+S HP   HISL+L+FDFPSSTI A+ LL+L AP+SG L+LD R+L++ +
Sbjct  1    MAPIDPHSFTESTHPLATHISLSLFFDFPSSTIHASALLTLPAPHSGPLSLDARALTVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP S +PLPFSLS   P    G  +TVSLS  +  L++  TSPSSSALQWLSPPQTFN
Sbjct  61   VLDPQSSAPLPFSLSSPDPIK--GCHLTVSLSNHSSFLIVYSTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  119  KTLPFVYTQCQAIHARSVFPCQD  141



>ref|XP_007220632.1| hypothetical protein PRUPE_ppa003396mg [Prunus persica]
 gb|EMJ21831.1| hypothetical protein PRUPE_ppa003396mg [Prunus persica]
Length=578

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFT+S HP   HISL+L+FDFPSSTI A+ LL+L AP+SG L+LD R+L++ +
Sbjct  1    MAPIDPHSFTESTHPLATHISLSLFFDFPSSTIHASALLTLPAPHSGPLSLDARALTVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP S +PLPFSLS   P    G  +TVSLS  +  L++  TSPSSSALQWLSPPQTFN
Sbjct  61   VLDPQSSAPLPFSLSSPDPIK--GCHLTVSLSNHSSFLIVYSTSPSSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  119  KTLPFVYTQCQAIHARSVFPCQD  141



>gb|KHG18031.1| leukotriene a-4 hydrolase [Gossypium arboreum]
Length=619

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 90/146 (62%), Positives = 103/146 (71%), Gaps = 4/146 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T  ISL+LY DFP +TI       L +P+ G L+ DTRSLSI  
Sbjct  1    MAPLDPHSFTDSHHPLTTDISLSLYLDFPCATIHGVAFFILKSPHVGQLSFDTRSLSIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQ---AQVLVLSKTSPSSSALQWLSPPQ  81
            VL P++LSPLPFSLS S      G  +++SL          ++  TSPSSSALQWLSPPQ
Sbjct  61   VLSPITLSPLPFSLSSSPDPIK-GTQLSISLPDDDVLNSFFIVFSTSPSSSALQWLSPPQ  119

Query  80   TFNKTHPFVYTQCQSIHARSIFPCQD  3
            TFNK HPFVYTQCQ IHARSIFPCQD
Sbjct  120  TFNKKHPFVYTQCQCIHARSIFPCQD  145



>emb|CDX69635.1| BnaA10g19840D [Brassica napus]
Length=614

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF +STI A+ LL+L++P+SG+L+LD+RS+SI +
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNASTIHASALLTLSSPFSGNLSLDSRSISIKS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            ++DP +L+PLP S+S S      G  V V L+GQ+Q+L+L  TSPS+SALQWLSP QTF+
Sbjct  61   IIDPQTLTPLPHSVSSSPDPIK-GSEVVVVLAGQSQILILYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_009121758.1| PREDICTED: leukotriene A-4 hydrolase homolog [Brassica rapa]
Length=614

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY DF +STI A+ LL+L++P+SG+L+LD+RS+SI +
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLDFNASTIHASALLTLSSPFSGNLSLDSRSISIKS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            ++DP +L+PLP S+S S      G  V V L+GQ+Q+L+L  TSPS+SALQWLSP QTF+
Sbjct  61   IIDPQTLTPLPHSVSSSPDPIK-GSEVVVVLAGQSQILILYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_009378140.1| PREDICTED: leukotriene A-4 hydrolase homolog [Pyrus x bretschneideri]
Length=655

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+ +FDFPSSTI A+ LL+L A YSG L+LD R+L++ +
Sbjct  43   MAPIDPHSFTDSTHPLATHISLSFFFDFPSSTIHASALLTLPASYSGPLSLDIRALTVHS  102

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP   S     +         G  +T +LS  A VL+L  TSPSSSALQWLSPPQTFN
Sbjct  103  VIDPHKPSRPLSYVISHPDPIK-GCHLTFTLSNAASVLILYSTSPSSSALQWLSPPQTFN  161

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQCQ+IHARS+FPCQD
Sbjct  162  KTLPFVYTQCQAIHARSVFPCQD  184



>ref|XP_003592804.1| Leukotriene-A4 hydrolase-like protein [Medicago truncatula]
 gb|AES63055.1| leukotriene A-4 hydrolase-like protein [Medicago truncatula]
Length=607

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS HP T HISLTLY DFPSSTI A+ L +L  P+SG   LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHPPTTHISLTLYLDFPSSTIHASALFTLQTPHSGPFFLDTRSLDIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            + DP   +P+PFSLSP++     G  +T++LS     L+   TSPSSSALQWL PPQTFN
Sbjct  61   ITDPTQSTPIPFSLSPTIDPIK-GSKLTLTLSNHTSFLITYTTSPSSSALQWLLPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQ+IHARS+FPCQD
Sbjct  120  KKHPFVYTQCQAIHARSVFPCQD  142



>ref|XP_008384306.1| PREDICTED: leukotriene A-4 hydrolase homolog [Malus domestica]
Length=613

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+ +FDFPSSTI A+ LL+L APYSG L+LD R+L+I +
Sbjct  1    MAPIDPHSFTDSTHPLATHISLSFFFDFPSSTIHASALLTLPAPYSGPLSLDVRALTIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP + S     +         G  ++ +LS  + VL+L  TSPSSSALQWLSPPQTFN
Sbjct  61   VIDPQNPSDPISYVISPPDPVK-GCHLSFTLSNASSVLILYSTSPSSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K  PFVYTQCQ+IHARS+FPCQD
Sbjct  120  KRLPFVYTQCQAIHARSVFPCQD  142



>ref|XP_008463564.1| PREDICTED: leukotriene A-4 hydrolase homolog [Cucumis melo]
Length=613

 Score =   140 bits (353),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 87/143 (61%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS H   +H SL+L+FDFPS+ I A+ L++L+  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHAQVLHYSLSLFFDFPSTVIHASALITLSTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSP  P    G  ++++L GQ+ ++V+  T+  SSALQWLSPPQTFN
Sbjct  61   VIDPISHYPIPFSLSPPDPIK--GSLLSITLGGQSSLIVIYSTTVESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQ+IHARSIFP QD
Sbjct  119  KTHPFVYTQCQAIHARSIFPSQD  141



>ref|XP_004497366.1| PREDICTED: leukotriene A-4 hydrolase-like [Cicer arietinum]
Length=609

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T HISLTLY DF +STI A++L +L  PY+G  +LDTRSL I +
Sbjct  1    MAPVDPHSFTDSTHPPTTHISLTLYLDFQTSTIHASSLFTLQNPYAGPFSLDTRSLQIHS  60

Query  251  vldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTF  75
            ++DP S +  P     S     I G  +T++LS     L+   TSPSSSALQWL PPQTF
Sbjct  61   IIDPQSPNNTPIPFDLSQTPDPIKGSKLTLNLSNHTSFLIKYTTSPSSSALQWLLPPQTF  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            NK H FVYTQCQ+IHARSIFPCQD
Sbjct  121  NKKHSFVYTQCQAIHARSIFPCQD  144



>ref|XP_007009681.1| Peptidase M1 family protein isoform 2 [Theobroma cacao]
 gb|EOY18491.1| Peptidase M1 family protein isoform 2 [Theobroma cacao]
Length=527

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS H  T HI+L+LYFDFPS+TI  A L +L++P+SG L LDTRSLSI  
Sbjct  1    MAPLDPHSFTDSTHTLTTHIALSLYFDFPSATIHGAALFTLSSPHSGPLCLDTRSLSIHR  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQV---LVLSKTSPSSSALQWLSPPQ  81
            VL P +LSPLP+SLSP       G  +++SL   A +   L+   TSPSSSALQWLSPPQ
Sbjct  61   VLSPSTLSPLPYSLSPFCDPIK-GTHLSLSLPNDAALSSFLITFSTSPSSSALQWLSPPQ  119

Query  80   TFNKTHPFVYTQCQSIHARSIFPCQD  3
            TFNK HPFVYTQCQSIHARS+FPCQD
Sbjct  120  TFNKKHPFVYTQCQSIHARSVFPCQD  145



>ref|XP_007009680.1| Peptidase M1 family protein isoform 1 [Theobroma cacao]
 gb|EOY18490.1| Peptidase M1 family protein isoform 1 [Theobroma cacao]
Length=619

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS H  T HI+L+LYFDFPS+TI  A L +L++P+SG L LDTRSLSI  
Sbjct  1    MAPLDPHSFTDSTHTLTTHIALSLYFDFPSATIHGAALFTLSSPHSGPLCLDTRSLSIHR  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQV---LVLSKTSPSSSALQWLSPPQ  81
            VL P +LSPLP+SLSP       G  +++SL   A +   L+   TSPSSSALQWLSPPQ
Sbjct  61   VLSPSTLSPLPYSLSPFCDPIK-GTHLSLSLPNDAALSSFLITFSTSPSSSALQWLSPPQ  119

Query  80   TFNKTHPFVYTQCQSIHARSIFPCQD  3
            TFNK HPFVYTQCQSIHARS+FPCQD
Sbjct  120  TFNKKHPFVYTQCQSIHARSVFPCQD  145



>gb|KDP46145.1| hypothetical protein JCGZ_06656 [Jatropha curcas]
Length=618

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T HISL+LYFDF SSTI +  LLSL+A ++G +++DTRSL+I  
Sbjct  1    MAPVDPHSFTDSTHPLTTHISLSLYFDFASSTIYSTALLSLSAAHTGPISIDTRSLTIYK  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L PLPF+LSP  P    G  +TVSL   A VL+   TSP SSALQWLSPPQTF 
Sbjct  61   VLDPQTLIPLPFTLSPPDPIK--GSLLTVSLHNHASVLIFFCTSPDSSALQWLSPPQTFG  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFV+TQCQ+IHARS+FPCQD
Sbjct  119  KIHPFVFTQCQAIHARSVFPCQD  141



>ref|XP_008369777.1| PREDICTED: leukotriene A-4 hydrolase homolog [Malus domestica]
Length=655

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+ +FDFPSSTI A+ LL+L APYSG L+LD R+L++ +
Sbjct  43   MAPIDPHSFTDSTHPLATHISLSFFFDFPSSTIHASALLTLPAPYSGPLSLDIRALTVHS  102

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP   S     +         G  +T +LS  A V +L  TSPSSSALQWLS PQTFN
Sbjct  103  VIDPHKPSRPLSYVISHPDPIK-GCHLTFTLSNAASVXILYSTSPSSSALQWLSXPQTFN  161

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KT PFVYTQC +IHARS+FPCQD
Sbjct  162  KTLPFVYTQCXAIHARSVFPCQD  184



>ref|XP_006399845.1| hypothetical protein EUTSA_v10012982mg [Eutrema salsugineum]
 gb|ESQ41298.1| hypothetical protein EUTSA_v10012982mg [Eutrema salsugineum]
Length=616

 Score =   136 bits (343),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H++L+LY DF +S I  + LLSL++ +SGDL+LD+R +SI  
Sbjct  1    MAPIDPHSFTDSSHPLTTHVALSLYLDFNTSIIHGSALLSLSSAFSGDLSLDSRCISIDM  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L  LPF +S +      G  + VSLSGQ+ +L++  TSPS+SALQWLSP QTF+
Sbjct  61   VLDPQTLERLPFHVSTNPDPIR-GTEIVVSLSGQSSLLLVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_006485956.1| PREDICTED: leukotriene A-4 hydrolase homolog [Citrus sinensis]
Length=620

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFT+S HP T HISL+LYFDF SSTI AA +L+LA+P++G L+LDTRSL+I  
Sbjct  1    MAPIDPHSFTESTHPLTTHISLSLYFDFSSSTIHAAAILTLASPHAGPLSLDTRSLTIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            VLDP +L+ LPF+LSP+      G+ + V+LS  + VL++  +SPSSSALQWLSPPQTFN
Sbjct  61   VLDPQTLTQLPFTLSPTDDPIK-GRHLIVTLSDHSSVLIVFSSSPSSSALQWLSPPQTFN  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HPFVYTQCQ+IHARS+FPCQD
Sbjct  120  KLHPFVYTQCQAIHARSVFPCQD  142



>ref|XP_004143812.1| PREDICTED: leukotriene A-4 hydrolase homolog [Cucumis sativus]
Length=611

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS HP  +H SL+L+FDFPS+ I A+ L++L+  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHPQALHYSLSLFFDFPSTLIHASALITLSTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSPS P    G  ++++L+GQ+ ++V   T+  SSALQWLSPPQTFN
Sbjct  61   VIDPMSHYPIPFSLSPSDPIK--GSLLSITLAGQSSLIVTYTTTLESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQ+IHARSIFP QD
Sbjct  119  KTHPFVYTQCQAIHARSIFPSQD  141



>emb|CDX85643.1| BnaA02g01700D [Brassica napus]
Length=612

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS+HP T H+SL+LY  FP+STI A+ LL+L++P+SG L+LD+RSLS+S+
Sbjct  1    MAPIDPHSFTDSSHPLTTHVSLSLYLSFPTSTIHASALLTLSSPFSGTLSLDSRSLSLSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +LSPLP SLSP+      G  ++V LSGQ+Q+L++  TSP++SALQWLSPPQTF+
Sbjct  61   ILDPKTLSPLPHSLSPTPDPIR-GTEISVVLSGQSQILIIYSTSPAASALQWLSPPQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_004164966.1| PREDICTED: leukotriene A-4 hydrolase homolog [Cucumis sativus]
Length=613

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS HP  +H SL+L+FDFPS+ I A+ L++++  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHPQALHYSLSLFFDFPSTLIHASALITISTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSPS P    G  ++++L+GQ+ ++V   T+  SSALQWLSPPQTFN
Sbjct  61   VIDPISHYPIPFSLSPSDPIK--GSLLSITLAGQSSLIVTYTTTLESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQCQ+IHARSIFP QD
Sbjct  119  KTHPFVYTQCQAIHARSIFPSQD  141



>ref|XP_006828276.1| hypothetical protein AMTR_s00023p00220060 [Amborella trichopoda]
 gb|ERM95692.1| hypothetical protein AMTR_s00023p00220060 [Amborella trichopoda]
Length=369

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            M PVDPHS+ DS+ PF  H++L+L+FDFPS TI  + LLSL  P++G LTLDTRSLSIS+
Sbjct  1    MDPVDPHSYADSSQPFASHLALSLFFDFPSRTIHGSALLSLPRPHAGPLTLDTRSLSISS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL--SGQAQVLVLSKTSPSSSALQWLSPPQT  78
             +DP+S +PLPFSLSP +     GQS+T++L  S  A VL+   TSP +SA+QWLSPPQT
Sbjct  61   AIDPLSSTPLPFSLSPIVDPIK-GQSLTITLPDSALASVLLTFTTSPQASAIQWLSPPQT  119

Query  77   FNKTHPFVYTQCQSIHARSIFPCQD  3
              KTHP+VYTQCQ+IH RSIFPCQD
Sbjct  120  ALKTHPYVYTQCQAIHTRSIFPCQD  144



>gb|KGN51243.1| hypothetical protein Csa_5G503560 [Cucumis sativus]
Length=613

 Score =   133 bits (335),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS H   +H SL+ +FDFPS+ I A+ L++L+  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHAQILHYSLSFFFDFPSTLIHASALITLSTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSPS P    G  ++++L GQ+ ++V   T+  SSALQWLSPPQTFN
Sbjct  61   VIDPMSHYPIPFSLSPSDPIK--GSLLSITLGGQSALIVTYSTTVESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQC  IHARSI P QD
Sbjct  119  KTHPFVYTQCHPIHARSILPSQD  141



>ref|XP_004149822.1| PREDICTED: leukotriene A-4 hydrolase homolog [Cucumis sativus]
Length=613

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS H   +H SL+ +FDFPS+ I A+ L++L+  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHAQILHYSLSFFFDFPSTLIHASALITLSTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSPS P    G  ++++L GQ+ ++V   T+  SSALQWLSPPQTFN
Sbjct  61   VIDPMSHYPIPFSLSPSDPIK--GSLLSITLGGQSALIVTYSTTVESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQC  IHARSI P QD
Sbjct  119  KTHPFVYTQCHPIHARSILPSQD  141



>ref|XP_009125918.1| PREDICTED: leukotriene A-4 hydrolase homolog [Brassica rapa]
Length=612

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T H+SL+LY  FP+STI A+ LL+L++P+SG L+LD+RSLS+S+
Sbjct  1    MAPIDPHSFTDSTHPLTTHVSLSLYLSFPTSTIHASALLTLSSPFSGTLSLDSRSLSLSS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L PLP SLSP+      G  ++V LSGQ+Q+L++  TSP++SALQWLSPPQTF+
Sbjct  61   ILDPQTLHPLPHSLSPTPDPIR-GTEISVVLSGQSQILLIYSTSPAASALQWLSPPQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>gb|KFK25582.1| hypothetical protein AALP_AA8G133600 [Arabis alpina]
Length=528

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSF DS HP T H+SL+LY DF +  I A+ LL+L++ +SGDL+LD+RS+SI+ 
Sbjct  1    MAPIDPHSFIDSTHPLTTHVSLSLYLDFNTQIIHASALLTLSSSFSGDLSLDSRSISINT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            +LDP +L PLP+S+S +      G  + VSLSGQ+ +L++  TSPS+SALQWLSP QTF+
Sbjct  61   ILDPKTLDPLPYSISTNPDRIR-GTEIIVSLSGQSSLLLVYSTSPSASALQWLSPLQTFS  119

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHP+VYTQCQ+IHARSIFPCQD
Sbjct  120  KTHPYVYTQCQAIHARSIFPCQD  142



>ref|XP_009378139.1| PREDICTED: leukotriene A-4 hydrolase homolog [Pyrus x bretschneideri]
Length=659

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 103/147 (70%), Gaps = 5/147 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP   HISL+ +FDFPSSTI A+ LL+L A YSG L+LD R+L++ +
Sbjct  43   MAPIDPHSFTDSTHPLATHISLSFFFDFPSSTIHASALLTLPASYSGPLSLDIRALTVHS  102

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP   S     +         G  +T +LS  A VL+L  TSPSSSALQWLS PQTFN
Sbjct  103  VIDPHKPSRPLSYVISHPDPIK-GCHLTFTLSNAASVLILYSTSPSSSALQWLSLPQTFN  161

Query  71   K----THPFVYTQCQSIHARSIFPCQD  3
            K    T PFVYTQC +IHARS+FPCQD
Sbjct  162  KTLPFTLPFVYTQCHAIHARSVFPCQD  188



>ref|XP_009396855.1| PREDICTED: leukotriene A-4 hydrolase homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396856.1| PREDICTED: leukotriene A-4 hydrolase homolog [Musa acuminata 
subsp. malaccensis]
Length=614

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSI-S  255
            MA +DPHS+T+S+ P   H++LTLYFDF + TI  + LL+L A ++G L LDTRSL I S
Sbjct  1    MARLDPHSYTESSQPLAKHVALTLYFDFAARTIHGSALLTLPAAHTGPLLLDTRSLVIHS  60

Query  254  AvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTF  75
             +    +        S   PDPV+GQ +++SLS Q+  LV+  TSPSSSALQWLSP QT 
Sbjct  61   VLDRHTNAPIPFSFPSDPTPDPVLGQPLSLSLSAQSAALVVFSTSPSSSALQWLSPAQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +K HPFVYTQCQSIHARS+FPCQD
Sbjct  121  SKAHPFVYTQCQSIHARSLFPCQD  144



>ref|XP_008465548.1| PREDICTED: leukotriene A-4 hydrolase homolog, partial [Cucumis 
melo]
Length=328

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS++DS HP  +H SL+L+F FPS+ I+A+ LL+L+  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYSDSTHPQVLHYSLSLFFHFPSTLINASALLTLSTSYCGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S   +PFSLSP  P    G  ++++L GQ+  +V+  T+  SSALQWLSPPQTFN
Sbjct  61   VIDPISYYLIPFSLSPPDPIK--GSLLSIALGGQSSFIVIYSTTAQSSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            +THPFVYTQC  IHARSIFP QD
Sbjct  119  QTHPFVYTQCHPIHARSIFPSQD  141



>gb|KGN51242.1| hypothetical protein Csa_5G497060 [Cucumis sativus]
Length=613

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TDS HP  +H SL+L+FDFPS+ I A+ L++++  Y G ++LDTRSL I +
Sbjct  1    MAPVDPHSYTDSTHPQALHYSLSLFFDFPSTLIHASALITISTSYYGSISLDTRSLIIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+DP+S  P+PFSLSPS P    G  ++++L+GQ+ ++V   T+  SSALQWLSPPQTFN
Sbjct  61   VIDPMSHYPIPFSLSPSDPIK--GSLLSITLAGQSSLIVTYTTTLESSALQWLSPPQTFN  118

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            KTHPFVYTQC  IHARSI P QD
Sbjct  119  KTHPFVYTQCHPIHARSILPSQD  141



>gb|ADE75697.1| unknown [Picea sitchensis]
Length=614

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTDS HP T H+ L+LYFDF S TI  + +L+L +PYSGDL LDTR L I  
Sbjct  1    MAPVDPHSFTDSLHPLTKHVHLSLYFDFDSKTIDGSAILTLESPYSGDLYLDTRCLKIHG  60

Query  251  vldpvslsplpfslspslpdp---VIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQ  81
            V    + S    +  P + +    + G  + VSL+ Q   ++  KT  S+SA+QWL+P Q
Sbjct  61   VYHDTTKSFSSSASIPFILENPDPIKGTLLRVSLTNQISFIITFKTDQSASAIQWLNPAQ  120

Query  80   TFNKTHPFVYTQCQSIHARSIFPCQD  3
            T  K  P+VY QCQSI+ARSIFPCQD
Sbjct  121  TAGKKFPYVYAQCQSIYARSIFPCQD  146



>dbj|BAK01914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=615

 Score =   120 bits (300),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 5/147 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP T H +L  Y DF +STI A+ L++L+AP++GDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVTAHAALVFYLDFAASTIHASALVTLSAPHTGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfs---lspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPP  84
                 +    P        +  DPV+G ++T++L    A  L+   TSPS+SALQWL+PP
Sbjct  61   ATTAPAPDAAPSPIPFSLAADADPVLGTALTLALPPDTASFLLTFSTSPSASALQWLAPP  120

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT +   PFV++QCQSIHARS+FPC D
Sbjct  121  QTASGL-PFVFSQCQSIHARSVFPCHD  146



>ref|XP_008783659.1| PREDICTED: leukotriene A-4 hydrolase homolog [Phoenix dactylifera]
Length=613

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHS  D++ PF  H+SLTLY DF +STI  + LL+L +P++G LTLDTRSLS  +
Sbjct  1    MAPLDPHSCADASQPFANHVSLTLYLDFATSTILGSALLTLPSPHTGPLTLDTRSLSNLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
             LDP+S SPLPFSLSPS PD ++GQ++TVSLS  + +L+   T+P+SSALQWLSP QT +
Sbjct  61   ALDPLSGSPLPFSLSPSNPDRILGQALTVSLSSHSSLLLTFSTTPASSALQWLSPAQTSS  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            ++HPFV+TQCQSIHARSIFPCQD
Sbjct  121  RSHPFVFTQCQSIHARSIFPCQD  143



>ref|XP_003563705.1| PREDICTED: leukotriene A-4 hydrolase homolog [Brachypodium distachyon]
Length=611

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP T H++L  Y DF +S I A+ L++L+AP+SGD+ LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVTSHLALAFYLDFSASAIHASALVTLSAPHSGDILLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            +  DPV+G ++T++L       +L+  TSP++SALQWLSPPQT 
Sbjct  61   ATTTTDAPSPIPFSLAADADPVLGTALTLTLPPNTSSFLLTFSTSPAASALQWLSPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +   PFV++QCQSIHARS+FPC D
Sbjct  121  SAL-PFVFSQCQSIHARSVFPCHD  143



>ref|XP_006650799.1| PREDICTED: leukotriene A-4 hydrolase homolog [Oryza brachyantha]
Length=611

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHSFTD  HP T   +L  Y DF +STI A+ LL+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSFTDGDHPVTAKAALAFYLDFAASTIHASALLTLSAPHSGDLLLDTRALTVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                               DPV+G ++T+SL       +L+  TSPS+SALQWLSPPQT 
Sbjct  61   ASTTSDPPAPVPFSLADAADPVLGSALTLSLPPDTTSFLLTFSTSPSASALQWLSPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            + + PFV++QCQSIHARS+FPC D
Sbjct  121  S-SQPFVFSQCQSIHARSVFPCHD  143



>ref|XP_010922491.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHSF D++HPF  H+SLT Y DF +STI  + LL+L +P+ G LTLDTRSLS  +
Sbjct  1    MALLDPHSFADASHPFATHVSLTFYLDFATSTILGSALLTLPSPHMGPLTLDTRSLSNLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
             LDP+SLSPLPFSLSPS PDPV+GQS+TVSLS  + +L+   T+P+SSALQWLSP QT +
Sbjct  61   ALDPLSLSPLPFSLSPSNPDPVLGQSLTVSLSSHSSLLLTFSTTPASSALQWLSPAQTSS  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            +++PFVYTQC SIHARSIFPCQD
Sbjct  121  RSYPFVYTQCLSIHARSIFPCQD  143



>ref|XP_010922490.1| PREDICTED: leukotriene A-4 hydrolase homolog isoform X1 [Elaeis 
guineensis]
Length=613

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHSF D++HPF  H+SLT Y DF +STI  + LL+L +P+ G LTLDTRSLS  +
Sbjct  1    MALLDPHSFADASHPFATHVSLTFYLDFATSTILGSALLTLPSPHMGPLTLDTRSLSNLS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
             LDP+SLSPLPFSLSPS PDPV+GQS+TVSLS  + +L+   T+P+SSALQWLSP QT +
Sbjct  61   ALDPLSLSPLPFSLSPSNPDPVLGQSLTVSLSSHSSLLLTFSTTPASSALQWLSPAQTSS  120

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            +++PFVYTQC SIHARSIFPCQD
Sbjct  121  RSYPFVYTQCLSIHARSIFPCQD  143



>tpg|DAA52184.1| TPA: hypothetical protein ZEAMMB73_681220, partial [Zea mays]
Length=530

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP     +L  Y DF +STI A+ +L+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVVSRAALAFYLDFAASTIHASAVLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            + PDPV+G ++T++L        L+  TSP++SALQWL+PPQT 
Sbjct  61   ASTDADPPEPIPFSLAAAPDPVLGTALTLALPRDTASFRLTFSTSPAASALQWLAPPQT-  119

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
                PFV++QCQSIHARS+FPC D
Sbjct  120  ASAQPFVFSQCQSIHARSVFPCHD  143



>ref|XP_008644156.1| PREDICTED: uncharacterized protein LOC100382637 isoform X1 [Zea 
mays]
Length=539

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP     +L  Y DF +STI A+ +L+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVVSRAALAFYLDFAASTIHASAVLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            + PDPV+G ++T++L        L+  TSP++SALQWL+PPQT 
Sbjct  61   ASTDADPPEPIPFSLAAAPDPVLGTALTLALPRDTASFRLTFSTSPAASALQWLAPPQT-  119

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
                PFV++QCQSIHARS+FPC D
Sbjct  120  ASAQPFVFSQCQSIHARSVFPCHD  143



>gb|ACN28213.1| unknown [Zea mays]
 gb|ACN34292.1| unknown [Zea mays]
 tpg|DAA52185.1| TPA: hypothetical protein ZEAMMB73_681220 [Zea mays]
 tpg|DAA52186.1| TPA: hypothetical protein ZEAMMB73_681220 [Zea mays]
Length=611

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP     +L  Y DF +STI A+ +L+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVVSRAALAFYLDFAASTIHASAVLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            + PDPV+G ++T++L        L+  TSP++SALQWL+PPQT 
Sbjct  61   ASTDADPPEPIPFSLAAAPDPVLGTALTLALPRDTASFRLTFSTSPAASALQWLAPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +   PFV++QCQSIHARS+FPC D
Sbjct  121  S-AQPFVFSQCQSIHARSVFPCHD  143



>ref|XP_002466200.1| hypothetical protein SORBIDRAFT_01g003380 [Sorghum bicolor]
 gb|EER93198.1| hypothetical protein SORBIDRAFT_01g003380 [Sorghum bicolor]
Length=611

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP     +L  Y DF +STI A+ LL+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVVSRAALAFYLDFAASTIHASALLTLSAPHSGDLLLDTRALTVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            + PDPV+G ++T++L        L+  TSP++SALQWL+PPQT 
Sbjct  61   ASTDADTPEPIPFSLAAAPDPVLGTALTLTLPPDTTSFRLTFSTSPAASALQWLAPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +   PFV++QCQSIHARSIFPC D
Sbjct  121  S-GQPFVFSQCQSIHARSIFPCHD  143



>ref|NP_001168832.1| uncharacterized protein LOC100382637 [Zea mays]
 gb|ACN30817.1| unknown [Zea mays]
Length=611

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP     +L  Y DF +STI A+ +L+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVISRAALAFYLDFAASTIHASAVLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                            ++PDPV+G ++T++L        L+  TSP++SALQWL+PPQT 
Sbjct  61   ASTDADPPEPIPFSLAAVPDPVLGTALTLALPRDTASFRLTFSTSPAASALQWLAPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +   PFV++QCQSIHARS+FPC D
Sbjct  121  S-AQPFVFSQCQSIHARSVFPCHD  143



>gb|EAY92357.1| hypothetical protein OsI_14085 [Oryza sativa Indica Group]
Length=611

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            M PVDPHS+TD  HP T   +L  Y DF +STI A+ LL+L+AP+SGDL LDTR+L++ +
Sbjct  1    MPPVDPHSYTDGDHPVTAKAALAFYLDFAASTIHASALLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                               DPV+G ++T++L       +L+  TSPS+SALQWLSPPQT 
Sbjct  61   ASTASDPPSPIPFSLADAADPVLGSALTLTLPPDTTSFLLTFSTSPSASALQWLSPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            + + PFV++QCQSIHARS+FPC D
Sbjct  121  S-SLPFVFSQCQSIHARSVFPCHD  143



>ref|NP_001051710.1| Os03g0819100 [Oryza sativa Japonica Group]
 sp|Q84TA3.1|LKHA4_ORYSJ RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 
hydrolase; AltName: Full=Leukotriene A(4) hydrolase [Oryza sativa 
Japonica Group]
 gb|AAO65874.1| putative leukotriene A-4 hydrolase [Oryza sativa Japonica Group]
 gb|ABF99571.1| Peptidase family M1 containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13624.1| Os03g0819100 [Oryza sativa Japonica Group]
 gb|EAZ29074.1| hypothetical protein OsJ_13129 [Oryza sativa Japonica Group]
Length=611

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            M PVDPHS+TD  HP T   +L  Y DF +STI A+ LL+L+AP+SGDL LDTR+L++ +
Sbjct  1    MPPVDPHSYTDGDHPVTAKAALAFYLDFAASTIHASALLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                               DPV+G ++T++L       +L+  TSPS+SALQWLSPPQT 
Sbjct  61   ASTASGPPSPIPFSLADAADPVLGSALTLTLPPDTTSFLLTFSTSPSASALQWLSPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            + + PFV++QCQSIHARS+FPC D
Sbjct  121  S-SLPFVFSQCQSIHARSVFPCHD  143



>ref|XP_004981267.1| PREDICTED: leukotriene A-4 hydrolase homolog [Setaria italica]
Length=611

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAPVDPHS+TD AHP   H +L  Y DF +STI A+ LL+L+AP+SGDL LDTR+L++ +
Sbjct  1    MAPVDPHSYTDGAHPVVSHAALAFYLDFAASTIHASALLTLSAPHSGDLLLDTRALAVHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
            V               + PDPV+G ++T++L        L+  TSP +SALQWL+PPQT 
Sbjct  61   VSTAADPPEPIPFSLAASPDPVLGSALTLTLPPDTTSFRLTFSTSPDASALQWLAPPQTA  120

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
            +   PFV++QCQSIHARSIFP  D
Sbjct  121  S-GQPFVFSQCQSIHARSIFPSHD  143



>gb|KHN27095.1| Leukotriene A-4 hydrolase [Glycine soja]
Length=610

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA VDPHSFTDS    T H++L+LY D PSSTI A+ L SL  P+SG   LDTRSL+I +
Sbjct  1    MAAVDPHSFTDSRQARTRHVALSLYLDLPSSTIHASALFSLQTPHSGPFYLDTRSLTIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+ P + +P+PFSLS   P    G  ++ +LS  +  L+   TSPSSSALQWL PPQ+  
Sbjct  61   VIHPKTQTPIPFSLSDPDPIK--GSLLSFTLSDHSSFLISYSTSPSSSALQWLLPPQS--  116

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
             +HPFVYTQCQSIHARS+FPCQD
Sbjct  117  -SHPFVYTQCQSIHARSVFPCQD  138



>ref|XP_002967717.1| hypothetical protein SELMODRAFT_88325 [Selaginella moellendorffii]
 gb|EFJ31064.1| hypothetical protein SELMODRAFT_88325 [Selaginella moellendorffii]
Length=619

 Score =   100 bits (249),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISAvld  243
            +DPHS+ D +   T  I+L L+ DF    I  +   +L   +SGD  LDTR L +    D
Sbjct  1    MDPHSYADFSQLLTDSIALDLFLDFERRIIVGSADFTLRQAFSGDFVLDTRDLLVRGAFD  60

Query  242  pvslsplpfslspslpdpVI-GQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTFNK  69
              S +  P +   S     I GQ + + L S  ++ L+L  TSP +SALQWL P Q  + 
Sbjct  61   SSSPAKKPLAFDISSERHPIKGQRLVLHLPSPTSRFLILFTTSPQASALQWLDPSQASSG  120

Query  68   THPFVYTQCQSIHARSIFPCQD  3
             HPFVYT CQ++HARSIFPCQD
Sbjct  121  KHPFVYTHCQALHARSIFPCQD  142



>ref|XP_002964317.1| hypothetical protein SELMODRAFT_82151 [Selaginella moellendorffii]
 gb|EFJ34650.1| hypothetical protein SELMODRAFT_82151 [Selaginella moellendorffii]
Length=616

 Score =   100 bits (249),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISAvld  243
            +DPHS+ D +   T  I+L L+ DF    I  +   +L   +SGD  LDTR L +    D
Sbjct  1    MDPHSYADFSQLLTDSIALDLFLDFERRIIVGSADFTLRQAFSGDFVLDTRDLLVRGAFD  60

Query  242  pvslsplpfslspslpdpVI-GQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTFNK  69
              S +  P +   S     I GQ + + L S  ++ L+L  TSP +SALQWL P Q  + 
Sbjct  61   SSSPAKKPLAFDISSERHPIKGQRLVLHLPSPTSRFLILFTTSPQASALQWLDPSQASSG  120

Query  68   THPFVYTQCQSIHARSIFPCQD  3
             HPFVYT CQ++HARSIFPCQD
Sbjct  121  KHPFVYTHCQALHARSIFPCQD  142



>ref|XP_003556555.1| PREDICTED: leukotriene A-4 hydrolase homolog [Glycine max]
Length=610

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 5/143 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA VDPHSFTDS    T H++L+LY D PSSTI A+ L SL   +SG   LDTRSL+I +
Sbjct  1    MAAVDPHSFTDSRQAGTRHVALSLYLDLPSSTIHASALFSLQTSHSGPFYLDTRSLTIHS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFN  72
            V+ P + +P+PFSLS   P    G  ++ +LS  +  L+   TSPSSSALQWL PPQ+  
Sbjct  61   VIHPKTQTPIPFSLSDPDPIK--GSLLSFTLSDHSSFLISYSTSPSSSALQWLLPPQS--  116

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
             +HPFVYTQCQSIHARS+FPCQD
Sbjct  117  -SHPFVYTQCQSIHARSVFPCQD  138



>gb|KFB46576.1| AGAP009907-PA-like protein [Anopheles sinensis]
Length=645

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 6/157 (4%)
 Frame = -2

Query  455  RSPCKTEVMAPVDPHSFTDSAHPFTVHISL--TLYFDFPsstisaatllslaAPYSGDLT  282
            +S   T  ++P+DP S++++      H+ L  T+ FD  + + +A     L      ++ 
Sbjct  25   KSSITTMRLSPLDPSSYSNAHELIIRHVDLDWTVNFDKSTISGTATLHFKLLKSELQEIF  84

Query  281  LDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPS  114
            LD   ++IS+V    S    P           IG  +T+ L    SG+  +++  +TSP 
Sbjct  85   LDVSDITISSVAVKTSAGEAPVDWDVGGTVDNIGTKLTIYLPTKTSGELTLVIAYETSPK  144

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +SALQWL+P QTF K HP++++QCQ+IHARSI PCQD
Sbjct  145  ASALQWLTPEQTFGKKHPYLFSQCQAIHARSILPCQD  181



>ref|WP_002613661.1| peptidase M1 [Stigmatella aurantiaca]
 gb|EAU66788.1| leukotriene A-4 hydrolase (LTA-4 hydrolase) (LeukotrieneA(4) 
hydrolase) [Stigmatella aurantiaca DW4/3-1]
 gb|ADO73669.1| Peptidase, M1 (Aminopeptidase N) family [Stigmatella aurantiaca 
DW4/3-1]
Length=584

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 60/144 (42%), Positives = 78/144 (54%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHSF D   P T  +      DF +  + A   L+L    +G L LDTR L I A
Sbjct  1    MARLDPHSFNDDTQPATESLDWKARVDFRTHRLHAEVTLTLREASAGPLDLDTRDLDIRA  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V+D            P      +G  + V L +G  Q+ V  +TSP SSALQWL+P QT 
Sbjct  61   VVDAQGRPLPYLLSPPEPI---LGSRLRVELPAGLRQLTVRYRTSPQSSALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+++QCQ+IHARS+ P QD
Sbjct  118  GGQHPFLFSQCQAIHARSVMPLQD  141



>ref|XP_319027.4| AGAP009907-PA [Anopheles gambiae str. PEST]
 gb|EAA14067.4| AGAP009907-PA [Anopheles gambiae str. PEST]
Length=646

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 6/155 (4%)
 Frame = -2

Query  449  PCKTEVMAPVDPHSFTDSAHPFTVHISL--TLYFDFPsstisaatllslaAPYSGDLTLD  276
            P +T  ++P+DP S++++      H+ L  T+ FD  + + +A     L      ++ LD
Sbjct  27   PARTMRLSPLDPSSYSNAQELIIRHVDLDWTVNFDKSTISGTATLHFKLTKKDLEEVFLD  86

Query  275  TRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPSSS  108
               L++S+V    +   +P           IG  +T+ L    + +  +++  +TSP +S
Sbjct  87   VSDLTVSSVAAKSNAGEVPLDWDIGGTIENIGSKLTIYLPTKTNDELTLVIAYETSPKAS  146

Query  107  ALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            ALQWL+P QTF K HP++++QCQ+IHARSI PCQD
Sbjct  147  ALQWLTPEQTFGKKHPYLFSQCQAIHARSILPCQD  181



>ref|XP_004173299.1| PREDICTED: LOW QUALITY PROTEIN: leukotriene A-4 hydrolase homolog, 
partial [Cucumis sativus]
Length=558

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  182  GQSVTVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            G  ++++L GQ+ ++V   T+  SSALQWLSPPQTFNKTHPFVYTQC  IHARSI P QD
Sbjct  27   GSLLSITLGGQSALIVTYSTTVESSALQWLSPPQTFNKTHPFVYTQCHPIHARSILPSQD  86



>gb|ETN67323.1| leukotriene A-4 hydrolase [Anopheles darlingi]
Length=620

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISL--TLYFDFPsstisaatllslaAPYSGDLTLDTRSLSI  258
            ++P+DP S++++      H+ L  T+ FD  + + +A     L      ++ LD   +S+
Sbjct  3    LSPLDPSSYSNAHELIIRHVDLDWTVNFDKSTISGTATLQFKLLKADLQEIFLDVSDISV  62

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPSSSALQWLS  90
            S+V    S   +P         P IG  +T+ L    SG+  V++  +TSP +SALQWL+
Sbjct  63   SSVAIQTSAGEVPLDWDIGGTIPNIGSKLTLYLPTKTSGELTVVIGYETSPKASALQWLT  122

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QTF K HP++++QCQ+IHARSI PCQD
Sbjct  123  PEQTFGKNHPYLFSQCQAIHARSILPCQD  151



>ref|WP_015351169.1| M1 family peptidase [Myxococcus stipitatus]
 ref|YP_007362597.1| M1 family peptidase [Myxococcus stipitatus DSM 14675]
 gb|AGC46913.1| M1 family peptidase [Myxococcus stipitatus DSM 14675]
Length=584

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 61/144 (42%), Positives = 82/144 (57%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA  DPHS+ DS  P T  +      DF +  + A   L+L    +G L LDTR L I  
Sbjct  1    MARPDPHSYNDSTQPETETLDWKARVDFHTRRLHAEATLTLKEASAGPLDLDTRDLEI--  58

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
             L  V     P     + P+P++G  + V L +G  Q+ V  +TSP++SALQWL+P QT 
Sbjct  59   -LRVVDAGGRPLPYMLAPPEPILGSRLRVELPAGVRQLTVHYRTSPTASALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+Y+QCQ+IHARS+ P QD
Sbjct  118  GGQHPFLYSQCQAIHARSVVPLQD  141



>ref|WP_044181511.1| peptidase M1 [Hyalangium minutum]
Length=584

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            M  +DPHS+ DS  P T  +      DF +  + A   L+L  P +G L LDTR L I A
Sbjct  1    MPRLDPHSYNDSTQPETESLDWKARVDFRTRRLHAEVTLTLKEPSAGPLDLDTRELDIRA  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V+D            P      +G  + + L  G  Q+ V  +TSP +SALQWL+P QT 
Sbjct  61   VVDDQGKPLPFHLAPPEPI---LGSRLRIQLPKGLRQLTVRYRTSPQASALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+++QCQ+IHARS+ P QD
Sbjct  118  GGQHPFLFSQCQAIHARSVIPLQD  141



>ref|WP_026939150.1| peptidase M1 [Holophaga foetida]
Length=586

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 5/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS  D   P T H  L    DF    I     L L  P SG L LDT+ L+I A
Sbjct  1    MANLDPHSHFDPLQPRTRHWDLRWRVDFSRRVIEGEVTLHLTEPSSGTLDLDTKDLAIRA  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS-KTSPSSSALQWLSPPQTF  75
                  + P        +    +G+ + + L      + ++ +TSP +  LQWLSP QT 
Sbjct  61   CSVAGEVLPFELGDEEPI----LGRRLRLELPPATSAITIAYETSPEAIGLQWLSPEQTA  116

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+++QCQ+IHAR++ PCQD
Sbjct  117  GGQHPFLFSQCQAIHARTLLPCQD  140



>ref|WP_002634079.1| peptidase M1 [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK87173.1| hypothetical protein A176_02133 [Myxococcus sp. (contaminant 
ex DSM 436)]
Length=584

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 58/144 (40%), Positives = 80/144 (56%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS+ DS  P T  +      DF +  + A    +L    +G L LDTR L I  
Sbjct  1    MARLDPHSYNDSTQPETETLDWRARVDFRTQRLHAEVTHTLKEASAGPLDLDTRDLEIR-  59

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
              D V  +  P     S  +P++G  + + L +G  Q  V  +T+P +SALQWL+P QT 
Sbjct  60   --DVVDTAGRPLPYILSPSEPILGSRLRIELPAGLRQFTVRYRTAPHASALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+Y+QCQ+IHARS+ P QD
Sbjct  118  GGQHPFLYSQCQAIHARSVVPLQD  141



>ref|WP_011555110.1| peptidase M1 [Myxococcus xanthus]
 gb|ABF86152.1| peptidase, M1 (aminopeptidase N) family [Myxococcus xanthus DK 
1622]
Length=584

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 57/144 (40%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS+ DS  P T  +      DF +  + A    +L    +G L LDTR L I  
Sbjct  1    MARLDPHSYNDSTQPETETLDWRARVDFKTQRLHAEVTHTLKEASAGPLDLDTRDLEIR-  59

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLS-GQAQVLVLSKTSPSSSALQWLSPPQTF  75
              D +  +  P     S  +P++G  + + L  G  Q  V  +T+P +SALQWL+P QT 
Sbjct  60   --DVIDAAGRPLPYILSPSEPILGSRLRIELPVGLRQFTVRYRTAPHASALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+Y+QCQ+IHARS+ P QD
Sbjct  118  GGKHPFLYSQCQAIHARSVVPLQD  141



>ref|WP_014395190.1| peptidase M1 [Corallococcus coralloides]
 gb|AFE08057.1| M1 family peptidase [Corallococcus coralloides DSM 2259]
Length=584

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 57/144 (40%), Positives = 77/144 (53%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS+ DS  P T  +      DF +  + A   L+L    +G L LDTR L I  
Sbjct  1    MARLDPHSYNDSTQPETETLDWKARVDFRTRRLHAEATLTLKEASAGPLDLDTRDLDIRG  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V+D            P      +G  + + L SG  Q+ V  +TSP +SALQWL+P QT 
Sbjct  61   VVDAQGRPLPYILSPPEPI---LGSRLRIELPSGVKQLTVRYRTSPEASALQWLTPSQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
                PF+++QCQ+IHARS+ P QD
Sbjct  118  GGQQPFLFSQCQAIHARSVVPLQD  141



>ref|WP_013941692.1| peptidase M1 [Myxococcus fulvus]
 gb|AEI68611.1| M1 family peptidase [Myxococcus fulvus HW-1]
Length=584

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 58/144 (40%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA +DPHS+ DS  P T  +      DF +  + A    +L    +G L LDTR L I  
Sbjct  1    MARLDPHSYNDSTQPETETLDWRARVDFKTQRLHAEVTHTLKEASAGPLDLDTRDLEIR-  59

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLS-GQAQVLVLSKTSPSSSALQWLSPPQTF  75
              D V  +  P     S  +P++G  + + L  G  Q  V  +T+P +SALQWL+P QT 
Sbjct  60   --DVVDAAGRPLPYILSPSEPILGSRLRIELPPGLRQFTVRYRTAPHASALQWLTPAQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               HPF+Y+QCQ+IHARS+ P QD
Sbjct  118  GGQHPFLYSQCQAIHARSVVPLQD  141



>gb|KJB80870.1| hypothetical protein B456_013G157100 [Gossypium raimondii]
Length=174

 Score = 77.8 bits (190),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MAP+DPHSFTDS HP T +ISL L+ DFPS+TI       L +P+ G L+ DTRSLSI  
Sbjct  1    MAPLDPHSFTDSHHPLTTNISLFLFLDFPSATIYGVAFFILKSPHVGQLSFDTRSLSIHQ  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSG----QAQVLVLSKTSPSSSALQWLSPP  84
            V   ++LSPL FSLS S      G  +++SL       +  +V S +  SSSALQWLSPP
Sbjct  61   VFSSITLSPLHFSLSSSPDPIK-GTQLSISLPDDDVLNSFFIVFSTSPSSSSALQWLSPP  119

Query  83   QTFNKTHPF  57
            QTFNK  PF
Sbjct  120  QTFNKKTPF  128


 Score = 28.5 bits (62),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  57   CLHPMSVHPRQVHFPLPGH  1
            CL+PM V+PR  HFP+  H
Sbjct  129  CLYPMPVYPRAFHFPMSRH  147



>ref|WP_002621207.1| hypothetical protein [Cystobacter fuscus]
 gb|EPX62473.1| hypothetical protein D187_008661 [Cystobacter fuscus DSM 2262]
Length=584

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA  DPHS++D   P T  +S     DF +  + A   L+L    +G L LDTR L + +
Sbjct  1    MARRDPHSYSDDTQPETERLSWKARVDFQTRRLHAEATLTLKEASAGPLDLDTRELEVES  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLS-GQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V+D                   +G  + V L  G  Q+ V  +TSP +SALQWL+P QT 
Sbjct  61   VVDGEGRPLSFLVSPAEPI---LGSRLRVELRPGVKQLTVRYRTSPGASALQWLTPAQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
                P++++QCQ+IHARS+ P QD
Sbjct  118  GGQAPYLFSQCQAIHARSVVPMQD  141



>ref|WP_043411402.1| peptidase M1 [Cystobacter violaceus]
 gb|KFA87716.1| peptidase M1 [Cystobacter violaceus Cb vi76]
Length=584

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 77/144 (53%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            MA  DPHS+ D   P T  ++     DF +  + A   L+L    +G L LDTR L I +
Sbjct  1    MARPDPHSYNDDTQPETESLTWKARVDFRTRRLHAEATLTLKEASAGPLDLDTRELEIRS  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLS-GQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V+D            P      +G  + V L  G  Q+ +  +TSP +SALQWL+P QT 
Sbjct  61   VVDAEGKPLPYLLSPPEPI---LGSRLRVELRPGTKQLTIRYRTSPRASALQWLTPAQTA  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
               +P++++QCQ+IHARS+ P QD
Sbjct  118  GGEYPYLFSQCQAIHARSVMPLQD  141



>ref|XP_001657127.1| AAEL003666-PA [Aedes aegypti]
 gb|EAT45009.1| AAEL003666-PA [Aedes aegypti]
Length=615

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISL--TLYFDFPsstisaatllslaAPYSGDLTLDTRSLSI  258
            ++P+DP S++++      HI L  T+ F+  + + SA+           ++ LD+  L I
Sbjct  3    LSPIDPSSYSNAHELIITHIDLDWTVNFEKSTLSGSASLSFKTLRDDVEEIFLDSSDLDI  62

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPSSSALQWLS  90
            +++    +   +P S     P   IG  +TV L    SG+ +++V  +T+P +SALQWL+
Sbjct  63   ASMAVKTAAGEIPVSWDVGKPVENIGSKLTVYLPTKTSGEFKLIVEYETNPKASALQWLN  122

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
              QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  123  AEQTCGKKHPYLFSQCQAIHARSLVPCQD  151



>gb|EFX86132.1| putative leukotriene A4 hydrolase [Daphnia pulex]
Length=618

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 75/151 (50%), Gaps = 8/151 (5%)
 Frame = -2

Query  437  EVMAPVDPHSFT--DSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSL  264
            E ++P DP+SF+  D      + + L + FD    +      +      +  L LD+R L
Sbjct  4    ERLSPGDPNSFSRPDEVKVTHMELELDINFDTNILSGHVVLSVEKVNAEANSLILDSRDL  63

Query  263  SISAvldpvslsplpfslspslpdpVIGQSVTVSLSG----QAQVLVLSKTSPSSSALQW  96
            ++S  +     +               G+ + +  SG    + ++ V   TSP S+ALQW
Sbjct  64   TVS--MVQDFETKQLLKFELGSSSTTFGEKLEIHFSGSQTIKQKIAVHYTTSPKSTALQW  121

Query  95   LSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            LSP QT  K HPF+++QCQ+IH RS+ PCQD
Sbjct  122  LSPEQTLGKKHPFLFSQCQAIHCRSLVPCQD  152



>ref|XP_001861493.1| leukotriene A-4 hydrolase [Culex quinquefasciatus]
 gb|EDS35678.1| leukotriene A-4 hydrolase [Culex quinquefasciatus]
Length=616

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 6/149 (4%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISL--TLYFDFPsstisaatllslaAPYSGDLTLDTRSLSI  258
            ++P+DP S++++      H+ L  T+ F+  + + SA            ++ LD   LSI
Sbjct  3    LSPIDPSSYSNAHELIIRHVDLDWTVNFEKSTISGSATLYFKTLKDDVEEIFLDASELSI  62

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPSSSALQWLS  90
            +++    S   +P +         IG  +TV L    SG+  V++  +T P +SALQWL+
Sbjct  63   ASMAIKGSAGEIPLNWDVGGHVDNIGSKLTVYLPTKTSGEFVVVIEYETDPKASALQWLT  122

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
              QT  K HP++++QCQ+IHARSI PCQD
Sbjct  123  AAQTCGKQHPYLFSQCQAIHARSIVPCQD  151



>ref|WP_026852922.1| peptidase M1 [Geothrix fermentans]
Length=592

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 53/144 (37%), Positives = 73/144 (51%), Gaps = 4/144 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTLDTRSLSISA  252
            M   DPHS+ DSA P    + L L  DF +  I    +L      SG L LDT+ L I  
Sbjct  1    MQRPDPHSYYDSAQPRARRLRLKLGVDFAAKRIDGEVMLEFGEAVSGVLDLDTKGLEIQT  60

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPPQTF  75
            V  P   S              +G  + V+  +G  +V +  +T+P + ALQWL P QT 
Sbjct  61   VQVPGQGSIPWELGEADPI---LGSRLRVTAPAGTREVAIRYRTAPDAMALQWLDPAQTE  117

Query  74   NKTHPFVYTQCQSIHARSIFPCQD  3
             K  P++++QCQ IHAR++ PCQD
Sbjct  118  GKVAPYLFSQCQQIHARTMVPCQD  141



>ref|WP_022976719.1| aminopeptidase [Nevskia ramosa]
Length=626

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 59/170 (35%), Positives = 83/170 (49%), Gaps = 5/170 (3%)
 Frame = -2

Query  497  SNRLLRYSKNPVLCRSPCKTEVMAPV-DPHSFTDSAHPFTVHISLTLYFDFPsstis--a  327
            S   L  S   VL  SP    + A V D HS+ +SA   T H+ + L  DF    +    
Sbjct  6    SRAALAASSIAVLILSPMNPVLAAEVVDTHSYANSAEVRTTHLVIDLDVDFAKRRLKGVT  65

Query  326  atllslaAPYSGDLTLDTRSLSI-SAvldpvslsplpfslspslpdpVIGQSVTVSL-SG  153
                    P +  + LDTR+L + SA       +           D V+GQS+TVSL +G
Sbjct  66   ELQFEKLKPDADRIVLDTRALDVRSAEASADGKAWAATKFVLGANDAVLGQSLTVSLPTG  125

Query  152  QAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
              +V ++  T P ++ LQWL P QT  K  PF+++Q ++IHARS  P QD
Sbjct  126  ATRVRIVYSTKPEATGLQWLKPAQTAGKKQPFLFSQSEAIHARSWLPLQD  175



>ref|XP_008176974.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Chrysemys picta 
bellii]
Length=614

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 73/147 (50%), Gaps = 4/147 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGD--LTLDTRSLSI  258
            MA +DP SF  S+   T H+ L    DF S  +      ++ A   G   L LDT+ L I
Sbjct  1    MAELDPSSFASSSDHLTQHLYLRCRVDFGSRALRGTAAHTVRAERDGLRCLVLDTKDLQI  60

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPSSSALQWLSPP  84
              V      +        S     +  +    L     V+V +  +TSP SSALQWL+P 
Sbjct  61   HKVAVNGQDAKFALGQRHSFKGTPLEITFPFELRRGQDVIVETSFETSPKSSALQWLTPE  120

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF+++QCQ+IH R+I PCQD
Sbjct  121  QTSGKKHPFLFSQCQAIHCRAILPCQD  147



>ref|XP_005306570.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Chrysemys picta 
bellii]
Length=614

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 73/147 (50%), Gaps = 4/147 (3%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGD--LTLDTRSLSI  258
            MA +DP SF  S+   T H+ L    DF S  +      ++ A   G   L LDT+ L I
Sbjct  1    MAELDPSSFASSSDHLTQHLYLRCRVDFGSRALRGTAAHTVRAERDGLRCLVLDTKDLQI  60

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPSSSALQWLSPP  84
              V      +        S     +  +    L     V+V +  +TSP SSALQWL+P 
Sbjct  61   HKVAVNGQDAKFALGQRHSFKGTPLEITFPFELRRGQDVIVETSFETSPKSSALQWLTPE  120

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF+++QCQ+IH R+I PCQD
Sbjct  121  QTSGKKHPFLFSQCQAIHCRAILPCQD  147



>ref|WP_044513799.1| aminopeptidase [Hymenobacter sp. DG25B]
 gb|AIZ64084.1| aminopeptidase [Hymenobacter sp. DG25B]
Length=602

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 2/151 (1%)
 Frame = -2

Query  449  PCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPs-stisaatllslaAPYSGDLTLDT  273
            P    +  P DPHS+         H+ L L  DF +      AT        +  L LDT
Sbjct  2    PTSAALPLPADPHSYARPTEVSVRHLMLDLSVDFRTHILSGEATWQLQDLSEAATLWLDT  61

Query  272  RSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQW  96
            R L I AV           +     PD ++GQS+ ++L +G +QV +  +T+P ++ALQW
Sbjct  62   RDLQIDAVSVGDHKHDTSTTWELGQPDAILGQSLRIALPAGTSQVTIRYRTAPGAAALQW  121

Query  95   LSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            L+P QT  +  PF++TQ Q+I AR+  PCQD
Sbjct  122  LTPAQTAGQQQPFLFTQSQAILARTWLPCQD  152



>ref|NP_001040416.1| leukotriene A4 hydrolase [Bombyx mori]
 gb|ABF51345.1| leukotriene A4 hydrolase [Bombyx mori]
Length=606

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 78/149 (52%), Gaps = 11/149 (7%)
 Frame = -2

Query  428  APVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYS-GDLTLDTRSLSISA  252
            +P+DP SF+        H++L+L  DF +  ++ +  L +      GD+ LD+  L+I +
Sbjct  5    SPLDPSSFSRPEQAVIKHVTLSLNVDFENKVLNGSATLDVDVLQDIGDVVLDSSELTIES  64

Query  251  vldpvslsplpfslspslpdpVIGQSVTVSLSGQA------QVLVLSKTSPSSSALQWLS  90
            +    +                 G  +T+ L  +A      ++ +   TSPS++ALQWL 
Sbjct  65   IELDGAQLTYKLDDPVPNY----GSKLTIQLPKRASSGDKLKIKIKYTTSPSATALQWLQ  120

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QT  K HP++++QCQ IHARSI PCQD
Sbjct  121  PAQTSGKKHPYLFSQCQPIHARSILPCQD  149



>gb|KGO39732.1| Leukotriene A4 hydrolase [Penicillium expansum]
 gb|KGO55313.1| Leukotriene A4 hydrolase [Penicillium expansum]
Length=620

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  103  VKLNGTVEVEIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  157



>gb|KGO62758.1| Leukotriene A4 hydrolase [Penicillium expansum]
Length=620

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  103  VKLNGTVEVEIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  157



>ref|XP_011295445.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Musca domestica]
Length=691

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 7/162 (4%)
 Frame = -2

Query  467  PVLCRSPCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG-  291
            PV C S      +  VDP S++      T H SL    DF ++ +  +         +  
Sbjct  70   PVYCVSNRNMGRLGKVDPSSYSQPELITTKHSSLEWKVDFDNTKLKGSVTHKFNVLENNL  129

Query  290  -DLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL-----SGQAQVLVLS  129
              + LD R + I       S S  P +   S P   IG  +T+ L      G+  V +  
Sbjct  130  ESIILDVRDVKILNAEIISSGSTTPLNHFISDPVDDIGAKLTLELPQGTAKGELTVRIDY  189

Query  128  KTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +TS  +S LQWL+P QT  K HP++++QCQ+IHARSI PCQD
Sbjct  190  ETSQKASGLQWLTPEQTLGKKHPYMFSQCQAIHARSIIPCQD  231



>ref|WP_032096781.1| MULTISPECIES: aminopeptidase [Alteromonas]
Length=653

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 78/149 (52%), Gaps = 7/149 (5%)
 Frame = -2

Query  440  TEVMAPVDPHSFTDSAHPFTVHISLTLY--FDFPsstisaatllslaAPYSGDLTLDTRS  267
            +++ + VD HSF++       H++L L   FD    + SA   +    P   +L LDTR+
Sbjct  62   SDMASGVDYHSFSNPDEVRVTHLALDLSANFDTQQLSGSATLKVERTDPKYNELVLDTRA  121

Query  266  LSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQA-QVLVLSKTSPSSSALQWLS  90
            L I  V       P     +       +G  +++SL   A QV V   TSPS+S +QWL+
Sbjct  122  LKIETVTVNGEAVPFTLGETDVD----LGTPLSISLPENANQVTVNYSTSPSASGVQWLT  177

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QT  K HPF++TQ Q++HARS  P QD
Sbjct  178  PAQTAGKKHPFLFTQAQAVHARSFIPLQD  206



>emb|CDM26923.1| Leukotriene A-4 hydrolase homolog [Penicillium roqueforti FM164]
Length=615

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  98   VKLNGTVEVDIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  152



>gb|EKV10701.1| Leukotriene A4 hydrolase [Penicillium digitatum PHI26]
 gb|EKV20629.1| Leukotriene A4 hydrolase [Penicillium digitatum Pd1]
Length=615

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  98   VKLNGTVEVDIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  152



>gb|KGO65010.1| Leukotriene A4 hydrolase [Penicillium italicum]
Length=615

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  98   VKLNGTVEVDIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  152



>ref|WP_007623272.1| leukotriene A-4 hydrolase [Glaciecola arctica]
 dbj|GAC20886.1| leukotriene A-4 hydrolase [Glaciecola arctica BSs20135]
Length=636

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 83/172 (48%), Gaps = 12/172 (7%)
 Frame = -2

Query  494  NRLLRYSKNPVLCRSPCKTEVMAPV-----DPHSFTDSAHPFTVHISLTLYFDFPsstis  330
            N   + + +P + +S   TEV         D HSF +       H+SL L  DF    + 
Sbjct  22   NSTTKTTASPKIEQSAAATEVATSTMQVGKDYHSFANPESIKVTHLSLDLTVDFAKKVLV  81

Query  329  aatll--slaAPYSGDLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLS  156
                L    A   +  L LDTR L+I +V           +   S     +G ++T+ + 
Sbjct  82   GTAQLDFQRAEKNAKQLILDTRDLTIKSVTAMGKELNFDLASGDSF----LGAALTIEIP  137

Query  155  GQAQVLVLS-KTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
              A  +V+S +TSP +S +QWL+P QT  K HPF++TQ Q+IHARS  P QD
Sbjct  138  ADADSVVISYQTSPEASGVQWLTPEQTAGKKHPFLFTQAQAIHARSFIPLQD  189



>ref|XP_002558974.1| Pc13g05400 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP91609.1| Pc13g05400 [Penicillium rubens Wisconsin 54-1255]
Length=666

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            + L+G  +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  149  IKLNGTVEVDIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  203



>gb|KFM57734.1| Leukotriene A-4 hydrolase, partial [Stegodyphus mimosarum]
Length=615

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 76/148 (51%), Gaps = 7/148 (5%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDF-PsstisaatllslaAPYSGDLTLDTRSLSIS  255
            M+ VDP+S+++        I+L L  DF          L         DL LDT+ L I 
Sbjct  5    MSDVDPNSYSNPEQCIVTDINLKLEVDFNKHILKGYVDLYVERKDTKSDLVLDTKDLVIH  64

Query  254  AvldpvslsplpfslspslpdpVIGQSVTVSL----SGQAQVLVLSKTSPSSSALQWLSP  87
             V +  +++ + + L         G  + V L    S +  V +  +TSP +SALQWL P
Sbjct  65   CVRNKNTMNKMNYELGEPHEK--FGTRLEVKLLKRPSKKCAVRIEYETSPKASALQWLEP  122

Query  86   PQTFNKTHPFVYTQCQSIHARSIFPCQD  3
             QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  123  NQTAGKKHPYMFSQCQAIHARSVLPCQD  150



>ref|XP_002090623.1| GE12699 [Drosophila yakuba]
 gb|EDW90335.1| GE12699 [Drosophila yakuba]
Length=613

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L      G   V +  +TS S+S LQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPAQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VIPCQD  153



>ref|WP_006006805.1| aminopeptidase [Glaciecola punicea]
 dbj|GAB56547.1| leukotriene A-4 hydrolase [Glaciecola punicea DSM 14233 = ACAM 
611]
Length=627

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 84/160 (53%), Gaps = 7/160 (4%)
 Frame = -2

Query  473  KNPVLCRSPCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAP  300
            K P    +P    + +  D HSF++ +     HI+L L  DF   ++   A         
Sbjct  25   KEPEASAAPDDVAIESGTDYHSFSNPSEILVKHINLDLNADFSQKSLIGRAQLSFERVEQ  84

Query  299  YSGDLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQA-QVLVLSKT  123
             + +L LDTR L+I      V+++  P   +    D  +G ++ + +  +A QV V  +T
Sbjct  85   KATELILDTRDLTIK----NVTVNDKPVDYTLKPADENLGAALHIDVGKRATQVTVHYQT  140

Query  122  SPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SPS+S +QWL+P QT  K HPF++TQ Q+IHARS  P QD
Sbjct  141  SPSASGVQWLTPAQTAGKQHPFLFTQAQAIHARSFIPLQD  180



>dbj|BAD92977.1| leukotriene A4 hydrolase variant [Homo sapiens]
Length=219

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  56   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  115

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  116  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  152



>gb|AAK93169.1| LD27070p [Drosophila melanogaster]
 gb|ACL85452.1| CG10602-PA, partial [synthetic construct]
 gb|ACL90328.1| CG10602-PA [synthetic construct]
Length=684

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 77/150 (51%), Gaps = 7/150 (5%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSI  258
            +  VDP S++      T H +L    DF ++ I  + L       +    + LD R +++
Sbjct  75   LGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINV  134

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWL  93
            +        S LP +   S     IGQ +T+ L      G   V +  +TS S+S LQWL
Sbjct  135  TNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWL  194

Query  92   SPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +P QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  195  NPTQTLGKEHPYMFSQCQAIHARSVIPCQD  224



>ref|XP_002507406.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68664.1| predicted protein [Micromonas sp. RCC299]
Length=632

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 6/67 (9%)
 Frame = -2

Query  185  IGQSVTVSLSGQAQ------VLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHAR  24
            +G  + + L  Q +      V++  +TSPSSSA+QWL P QT    HP+++TQCQ+IHAR
Sbjct  80   MGAPLVIELDKQMEKDSSFDVVITYRTSPSSSAVQWLRPEQTAGGKHPYLFTQCQAIHAR  139

Query  23   SIFPCQD  3
            S+FPCQD
Sbjct  140  SLFPCQD  146



>ref|XP_001974335.1| GG21678 [Drosophila erecta]
 gb|EDV54735.1| GG21678 [Drosophila erecta]
Length=613

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-SGQAQ----VLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L SG A+    V +  +TS S+S LQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPSGTAKGSLTVRIDYETSSSASGLQWLNPAQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VIPCQD  153



>ref|XP_008255137.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Oryctolagus 
cuniculus]
Length=532

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP+
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_002711258.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Oryctolagus 
cuniculus]
Length=611

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP+
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_010392291.1| aminopeptidase [Pseudoalteromonas undina]
 gb|ERG59346.1| cold-active aminopeptidase [Pseudoalteromonas undina NCIMB 2128]
Length=613

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNANSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QAQ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKNQAQKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|XP_004748554.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Mustela putorius 
furo]
 ref|XP_004787297.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Mustela putorius 
furo]
Length=532

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I   +              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKAVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_004400314.1| PREDICTED: leukotriene A-4 hydrolase [Odobenus rosmarus divergens]
Length=611

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGEKQSYKGSPMEISLPIALSKNEEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>gb|EPS29094.1| hypothetical protein PDE_04043 [Penicillium oxalicum 114-2]
Length=648

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L G  +V +  +T+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  132  VELDGTVEVDIAVQTTNECTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  186



>ref|XP_004583325.1| PREDICTED: leukotriene A-4 hydrolase [Ochotona princeps]
Length=514

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKKHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_018981430.1| hypothetical protein [Salinimonas chungwhensis]
Length=631

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 72/142 (51%), Gaps = 7/142 (5%)
 Frame = -2

Query  419  DPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSISAvl  246
            D HSF++       H+ L L  DF    +     L +    +G   L LDTR L+I++V 
Sbjct  46   DYHSFSNPDEITVTHLDLALTADFEQKQLKGRATLDIVRQQAGADTLVLDTRDLNINSVT  105

Query  245  dpvslsplpfslspslpdpVIGQSVTVSLSGQA-QVLVLSKTSPSSSALQWLSPPQTFNK  69
                        S +     +G  +++SL   A QV V   TSP +S +QWL+P QT  K
Sbjct  106  VNGQSVDYSLGASDAN----LGTPLSISLPANAKQVTVNYHTSPEASGVQWLTPAQTAGK  161

Query  68   THPFVYTQCQSIHARSIFPCQD  3
             HPF++TQ Q+IHARS  P QD
Sbjct  162  QHPFLFTQAQAIHARSFIPLQD  183



>ref|XP_004748553.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Mustela putorius 
furo]
 ref|XP_004787296.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Mustela putorius 
furo]
Length=611

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I   +              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKAVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_002132587.1| GA25817 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY69989.1| GA25817 [Drosophila pseudoobscura pseudoobscura]
Length=613

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L      G   V +  +TS S+S LQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPAGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VVPCQD  153



>ref|XP_002014673.1| GL18827 [Drosophila persimilis]
 gb|EDW28669.1| GL18827 [Drosophila persimilis]
Length=613

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L      G   V +  +TS S+S LQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPAGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VVPCQD  153



>ref|XP_539728.3| PREDICTED: leukotriene A-4 hydrolase [Canis lupus familiaris]
Length=611

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVTNGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_024015773.1| putative cold-active aminopeptidase [Alteromonas macleodii]
 gb|AGP80794.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Aegean Sea MED64']
Length=327

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatl--lslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +  A P +  L LDTR+L 
Sbjct  54   IASGVDYHSFANPNEVRVTHLSLDLTANFETKQLVGDVTLDVKRAKPENNTLVLDTRALD  113

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  +T++L S    V V   TSP +S +QWL+P 
Sbjct  114  IDSVTVNGESVPFEMGKTDPD----LGTPLTITLPSAANSVTVAYSTSPDASGVQWLTPA  169

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  170  QTTGKQHPFLFTQAQAVHARSFIPLQD  196



>ref|XP_002064528.1| GK23897 [Drosophila willistoni]
 gb|EDW75514.1| GK23897 [Drosophila willistoni]
Length=613

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            +GQ +T+ L      G   V +  +TS S+SALQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   MGQKLTLELPAGTAKGSLNVRIDYETSNSASALQWLNPAQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VLPCQD  153



>gb|EDM16914.1| leukotriene A4 hydrolase, isoform CRA_b [Rattus norvegicus]
Length=400

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_001965345.1| GF20677 [Drosophila ananassae]
 gb|EDV33479.1| GF20677 [Drosophila ananassae]
Length=613

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L      G   V +  +TS S+S LQWLSP QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLSPAQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VIPCQD  153



>ref|XP_004650252.1| PREDICTED: leukotriene A-4 hydrolase [Jaculus jaculus]
Length=611

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_006741958.1| PREDICTED: leukotriene A-4 hydrolase-like [Leptonychotes weddellii]
Length=441

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_036957061.1| aminopeptidase [Pseudoalteromonas sp. A2]
Length=613

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I+ V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDINKVMYQTANGNWHKASFNLANRDNVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|WP_025538538.1| aminopeptidase [Cytophagaceae bacterium JGI 0001001-B3]
Length=621

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 55/149 (37%), Positives = 74/149 (50%), Gaps = 5/149 (3%)
 Frame = -2

Query  443  KTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGDLTL-DTRS  267
            +TE   P DPHSFT SA     H+S     DF +  I+A     +      DL + DT+ 
Sbjct  25   ETEYKKPTDPHSFTLSADARVKHLSWNATVDFNTKIITATAGWDIEHRPDADLIIFDTKG  84

Query  266  LSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLS  90
            L I    D            P      +GQ++ V +    + V +  +TSP + ALQWL+
Sbjct  85   LKIKKATDADGQPLEFRLADPDSL---LGQALAVLIKKDTRRVNIEYETSPEAEALQWLA  141

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QT  K HPF++TQ Q+I ARS  PCQD
Sbjct  142  PSQTAGKQHPFLFTQSQAILARSWIPCQD  170



>ref|XP_006241313.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Rattus norvegicus]
Length=532

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>gb|KIX01374.1| leukotriene A-4 hydrolase/aminopeptidase [Rhinocladiella mackenziei 
CBS 650.93]
Length=620

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L  +  + +  +T+PS +ALQWL+P QT NK HP++++QC++IHARSIFPCQD
Sbjct  99   VGLDERVNIEIDLETTPSCTALQWLTPAQTSNKKHPYMFSQCEAIHARSIFPCQD  153



>ref|XP_004418035.1| PREDICTED: leukotriene A-4 hydrolase [Ceratotherium simum simum]
Length=611

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIERVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQKVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKKHPYLFSQCQAIHCRAILPCQD  149



>ref|NP_001025202.1| leukotriene A-4 hydrolase [Rattus norvegicus]
 gb|AAH99819.1| Leukotriene A4 hydrolase [Rattus norvegicus]
Length=611

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>gb|EDM16913.1| leukotriene A4 hydrolase, isoform CRA_a [Rattus norvegicus]
Length=479

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_010558065.1| aminopeptidase [Pseudoalteromonas marina]
 gb|ERG25374.1| cold-active aminopeptidase [Pseudoalteromonas marina mano4]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 51/152 (34%), Positives = 73/152 (48%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   VD +S+ +     T H+SL L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAVDQNSYANLDDVVTTHLSLDLDVDFDDKQLEGFVEHTLKWNNSKSKTLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQVL-VLSKTSPSSSALQ  99
            R L I  V+          +         + G  +T+    QA+V+ +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTQTGSWHKAKFTLANRDDVKGSKLTIKFKSQAKVVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPTQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|XP_008514827.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Equus przewalskii]
Length=532

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>ref|NP_724139.1| CG10602, isoform C [Drosophila melanogaster]
 ref|NP_724140.1| CG10602, isoform D [Drosophila melanogaster]
 ref|NP_609916.4| CG10602, isoform E [Drosophila melanogaster]
 gb|AAN11016.1| CG10602, isoform C [Drosophila melanogaster]
 gb|AAN11017.1| CG10602, isoform D [Drosophila melanogaster]
 gb|AAF53718.3| CG10602, isoform E [Drosophila melanogaster]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 7/147 (5%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSISAv  249
            VDP S++      T H +L    DF ++ I  + L       +    + LD R ++++  
Sbjct  7    VDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNA  66

Query  248  ldpvslsplpfslspslpdpVIGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPP  84
                  S LP +   S     IGQ +T+ L      G   V +  +TS S+S LQWL+P 
Sbjct  67   TLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPT  126

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  127  QTLGKEHPYMFSQCQAIHARSVIPCQD  153



>gb|ERE91837.1| leukotriene A-4 hydrolase [Cricetulus griseus]
Length=512

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_006988522.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Peromyscus maniculatus 
bairdii]
Length=545

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>gb|EGW08381.1| Leukotriene A-4 hydrolase [Cricetulus griseus]
Length=529

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_004451587.1| PREDICTED: leukotriene A-4 hydrolase [Dasypus novemcinctus]
Length=611

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              +     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVISGQEVNYALGERQTYKGSPLEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HPF+++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPFLFSQCQAIHCRAILPCQD  149



>ref|WP_039038487.1| aminopeptidase [Pseudoalteromonas sp. ECSMB14103]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 73/152 (48%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   VD +S+ +     T H+SL L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAVDQNSYANLDDVVTTHLSLDLDVDFDDKQLEGFVEHTLKWNNSKSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQVL-VLSKTSPSSSALQ  99
            R L I  V+          +         + G  +T+    QA+++ +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTQTGSWHKAKFTLANRDDVKGSKLTIEFKSQAKIVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPTQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|XP_006988523.1| PREDICTED: leukotriene A-4 hydrolase isoform X3 [Peromyscus maniculatus 
bairdii]
Length=532

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_008132263.1| aminopeptidase [Pseudoalteromonas sp. BSi20480]
 dbj|GAA76897.1| leukotriene A-4 hydrolase [Pseudoalteromonas sp. BSi20480]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 73/152 (48%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   VD +S+ +     T H+SL L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAVDQNSYANLDDVVTTHLSLDLDVDFDDKQLEGFVEHTLKWNNSKSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQVL-VLSKTSPSSSALQ  99
            R L I  V+          +         + G  +T+    QA+++ +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTQTGSWHKAKFTLANRDDVKGSKLTIEFKSQAKIVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPTQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|XP_008514825.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Equus przewalskii]
Length=611

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_024602237.1| aminopeptidase [Pseudoalteromonas atlantica]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|WP_013466183.1| MULTISPECIES: aminopeptidase [Pseudoalteromonas]
 gb|ADT69927.1| cold-active aminopeptidase [Pseudoalteromonas sp. SM9913]
Length=613

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|XP_005068057.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Mesocricetus 
auratus]
Length=611

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_007640272.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Cricetulus griseus]
 ref|XP_007633301.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Cricetulus griseus]
Length=532

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_002601783.1| hypothetical protein BRAFLDRAFT_215361 [Branchiostoma floridae]
 gb|EEN57795.1| hypothetical protein BRAFLDRAFT_215361 [Branchiostoma floridae]
Length=612

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 80/149 (54%), Gaps = 11/149 (7%)
 Frame = -2

Query  422  VDPHSFTDSAHPFTVHISLTLYFDFPsstisaatl--lslaAPYSGDLTLDTRSLSISAv  249
             DP S ++S    T +ISL L  DF    +  +    + +       + LDTR L+I  V
Sbjct  2    ADPCSLSNSQACKTTNISLHLVVDFDKKVLRGSATLDVEVLEERVEHVVLDTRDLTIHGV  61

Query  248  ldpvslsplpfslspslpdpVIGQSVTVSL-------SGQAQVLVLSKTSPSSSALQWLS  90
             D  +  PL F L   +     G  + +SL         + QV V  +T+PSSSALQWLS
Sbjct  62   EDTSTGQPLQFLLKDQVAP--FGSPLQISLPANCQAKGSKCQVKVSYETAPSSSALQWLS  119

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  120  PQQTAGKQHPYLFSQCQAIHARSMLPCQD  148



>gb|KEF63390.1| leukotriene A-4 hydrolase [Exophiala aquamarina CBS 119918]
Length=631

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  164  SLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SL     V +  +T+P+ +ALQWL+P QT NK HP+V++QCQ+IHARSIFPCQD
Sbjct  101  SLDKTLAVQIDLETTPACTALQWLTPEQTSNKKHPYVFSQCQAIHARSIFPCQD  154



>ref|XP_003501464.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Cricetulus griseus]
 ref|XP_007633300.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Cricetulus griseus]
Length=611

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_028834677.1| MULTISPECIES: aminopeptidase [Pseudoalteromonas]
Length=613

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|WP_036980588.1| aminopeptidase [Pseudoalteromonas sp. SCSIO_11900]
 gb|EWS99061.1| aminopeptidase [Pseudoalteromonas sp. SCSIO_11900]
Length=613

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|XP_006513349.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Mus musculus]
Length=532

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   ++++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_033103521.1| MULTISPECIES: aminopeptidase [Alteromonadales]
 gb|KGK00812.1| Leukotriene-A(4) hydrolase [Pseudoalteromonas sp. ND6B]
Length=613

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNAKSTKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKSQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|WP_008108511.1| MULTISPECIES: aminopeptidase [Pseudoalteromonas]
 dbj|GAA62371.1| leukotriene A-4 hydrolase [Pseudoalteromonas sp. BSi20311]
 dbj|GAA70986.1| leukotriene A-4 hydrolase [Pseudoalteromonas sp. BSi20439]
Length=613

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDT  273
            C   + + +D +S+ +     T H++L L  DF    +       L      S  L LDT
Sbjct  16   CSQAMASAIDQNSYANLDDVITTHLNLDLDIDFADKQLEGFVEHTLQWQNASSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++   QA+ V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQTANGNWHKASFNLANRDDVKGSKLTITFKNQAEKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWIPVQD  167



>ref|XP_006988521.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Peromyscus maniculatus 
bairdii]
Length=611

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_005358218.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Microtus ochrogaster]
Length=532

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPQ  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_039224613.1| aminopeptidase [Alteromonas macleodii]
 gb|KHT57055.1| aminopeptidase [Alteromonas macleodii]
Length=648

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 74/157 (47%), Gaps = 7/157 (4%)
 Frame = -2

Query  464  VLCRSPCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSG  291
            V   S     + + VD HSF +       H+SL L  +F +  +       +    P + 
Sbjct  49   VAVASQADAAIASGVDYHSFANPNEIRVTHLSLNLTANFETKQLVGDVTLDVKREKPDNN  108

Query  290  DLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPS  114
             L LDTR+L I +V       P             +G  +T++L   A  V V   TSP 
Sbjct  109  TLVLDTRALDIQSVTVDGESVPFEMGEVDPD----LGTPLTITLPSSANAVTVAYSTSPD  164

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +S +QWL+P QT  K HPF++TQ Q++HARS  P QD
Sbjct  165  ASGVQWLTPAQTAGKKHPFLFTQAQAVHARSFIPLQD  201



>ref|XP_008830286.1| PREDICTED: leukotriene A-4 hydrolase [Nannospalax galili]
Length=611

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|WP_039230763.1| aminopeptidase [Alteromonas macleodii]
 gb|KHT61058.1| aminopeptidase [Alteromonas macleodii]
Length=648

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 74/157 (47%), Gaps = 7/157 (4%)
 Frame = -2

Query  464  VLCRSPCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSG  291
            V   S     + + VD HSF +       H+SL L  +F +  +       +    P + 
Sbjct  49   VAVASQADAAIASGVDYHSFANPNEIRVTHLSLNLTANFETKQLVGDVTLDVKREKPDNN  108

Query  290  DLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPS  114
             L LDTR+L I +V       P             +G  +T++L   A  V V   TSP 
Sbjct  109  TLVLDTRALDIQSVTVDGESVPFEMGEVDPD----LGTPLTITLPSSANAVTVAYSTSPE  164

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +S +QWL+P QT  K HPF++TQ Q++HARS  P QD
Sbjct  165  ASGVQWLTPAQTAGKKHPFLFTQAQAVHARSFIPLQD  201



>gb|AAH21417.1| Lta4h protein [Mus musculus]
Length=611

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   ++++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>ref|NP_032543.2| leukotriene A-4 hydrolase [Mus musculus]
 sp|P24527.4|LKHA4_MOUSE RecName: Full=Leukotriene A-4 hydrolase; Short=LTA-4 hydrolase; 
AltName: Full=Leukotriene A(4) hydrolase [Mus musculus]
 dbj|BAE22342.1| unnamed protein product [Mus musculus]
Length=611

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   ++++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>gb|AAB59675.1| leukotriene A-4 hydrolase [Mus musculus]
Length=611

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S       +  S+ ++LS   ++++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_005358217.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Microtus ochrogaster]
Length=611

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPQ  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_002001748.1| GI17019 [Drosophila mojavensis]
 gb|EDW11190.1| GI17019 [Drosophila mojavensis]
Length=613

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 7/150 (5%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSI  258
            ++ VDP S+++     T H ++    DF ++ +  + L       S    + LD R + +
Sbjct  4    LSSVDPSSYSEPEKITTEHTAIHWNVDFETTKLRGSVLHKFKVLTSNLESILLDVRDIEV  63

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWL  93
                     S  P +   S P P +GQ +T+ L      G   V +  +T+ ++S LQWL
Sbjct  64   KNATLLAGGSEQPINYFISDPVPDVGQKLTLELPAGTAKGSLNVRIDYETASNASGLQWL  123

Query  92   SPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +P QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  124  NPNQTLGKQHPYMFSQCQAIHARSVMPCQD  153



>ref|XP_004675850.1| PREDICTED: leukotriene A-4 hydrolase [Condylura cristata]
Length=611

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+            S S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGESQSYKGSPMEISLPIALSKNQEIVIEISFETSPQ  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAIIPCQD  149



>ref|XP_001494815.3| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Equus caballus]
Length=733

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  175  LTLDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  234

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  235  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  271



>ref|XP_005606585.1| PREDICTED: leukotriene A-4 hydrolase isoform X3 [Equus caballus]
Length=590

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  175  LTLDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  234

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  235  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  271



>gb|ERE91834.1| leukotriene A-4 hydrolase [Cricetulus griseus]
Length=1242

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>gb|ERE91836.1| leukotriene A-4 hydrolase [Cricetulus griseus]
Length=1178

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPS  114
            LTLDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LTLDTKDLTIEKVVINGQEVKYTLGERQGYKGSPMEISLPIALSKNQEVVIEISYETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKQHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_005606584.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Equus caballus]
Length=654

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            LTLDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  175  LTLDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  234

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  235  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  271



>ref|WP_025256395.1| aminopeptidase [Alteromonas sp. ALT199]
 gb|EXF50072.1| aminopeptidase N [Alteromonas sp. ALT199]
Length=648

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +    P +  L LDTR+L+
Sbjct  59   IASGVDYHSFANPNEVRVTHLSLNLTANFETKQLIGDVTLDVKRTTPENNTLVLDTRALN  118

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  ++++L   A  V V   TSP +S +QWL+P 
Sbjct  119  IESVTVDGESVPFAMGETDKD----LGTPLSITLPNAANAVTVAYSTSPEASGVQWLTPA  174

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  175  QTAGKKHPFLFTQAQAVHARSFIPLQD  201



>ref|XP_007232319.1| PREDICTED: leukotriene A-4 hydrolase [Astyanax mexicanus]
Length=615

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 5/148 (3%)
 Frame = -2

Query  431  MAPVDPH-SFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYS--GDLTLDTRSLS  261
            MAPV  H SF+  +   T H++L+L  DF S  +     L++         LTLDT+ L 
Sbjct  1    MAPVTDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLK  60

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVL--SKTSPSSSALQWLSP  87
            I  V      +              +  ++   LS    V+V    +TSPS+SALQWLSP
Sbjct  61   IFKVSANGQAAKFELGAQHGFKGSPLEITLPFELSRGQHVIVEVEYETSPSASALQWLSP  120

Query  86   PQTFNKTHPFVYTQCQSIHARSIFPCQD  3
             QT  K HP++++QCQ+ H R++ PCQD
Sbjct  121  AQTAGKKHPYLFSQCQATHCRTMVPCQD  148



>sp|Q2TZ99.1|LKHA4_ASPOR RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 
hydrolase; AltName: Full=Leukotriene A(4) hydrolase [Aspergillus 
oryzae RIB40]
 dbj|BAE65366.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT77415.1| bifunctional leukotriene A4 hydrolase/aminopeptidase LTA4H [Aspergillus 
oryzae 3.042]
 gb|KDE82402.1| bifunctional leukotriene A4 hydrolase/aminopeptidase LTA4H [Aspergillus 
oryzae 100-8]
Length=615

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+   +V +  KT+   +ALQWL+P QT N+ HP++++QCQ+IHARSIFPCQD
Sbjct  99   VGLNEMVEVEISVKTTEKCTALQWLTPAQTSNRKHPYMFSQCQAIHARSIFPCQD  153



>ref|XP_003783386.1| PREDICTED: leukotriene A-4 hydrolase [Otolemur garnettii]
Length=611

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP+
Sbjct  53   LVLDTKDLTIEKVVINGQEVEYALGERQGYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_003054759.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60011.1| predicted protein [Micromonas pusilla CCMP1545]
Length=957

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 9/102 (9%)
 Frame = -2

Query  290  DLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL------SGQAQVLVLS  129
            +L LDTR L+I   +   + +              +G ++T++          A V V  
Sbjct  373  ELVLDTRDLAIEKCVVDGADATFALQADAHPV---MGSALTIAFPTPLAAGATASVEVSY  429

Query  128  KTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            KTSPSSSA+QWL P QT   +HP+++TQCQ+IHARS++PCQD
Sbjct  430  KTSPSSSAVQWLRPEQTAGGSHPYLFTQCQAIHARSLYPCQD  471



>ref|XP_002079842.1| GD21803 [Drosophila simulans]
 gb|EDX05427.1| GD21803 [Drosophila simulans]
Length=613

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -2

Query  185  IGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARS  21
            IGQ +T+ L      G   V +  +TS S+S LQWL+P QT  K HP++++QCQ+IHARS
Sbjct  88   IGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARS  147

Query  20   IFPCQD  3
            + PCQD
Sbjct  148  VIPCQD  153



>ref|XP_006914655.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Pteropus alecto]
 ref|XP_011364221.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Pteropus vampyrus]
Length=532

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP+
Sbjct  53   LILDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_001260272.1| leukotriene A4 hydrolase [Neosartorya fischeri NRRL 181]
 sp|A1DG68.1|LKHA4_NEOFI RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 
hydrolase; AltName: Full=Leukotriene A(4) hydrolase [Neosartorya 
fischeri NRRL 181]
 gb|EAW18375.1| leukotriene A4 hydrolase [Neosartorya fischeri NRRL 181]
Length=617

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+   +V +  KT+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  99   VKLNEMIEVDISVKTTEKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  153



>gb|EHJ63222.1| leukotriene A4 hydrolase [Danaus plexippus]
Length=661

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 75/150 (50%), Gaps = 10/150 (7%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatlls-laAPYSGDLTLDTRSLSIS  255
            ++P+DP SF+        H+ L+   DF    ++  ++L+     Y  ++ LDT  L I 
Sbjct  4    LSPLDPSSFSRPEQAIIKHVDLSYDVDFEKKVLNGVSVLTIEVLDYIENVILDTSELDIK  63

Query  254  AvldpvslsplpfslspslpdpVIGQSVTVSL------SGQAQVLVLSKTSPSSSALQWL  93
            ++      +       P       G  +T+ L        Q Q+ +   TSP+++ALQWL
Sbjct  64   SIELKDGTALQFKLGDPVPNY---GSKLTIDLPQSAAPEQQLQIKIKFNTSPNATALQWL  120

Query  92   SPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
               QT  K HP++++QCQ IHARSI PCQD
Sbjct  121  DANQTSGKKHPYLFSQCQPIHARSILPCQD  150



>ref|WP_012517391.1| aminopeptidase [Alteromonas macleodii]
 gb|AEA97037.1| aminopeptidase [Alteromonas macleodii str. 'Deep ecotype']
Length=643

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +  A P +  L LDTR+L 
Sbjct  54   IASGVDYHSFANPNEVRVTHLSLDLTANFETKQLVGDVTLDVKRAKPENNTLVLDTRALD  113

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  114  IDSVTVNGESVPFEIGKTDPD----LGTPLTITLPSAANSVTVAYSTSPDASGVQWLTPA  169

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  170  QTAGKQHPFLFTQAQAVHARSFIPLQD  196



>ref|WP_020745407.1| putative cold-active aminopeptidase [Alteromonas macleodii]
 ref|YP_008191757.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'English Channel 615']
 gb|AGP77107.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'English Channel 615']
Length=643

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +  A P +  L LDTR+L 
Sbjct  54   IASGVDYHSFANPNEVRVTHLSLDLTANFETKQLVGDVTLDVKRAKPENNTLVLDTRALD  113

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  114  IDSVTVNGESVPFEIGKTDPD----LGTPLTITLPSAANSVTVAYSTSPDASGVQWLTPA  169

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  170  QTAGKQHPFLFTQAQAVHARSFIPLQD  196



>ref|WP_029774313.1| aminopeptidase [Pseudoalteromonas sp. TB51]
Length=614

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   +D +S+ +     T H++L L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAIDQNSYANLDDVVTTHLNLDLDVDFADKQLEGFVEHTLKWNNDTSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQA-QVLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++L  QA +V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQDTSGDWHKAKFTLADRDDVKGSKLTITLKSQAPKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|WP_024033946.1| aminopeptidase [Pseudoalteromonas sp. NW 4327]
 gb|ETJ46546.1| aminopeptidase [Pseudoalteromonas sp. NW 4327]
Length=614

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   +D +S+ +     T H++L L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAIDQNSYANLDDVVTTHLNLDLDVDFADKQLEGFVEHTLKWNNDTSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQA-QVLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++L  QA +V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQDTSGDWHKAKFTLADRDDVKGSKLTITLKSQAPKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|XP_007724601.1| leukotriene A-4 hydrolase [Capronia coronata CBS 617.96]
 gb|EXJ88595.1| leukotriene A-4 hydrolase [Capronia coronata CBS 617.96]
Length=633

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  170  TVSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            TV L+ + +V +  +T+   +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  99   TVKLNEKVEVHIDLETTALCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  154



>ref|WP_004587495.1| cold-active aminopeptidase [Pseudoalteromonas agarivorans]
 gb|ENN99105.1| cold-active aminopeptidase [Pseudoalteromonas agarivorans S816]
Length=614

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/152 (33%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = -2

Query  446  CKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllsla--APYSGDLTLDT  273
            C   +   +D +S+ +     T H++L L  DF    +      +L      S  L LDT
Sbjct  16   CSQAMANAIDQNSYANLDDVVTTHLNLDLDVDFADKQLEGFVEHTLKWNNDTSKKLVLDT  75

Query  272  RSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQA-QVLVLSKTSPSSSALQ  99
            R L I  V+   +      +         + G  +T++L  QA +V +   + P +S LQ
Sbjct  76   RDLDIDKVMYQDTSGDWHKAKFTLADRDDVKGSKLTITLKSQAPKVRIYYNSRPEASGLQ  135

Query  98   WLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            WL+P QT +KTHPF+Y+Q Q+IHARS  P QD
Sbjct  136  WLTPEQTASKTHPFMYSQSQAIHARSWLPVQD  167



>ref|WP_020742960.1| putative cold-active aminopeptidase [Alteromonas macleodii]
 ref|YP_008170883.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Ionian Sea U4']
 gb|AGP84625.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Ionian Sea U4']
 gb|AGP88741.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Ionian Sea U7']
 gb|AGP92623.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Ionian Sea U8']
Length=643

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +  A P +  L LDTR+L 
Sbjct  54   IASGVDYHSFANPNEVRVTHLSLDLTTNFETKQLVGDVTLDVKRARPENNTLVLDTRALD  113

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  114  IDSVTVNGESVPFEIGKTDPD----LGTPLTITLPSAANSVTVAYSTSPDASGVQWLTPA  169

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  170  QTAGKQHPFLFTQAQAVHARSFIPLQD  196



>ref|XP_002378195.1| leukotriene A4 hydrolase [Aspergillus flavus NRRL3357]
 gb|EED53031.1| leukotriene A4 hydrolase [Aspergillus flavus NRRL3357]
Length=666

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+   +V +  KT+   +ALQWL+P QT N+ HP++++QCQ+IHARSIFPCQD
Sbjct  144  VGLNEMVEVEISVKTTEKCTALQWLTPAQTSNRKHPYMFSQCQAIHARSIFPCQD  198



>ref|XP_001826499.2| leukotriene A-4 hydrolase [Aspergillus oryzae RIB40]
Length=662

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  167  VSLSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            V L+   +V +  KT+   +ALQWL+P QT N+ HP++++QCQ+IHARSIFPCQD
Sbjct  144  VGLNEMVEVEISVKTTEKCTALQWLTPAQTSNRKHPYMFSQCQAIHARSIFPCQD  198



>ref|WP_015066316.1| cold-active aminopeptidase [Alteromonas macleodii]
 gb|AFV84362.1| putative cold-active aminopeptidase [Alteromonas macleodii AltDE1]
 gb|AGP96370.1| cold-active aminopeptidase [Alteromonas macleodii str. 'Ionian 
Sea UM7']
 gb|AGQ00704.1| cold-active aminopeptidase [Alteromonas macleodii str. 'Ionian 
Sea UM4b']
Length=643

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +  A P +  L LDTR+L 
Sbjct  54   IASGVDYHSFANPNEVRVTHLSLDLTANFETKQLIGDVTLDVKRAKPENNTLVLDTRALD  113

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P     +       +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  114  IDSVTVNGESVPFEIGKTDPD----LGTPLTITLPSAANSVTVAYSTSPDASGVQWLTPA  169

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  170  QTAGKQHPFLFTQAQAVHARSFIPLQD  196



>ref|XP_011364220.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Pteropus vampyrus]
Length=573

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP+
Sbjct  53   LILDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_006914654.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Pteropus alecto]
 gb|ELK10360.1| Leukotriene A-4 hydrolase [Pteropus alecto]
Length=611

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP+
Sbjct  53   LILDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPN  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_004623860.1| PREDICTED: leukotriene A-4 hydrolase [Octodon degus]
Length=611

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+                    +  S+ ++LS   +V++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQGYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|NP_001269293.1| leukotriene A-4 hydrolase [Chinchilla lanigera]
 sp|Q6S9C8.3|LKHA4_CHILA RecName: Full=Leukotriene A-4 hydrolase; Short=LTA-4 hydrolase; 
AltName: Full=Leukotriene A(4) hydrolase [Chinchilla lanigera]
 gb|AAR26536.1| LTA4 hydrolase [Chinchilla lanigera]
Length=611

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT++L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LVLDTKALTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>ref|XP_002051925.1| GJ24461 [Drosophila virilis]
 gb|EDW64080.1| GJ24461 [Drosophila virilis]
Length=613

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/150 (33%), Positives = 79/150 (53%), Gaps = 7/150 (5%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSI  258
            ++ VDP S+++     T H S+    DF S+ +  + L       S    + LD R + +
Sbjct  4    LSNVDPSSYSEPELITTEHSSINWKVDFESTKLRGSVLHKFNVLSSNLEKILLDVRDIDV  63

Query  257  SAvldpvslsplpfslspslpdpVIGQSVTVSL-----SGQAQVLVLSKTSPSSSALQWL  93
                     + LP +   S P P +GQ +T+ L      G   V +  +T+ ++S LQWL
Sbjct  64   KNATLLAGGTELPINYFISDPVPDMGQKLTLELPTGTAKGSLNVRIDYETASNASGLQWL  123

Query  92   SPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            +P QT  K HP++++QCQ+IHARS+ PCQD
Sbjct  124  NPAQTLGKKHPYMFSQCQAIHARSVLPCQD  153



>ref|WP_014978452.1| aminopeptidase [Alteromonas macleodii]
 gb|AFT94300.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'Balearic Sea AD45']
Length=648

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +    P +  L LDTR+L 
Sbjct  59   IASGVDYHSFANPNEIRVTHLSLNLTANFETKQLVGDVTLDVKREKPDNNTLVLDTRALD  118

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P             +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  119  IQSVTVDGESVPFEMGEVDPD----LGTPLTITLPSSANAVTVAYSTSPEASGVQWLTPA  174

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  175  QTAGKKHPFLFTQAQAVHARSFIPLQD  201



>gb|EAW97560.1| leukotriene A4 hydrolase, isoform CRA_d [Homo sapiens]
Length=494

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_014948415.1| aminopeptidase [Alteromonas macleodii]
 gb|AFS36300.1| putative cold-active aminopeptidase [Alteromonas macleodii ATCC 
27126]
Length=648

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +    P +  L LDTR+L 
Sbjct  59   IASGVDYHSFANPNEIRVTHLSLNLTANFETKQLVGDVTLDVKREKPDNNTLVLDTRALD  118

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P             +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  119  IQSVTVDGESVPFEMGEVDPD----LGTPLTITLPSSANAVTVAYSTSPEASGVQWLTPA  174

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  175  QTAGKKHPFLFTQAQAVHARSFIPLQD  201



>ref|XP_005324508.1| PREDICTED: leukotriene A-4 hydrolase [Ictidomys tridecemlineatus]
Length=611

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|WP_014975769.1| aminopeptidase [Alteromonas macleodii]
 gb|AFT73492.1| putative cold-active aminopeptidase [Alteromonas macleodii str. 
'English Channel 673']
Length=648

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = -2

Query  434  VMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaAPYSGDLTLDTRSLS  261
            + + VD HSF +       H+SL L  +F +  +       +    P +  L LDTR+L 
Sbjct  59   IASGVDYHSFANPNEIRVTHLSLNLTANFETKQLVGDVTLDVKREKPDNNTLVLDTRALD  118

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPP  84
            I +V       P             +G  +T++L   A  V V   TSP +S +QWL+P 
Sbjct  119  IQSVTVDGESVPFEMGEVDPD----LGTPLTITLPSSANAVTVAYSTSPEASGVQWLTPA  174

Query  83   QTFNKTHPFVYTQCQSIHARSIFPCQD  3
            QT  K HPF++TQ Q++HARS  P QD
Sbjct  175  QTAGKKHPFLFTQAQAVHARSFIPLQD  201



>ref|XP_008685945.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Ursus maritimus]
Length=611

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>emb|CDQ64461.1| unnamed protein product [Oncorhynchus mykiss]
Length=615

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 76/143 (53%), Gaps = 4/143 (3%)
 Frame = -2

Query  419  DPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSISAvl  246
            DP SF+  +   T H++LT + DF S  I A   L++         LTLDT+ L +S V 
Sbjct  6    DPCSFSSFSKCVTKHLNLTYHVDFDSHVIKAKVALTVEVLVDNFTSLTLDTKDLKVSKVT  65

Query  245  dpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLV--LSKTSPSSSALQWLSPPQTFN  72
                 +        S     +  ++   LS    V+V    +T+PS+SALQWL+P QT  
Sbjct  66   ANGQAAKFTLGPKHSFMGTPLEITLPFDLSRGQHVIVEVTYETAPSASALQWLTPEQTAG  125

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K HP++++QCQ+ H RS+ PCQD
Sbjct  126  KKHPYLFSQCQATHCRSMVPCQD  148



>ref|XP_002919280.1| PREDICTED: leukotriene A-4 hydrolase [Ailuropoda melanoleuca]
 gb|EFB15975.1| hypothetical protein PANDA_007898 [Ailuropoda melanoleuca]
Length=611

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>gb|KIW92424.1| leukotriene A-4 hydrolase/aminopeptidase [Cladophialophora bantiana 
CBS 173.52]
Length=625

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  161  LSGQAQVLVLSKTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            L  +  + +  +T+PS +ALQWL+P QT NK HP++++QCQ+IHARSIFPCQD
Sbjct  101  LKEKIDIEISLETTPSCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPCQD  153



>ref|XP_005882424.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Myotis brandtii]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_008143170.1| PREDICTED: leukotriene A-4 hydrolase [Eptesicus fuscus]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_005268928.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Homo sapiens]
 ref|XP_008958573.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Pan paniscus]
 ref|XP_009424248.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Pan troglodytes]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_006757685.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Myotis davidii]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_006109766.1| PREDICTED: LOW QUALITY PROTEIN: leukotriene A4 hydrolase [Myotis 
lucifugus]
Length=604

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPLEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_008567281.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Galeopterus 
variegatus]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVTYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPR  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_010778729.1| PREDICTED: leukotriene A-4 hydrolase, partial [Notothenia coriiceps]
Length=157

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 4/143 (3%)
 Frame = -2

Query  419  DPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSG--DLTLDTRSLSISAvl  246
            DP SF+  +H  T H++L L+ DF    I     L++ A       LTLD R L + +V 
Sbjct  3    DPCSFSSVSHFLTRHLNLALHVDFSRHVIRGVLALTVEALQDRLHALTLDCRDLQVFSVK  62

Query  245  dpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLV--LSKTSPSSSALQWLSPPQTFN  72
                 +        +     +  ++   LS    V+V    +TSP+++ALQWLSP QT  
Sbjct  63   ANGQAARFTTGPKHTFKGAPLEITLPFDLSRGQHVIVEVTYETSPTATALQWLSPEQTAG  122

Query  71   KTHPFVYTQCQSIHARSIFPCQD  3
            K  P++++QCQ+ H RS+ PCQD
Sbjct  123  KEKPYLFSQCQAHHCRSMIPCQD  145



>ref|XP_005882423.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Myotis brandtii]
 gb|EPQ17729.1| Leukotriene A-4 hydrolase [Myotis brandtii]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>gb|EAW97558.1| leukotriene A4 hydrolase, isoform CRA_b [Homo sapiens]
Length=555

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_007796836.1| putative leukotriene a-4 hydrolase protein [Eutypa lata UCREL1]
 gb|EMR64070.1| putative leukotriene a-4 hydrolase protein [Eutypa lata UCREL1]
Length=617

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 77/149 (52%), Gaps = 7/149 (5%)
 Frame = -2

Query  431  MAPVDPHSFTDSAHPFTVHISLTLYFDFPsstisaa---tllslaAPYSGDLTLDTRSLS  261
            MAP DP++  +     T H ++    +F    +  +    L SL    S ++TLDT  LS
Sbjct  43   MAPRDPNTLANYGDWRTKHTTVNFKINFEKQRLEGSVLLELESLTDNQSKEITLDTNYLS  102

Query  260  ISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS---KTSPSSSALQWLS  90
            IS+V    S S              +  SV  + + Q +V+ L    +T+     LQWL+
Sbjct  103  ISSVKLNSSDSDWKVKDRVEPYGSPLHVSVP-NGAPQGEVIKLDIELETTKECVGLQWLT  161

Query  89   PPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            P QT NK HP+VY+QCQ+I ARSIFPCQD
Sbjct  162  PAQTGNKKHPYVYSQCQAILARSIFPCQD  190



>ref|WP_005493302.1| Cold-active aminopeptidase (Neutral zinc metallopeptidase, M1 
family) [Pseudoalteromonas luteoviolacea]
 emb|CCQ11403.1| Cold-active aminopeptidase (Neutral zinc metallopeptidase, M1 
family) [Pseudoalteromonas luteoviolacea B = ATCC 29581]
Length=615

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/162 (31%), Positives = 80/162 (49%), Gaps = 5/162 (3%)
 Frame = -2

Query  473  KNPVLCRS-PCKTEVMAPVDPHSFTDSAHPFTVHISLTLYFDFPsstis--aatllslaA  303
            K  +LC S   +   +A +D H++ +     + H+ L L  DF    +       L+   
Sbjct  7    KISLLCASLSAQAYAIAAIDEHTYANLDEVVSTHLYLDLNVDFADKELEGFVEHTLAWKK  66

Query  302  PYSGDLTLDTRSLSISAvldpvslsplpfslspslpdpVI-GQSVTVSLSGQAQ-VLVLS  129
              +  L LDTR L+I  V+   +      +         + G  +T++   QA+ V V  
Sbjct  67   KQARSLVLDTRDLTIHRVIYETAEGTWKAAKFTLADRDDVKGSKLTITFQNQAKRVRVYY  126

Query  128  KTSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
             + P +S LQWL+P QT +K+HPF+Y+Q Q+IHARS  P QD
Sbjct  127  NSRPEASGLQWLTPEQTASKSHPFMYSQSQAIHARSWIPVQD  168



>ref|WP_034733151.1| aminopeptidase [Idiomarina sp. MCCC 1A10513]
Length=614

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 2/141 (1%)
 Frame = -2

Query  419  DPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGD-LTLDTRSLSISAvld  243
            D HS+       T H+ L L  DF +  +       L      D L LDTR L+I     
Sbjct  27   DAHSYAKLNEVSTPHLELDLTIDFDNKQLVGTATYDLLRHGDADTLHLDTRDLTIEKTEL  86

Query  242  pvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPPQTFNKT  66
             V  +    +         +GQ +T+S+   A+ V +   T+P++S LQWL+P QT  K 
Sbjct  87   WVDNAWQETAYQLGDAHETLGQELTISIGDSAEKVRIHYATAPTASGLQWLTPEQTAGKK  146

Query  65   HPFVYTQCQSIHARSIFPCQD  3
            HPF+++Q Q IH+RS  P QD
Sbjct  147  HPFMFSQSQPIHSRSWIPIQD  167



>gb|KFZ28492.1| aminopeptidase [Idiomarina sp. MCCC 1A10513]
Length=616

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 2/141 (1%)
 Frame = -2

Query  419  DPHSFTDSAHPFTVHISLTLYFDFPsstisaatllslaAPYSGD-LTLDTRSLSISAvld  243
            D HS+       T H+ L L  DF +  +       L      D L LDTR L+I     
Sbjct  29   DAHSYAKLNEVSTPHLELDLTIDFDNKQLVGTATYDLLRHGDADTLHLDTRDLTIEKTEL  88

Query  242  pvslsplpfslspslpdpVIGQSVTVSLSGQAQ-VLVLSKTSPSSSALQWLSPPQTFNKT  66
             V  +    +         +GQ +T+S+   A+ V +   T+P++S LQWL+P QT  K 
Sbjct  89   WVDNAWQETAYQLGDAHETLGQELTISIGDSAEKVRIHYATAPTASGLQWLTPEQTAGKK  148

Query  65   HPFVYTQCQSIHARSIFPCQD  3
            HPF+++Q Q IH+RS  P QD
Sbjct  149  HPFMFSQSQPIHSRSWIPIQD  169



>ref|XP_011282463.1| PREDICTED: leukotriene A-4 hydrolase [Felis catus]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQDVKYALGERQSYRGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>gb|KFE72324.1| hypothetical protein DB31_0586 [Hyalangium minutum]
Length=559

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = -2

Query  302  PYSGDLTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSL-SGQAQVLVLSK  126
            P +G L LDTR L I AV+D            P      +G  + + L  G  Q+ V  +
Sbjct  19   PSAGPLDLDTRELDIRAVVDDQGKPLPFHLAPPEPI---LGSRLRIQLPKGLRQLTVRYR  75

Query  125  TSPSSSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            TSP +SALQWL+P QT    HPF+++QCQ+IHARS+ P QD
Sbjct  76   TSPQASALQWLTPSQTAGGQHPFLFSQCQAIHARSVIPLQD  116



>ref|XP_010338482.1| PREDICTED: leukotriene A-4 hydrolase isoform X2 [Saimiri boliviensis 
boliviensis]
Length=532

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +++V    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVVEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>gb|EAW97557.1| leukotriene A4 hydrolase, isoform CRA_a [Homo sapiens]
Length=610

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_006757684.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Myotis davidii]
 ref|XP_006757686.1| PREDICTED: leukotriene A-4 hydrolase isoform X3 [Myotis davidii]
 gb|ELK34920.1| Leukotriene A-4 hydrolase [Myotis davidii]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVKYVLGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_004053757.1| PREDICTED: leukotriene A-4 hydrolase [Gorilla gorilla gorilla]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>pdb|3CHO|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex 
With 2-Amino-N-[4-(Phenylmethoxy)phenyl]-Acetamide
 pdb|3CHP|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex 
With (3s)-3-Amino-4-Oxo-4-[(4-Phenylmethoxyphenyl) Amino]butanoic 
Acid
 pdb|3CHQ|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex 
With N5-[4-(Phenylmethoxy)phenyl]-L-Glutamine
 pdb|3CHR|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex 
With 4-Amino-N-[4-(Phenylmethoxy)phenyl]-Butanamide
 pdb|3CHS|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex 
With (2s)-2-Amino-5-[[4-[(2s)-2-Hydroxy-2-Phenyl- Ethoxy]phenyl]amino]-5-Oxo-Pentanoic 
Acid
Length=610

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  52   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  111

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  112  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  148



>pdb|2R59|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor Rb3041
 pdb|3B7R|L Chain L, Leukotriene A4 Hydrolase Complexed With Inhibitor Rb3040
 pdb|3B7U|X Chain X, Leukotriene A4 Hydrolase Complexed With Kelatorphan
Length=616

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  58   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  117

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  118  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  154



>ref|XP_008567280.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Galeopterus 
variegatus]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQEVTYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPR  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>pdb|1SQM|A Chain A, Structure Of [r563a] Leukotriene A4 Hydrolase
Length=610

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  52   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  111

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  112  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  148



>pdb|1GW6|A Chain A, Structure Of Leukotriene A4 Hydrolase D375n Mutant
Length=610

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  52   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  111

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  112  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  148



>ref|XP_007085703.1| PREDICTED: leukotriene A-4 hydrolase [Panthera tigris altaica]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LILDTKDLTIEKVVINGQDVKYALGERQSYRGSPMEISLPIALSKNQEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>ref|XP_010627469.1| PREDICTED: leukotriene A-4 hydrolase [Fukomys damarensis]
 gb|KFO31146.1| Leukotriene A-4 hydrolase [Fukomys damarensis]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   +V++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYSLGERQSYKGSPLEISLPIALSKNEEVVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R++ PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQD  149



>ref|NP_000886.1| leukotriene A-4 hydrolase isoform 1 [Homo sapiens]
 ref|XP_003808292.1| PREDICTED: leukotriene A-4 hydrolase isoform X1 [Pan paniscus]
 sp|P09960.2|LKHA4_HUMAN RecName: Full=Leukotriene A-4 hydrolase; Short=LTA-4 hydrolase; 
AltName: Full=Leukotriene A(4) hydrolase [Homo sapiens]
 pdb|1HS6|A Chain A, Structure Of Leukotriene A4 Hydrolase Complexed With 
Bestatin.
 pdb|2VJ8|A Chain A, Complex Of Human Leukotriene A4 Hydrolase With A Hydroxamic 
Acid Inhibitor
 pdb|3FTS|A Chain A, Leukotriene A4 Hydrolase In Complex With Resveratrol
 pdb|3FTU|A Chain A, Leukotriene A4 Hydrolase In Complex With Dihydroresveratrol
 pdb|3FTV|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment N- 
(Pyridin-3-Ylmethyl)aniline
 pdb|3FTW|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragments N- 
(Pyridin-3-Ylmethyl)aniline And Acetate
 pdb|3FTX|A Chain A, Leukotriene A4 Hydrolase In Complex With Dihydroresveratrol 
And Bestatin
 pdb|3FTY|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 3- 
(Benzyloxy)pyridin-2-Amine
 pdb|3FU0|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 4-(4- 
Fluorobenzoyl)pyridine
 pdb|3FU3|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 4-(2- 
Amino-1,3-Thiazol-4-Yl)phenol
 pdb|3FU5|A Chain A, Leukotriene A4 Hydrolase In Complex With (5-Thiophen-2- 
Ylthiophen-2-Yl)methylamine
 pdb|3FU6|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment (4- 
Thiophen-2-Ylphenyl)methanamine
 pdb|3FUD|A Chain A, Leukotriene A4 Hydrolase In Complex With N-Methyl-1-(2- 
Thiophen-2-Ylphenyl)methanamine
 pdb|3FUE|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 5- 
Chloroindole And Bestatin
 pdb|3FUF|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 5- 
Fluoroindole And Bestatin
 pdb|3FUH|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 5- 
Hydroxyindole And Bestatin
 pdb|3FUI|A Chain A, Leukotriene A4 Hydrolase In Complex With N-Benzyl-4-[(2r)- 
Pyrrolidin-2-Ylmethoxy]aniline
 pdb|3FUJ|A Chain A, Leukotriene A4 Hydrolase In Complex With 5-[2-(1h-Pyrrol-1- 
Yl)ethoxy]-1h-Indole
 pdb|3FUK|A Chain A, Leukotriene A4 Hydrolase In Complex With 1-[2-(1h-Indol-5- 
Yloxy)ethyl]piperidine-4-Carboxylic Acid
 pdb|3FUM|A Chain A, Leukotriene A4 Hydrolase In Complex With (R)-Pyridin-4-Yl[4- 
(2-Pyrrolidin-1-Ylethoxy)phenyl]methanol
 pdb|3FUN|A Chain A, Leukotriene A4 Hydrolase In Complex With {4-[(2r)- Pyrrolidin-2-Ylmethoxy]phenyl}(4-Thiophen-3-Ylphenyl) 
Methanone
 pdb|3FH5|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor (2r)-2-[(4- 
Benzylphenoxy)methyl]pyrrolidine.
 pdb|3FH7|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor 4-[(2s)-2-{[4-(4- 
Chlorophenoxy)phenoxy]methyl}pyrrolidin-1-Yl]butanoate.
 pdb|3FH8|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor 1-[2-(4- 
Benzylphenoxy)ethyl]pyrrolidine.
 pdb|3FHE|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor N-[3-(4- 
Benzylphenoxy)propyl]-N-Methyl-Beta-Alanine.
 pdb|3FTZ|A Chain A, Leukotriene A4 Hydrolase In Complex With Fragment 2-(pyridin-3- 
Ylmethoxy)aniline
 pdb|3FUL|A Chain A, Leukotriene A4 Hydrolase In Complex With Pyridin-4-Yl[4-(2-Pyrrolidin- 
1-Ylethoxy)phenyl]methanone
 pdb|4DPR|A Chain A, Structure Of Human Leukotriene A4 Hydrolase In Complex 
With Inhibitor Captopril
 pdb|4L2L|A Chain A, Human Leukotriene A4 Hydrolase Complexed With Ligand 
4-(4- Benzylphenyl)thiazol-2-amine
 pdb|4MKT|A Chain A, Human Leukotriene A4 Hydrolase In Complex With Pro-gly-pro 
Analogue And 4-(4-benzylphenyl)thiazol-2-amine
 pdb|4MS6|A Chain A, Human Leukotriene A4 Hydrolase In Complex With Pro-gly-pro 
Analogue
 gb|AAA36176.1| leukotriene A-4 hydrolase precursor [Homo sapiens]
 gb|AAA36177.1| leukotriene A4 hydrolase [Homo sapiens]
 gb|AAA89077.1| leukotriene A4 hydrolase [Homo sapiens]
 gb|AAH32528.1| Leukotriene A4 hydrolase [Homo sapiens]
 emb|CAG33349.1| LTA4H [Homo sapiens]
 gb|EAW97559.1| leukotriene A4 hydrolase, isoform CRA_c [Homo sapiens]
 dbj|BAJ20678.1| leukotriene A4 hydrolase [synthetic construct]
 gb|ADZ15951.1| leukotriene A4 hydrolase [synthetic construct]
Length=611

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  53   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  112

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  113  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  149



>pdb|3U9W|A Chain A, Structure Of Human Leukotriene A4 Hydrolase In Complex 
With Inhibitor Sc57461a
 pdb|5AEN|A Chain A, Structure Of Human Leukotriene A4 Hydrolase In Complex 
With Inhibitor Dimethyl(2-(4-phenoxyphenoxy)ethyl)amine
Length=608

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  50   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  109

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  110  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  146



>pdb|3B7S|A Chain A, [e296q]lta4h In Complex With Rsr Substrate
 pdb|3B7T|A Chain A, [e296q]lta4h In Complex With Arg-Ala-Arg Substrate
Length=616

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  287  LTLDTRSLSISAvldpvslsplpfslspslpdpVIGQSVTVSLSGQAQVLVLS--KTSPS  114
            L LDT+ L+I  V+              S     +  S+ ++LS   ++++    +TSP 
Sbjct  58   LVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPK  117

Query  113  SSALQWLSPPQTFNKTHPFVYTQCQSIHARSIFPCQD  3
            SSALQWL+P QT  K HP++++QCQ+IH R+I PCQD
Sbjct  118  SSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQD  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220