BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002H06 641 bp,

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086410.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      273   1e-84   Sesamum indicum [beniseed]
emb|CDP00275.1|  unnamed protein product                                268   3e-82   Coffea canephora [robusta coffee]
ref|XP_009610610.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    258   7e-79   Nicotiana tomentosiformis
ref|XP_009775473.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      258   7e-79   Nicotiana sylvestris
ref|XP_009610611.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    258   8e-79   Nicotiana tomentosiformis
ref|XP_006357252.1|  PREDICTED: nitrate transporter 1.7-like            256   4e-78   Solanum tuberosum [potatoes]
gb|EYU28693.1|  hypothetical protein MIMGU_mgv1a004515mg                253   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_003551991.1|  PREDICTED: nitrate transporter 1.7-like            253   9e-77   Glycine max [soybeans]
gb|EPS62066.1|  hypothetical protein M569_12727                         251   2e-76   Genlisea aurea
gb|KJB77129.1|  hypothetical protein B456_012G121800                    247   3e-75   Gossypium raimondii
gb|KHG14034.1|  Nitrate transporter 1.7 -like protein                   246   3e-74   Gossypium arboreum [tree cotton]
ref|XP_007157410.1|  hypothetical protein PHAVU_002G067700g             246   4e-74   Phaseolus vulgaris [French bean]
ref|XP_002269340.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           246   4e-74   Vitis vinifera
ref|XP_004489968.1|  PREDICTED: nitrate transporter 1.7-like            246   5e-74   Cicer arietinum [garbanzo]
gb|KDO39248.1|  hypothetical protein CISIN_1g007862mg                   242   5e-74   Citrus sinensis [Valencia orange]
ref|XP_006438562.1|  hypothetical protein CICLE_v10030982mg             242   6e-74   Citrus clementina
gb|KDP21241.1|  hypothetical protein JCGZ_21712                         245   7e-74   Jatropha curcas
gb|KJB77128.1|  hypothetical protein B456_012G121800                    244   2e-73   Gossypium raimondii
gb|KHN01163.1|  Nitrate transporter 1.7                                 243   3e-73   Glycine soja [wild soybean]
ref|XP_007044382.1|  Nitrate transporter 1.7, putative                  243   4e-73   Theobroma cacao [chocolate]
gb|KDO39247.1|  hypothetical protein CISIN_1g007862mg                   242   6e-73   Citrus sinensis [Valencia orange]
gb|KDO39246.1|  hypothetical protein CISIN_1g007862mg                   242   6e-73   Citrus sinensis [Valencia orange]
ref|XP_004509940.1|  PREDICTED: nitrate transporter 1.7-like            243   7e-73   Cicer arietinum [garbanzo]
ref|XP_006378165.1|  proton-dependent oligopeptide transport fami...    242   8e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006483256.1|  PREDICTED: nitrate transporter 1.7-like isof...    242   9e-73   Citrus sinensis [Valencia orange]
ref|XP_009105593.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      232   1e-72   Brassica rapa
ref|XP_010044698.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      243   2e-72   Eucalyptus grandis [rose gum]
ref|XP_010551494.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           241   2e-72   Tarenaya hassleriana [spider flower]
gb|KHN28716.1|  Nitrate transporter 1.7                                 241   2e-72   Glycine soja [wild soybean]
ref|XP_006438561.1|  hypothetical protein CICLE_v10030982mg             241   3e-72   Citrus clementina
ref|XP_003613558.1|  Peptide transporter PTR1                           241   3e-72   Medicago truncatula
ref|XP_006483255.1|  PREDICTED: nitrate transporter 1.7-like isof...    241   4e-72   Citrus sinensis [Valencia orange]
ref|XP_003519778.1|  PREDICTED: nitrate transporter 1.7-like            241   6e-72   Glycine max [soybeans]
ref|XP_004297809.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      240   1e-71   Fragaria vesca subsp. vesca
ref|XP_004238760.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           239   1e-71   Solanum lycopersicum
ref|XP_002520155.1|  nitrate transporter, putative                      239   2e-71   Ricinus communis
ref|XP_011006584.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           236   2e-70   Populus euphratica
ref|XP_010096325.1|  Nitrate transporter 1.7                            235   5e-70   Morus notabilis
gb|KEH19853.1|  peptide/nitrate transporter                             234   1e-69   Medicago truncatula
ref|XP_002863113.1|  proton-dependent oligopeptide transport fami...    232   1e-68   Arabidopsis lyrata subsp. lyrata
emb|CDY38767.1|  BnaA07g28390D                                          232   1e-68   Brassica napus [oilseed rape]
ref|XP_009105659.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           232   1e-68   Brassica rapa
ref|XP_006302005.1|  hypothetical protein CARUB_v10019982mg             231   2e-68   Capsella rubella
ref|NP_564979.1|  nitrate transporter 1.7                               231   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52567.1|AC010675_15  putative peptide transporter; 37139-33250    231   3e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48389.1|  BnaA07g24080D                                          230   4e-68   Brassica napus [oilseed rape]
ref|XP_009127767.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           229   5e-68   Brassica rapa
emb|CDY56086.1|  BnaA02g35730D                                          229   5e-68   Brassica napus [oilseed rape]
ref|XP_010256203.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      230   6e-68   Nelumbo nucifera [Indian lotus]
emb|CDY53067.1|  BnaCnng24110D                                          229   7e-68   Brassica napus [oilseed rape]
emb|CDY11647.1|  BnaC06g30920D                                          230   7e-68   Brassica napus [oilseed rape]
ref|XP_007222023.1|  hypothetical protein PRUPE_ppa002984mg             229   1e-67   Prunus persica
dbj|BAJ33974.1|  unnamed protein product                                229   1e-67   Eutrema halophilum
ref|XP_006390953.1|  hypothetical protein EUTSA_v10018285mg             229   1e-67   Eutrema salsugineum
ref|XP_008353106.1|  PREDICTED: uncharacterized protein LOC103416653    234   2e-67   
ref|XP_010512052.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           228   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007153857.1|  hypothetical protein PHAVU_003G070500g             227   4e-67   Phaseolus vulgaris [French bean]
ref|XP_010415654.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      228   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010470990.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           228   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010683278.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           225   3e-66   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KFK41407.1|  hypothetical protein AALP_AA2G126900                    224   6e-66   Arabis alpina [alpine rockcress]
ref|XP_008221697.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      224   8e-66   
ref|XP_009360408.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           223   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_010475864.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      223   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007226812.1|  hypothetical protein PRUPE_ppa024795mg             222   2e-65   Prunus persica
ref|XP_010443122.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      221   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008367039.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      222   4e-65   Malus domestica [apple tree]
ref|XP_010482935.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      222   6e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008221751.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      221   8e-65   Prunus mume [ume]
ref|XP_006645212.1|  PREDICTED: nitrate transporter 1.7-like            218   3e-64   
emb|CDY23545.1|  BnaC06g25140D                                          219   6e-64   Brassica napus [oilseed rape]
dbj|BAK04665.1|  predicted protein                                      219   9e-64   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008446297.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    218   1e-63   
ref|XP_010926623.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      218   1e-63   Elaeis guineensis
ref|XP_010926624.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      217   4e-63   Elaeis guineensis
ref|XP_007044381.1|  Nitrate transporter 1.7, putative                  216   8e-63   Theobroma cacao [chocolate]
gb|KJB48086.1|  hypothetical protein B456_008G052800                    214   8e-63   Gossypium raimondii
ref|XP_004155325.1|  PREDICTED: LOW QUALITY PROTEIN: nitrate tran...    216   9e-63   
ref|XP_008221696.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      216   1e-62   Prunus mume [ume]
ref|XP_009389042.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      214   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48085.1|  hypothetical protein B456_008G052800                    214   3e-62   Gossypium raimondii
ref|XP_007227399.1|  hypothetical protein PRUPE_ppb015207mg             214   3e-62   Prunus persica
gb|KJB61233.1|  hypothetical protein B456_009G346900                    214   3e-62   Gossypium raimondii
ref|XP_004971025.1|  PREDICTED: nitrate transporter 1.7-like isof...    213   4e-62   
gb|EMS49861.1|  Nitrate transporter 1.7                                 214   7e-62   Triticum urartu
ref|NP_001045170.1|  Os01g0913300                                       213   1e-61   
ref|XP_004135202.1|  PREDICTED: nitrate transporter 1.7-like            213   2e-61   Cucumis sativus [cucumbers]
gb|EMT16488.1|  Peptide transporter PTR1                                208   2e-61   Aegilops tauschii
gb|KHG01988.1|  hypothetical protein F383_22454                         212   2e-61   Gossypium arboreum [tree cotton]
ref|XP_004971024.1|  PREDICTED: nitrate transporter 1.7-like isof...    212   3e-61   Setaria italica
ref|XP_010232727.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      211   3e-61   Brachypodium distachyon [annual false brome]
ref|XP_007226648.1|  hypothetical protein PRUPE_ppa022076mg             210   9e-61   Prunus persica
gb|KHF99049.1|  Nitrate transporter 1.7 -like protein                   210   9e-61   Gossypium arboreum [tree cotton]
gb|KHN48151.1|  Nitrate transporter 1.7                                 209   2e-60   Glycine soja [wild soybean]
ref|XP_003553207.1|  PREDICTED: nitrate transporter 1.7-like            209   3e-60   Glycine max [soybeans]
emb|CBH32526.1|  peptide transporter, putative, expressed               208   6e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006415996.1|  hypothetical protein EUTSA_v10007235mg             207   1e-59   Eutrema salsugineum
ref|XP_011463116.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      207   1e-59   Fragaria vesca subsp. vesca
ref|XP_009408470.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      206   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838787.1|  hypothetical protein AMTR_s00002p00259170          206   4e-59   
ref|XP_009397037.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...    205   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...    205   6e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES96528.2|  peptide/nitrate transporter                             205   7e-59   Medicago truncatula
gb|KFK44623.1|  hypothetical protein AALP_AA1G282800                    204   1e-58   Arabis alpina [alpine rockcress]
ref|XP_004489982.1|  PREDICTED: nitrate transporter 1.7-like            204   1e-58   Cicer arietinum [garbanzo]
ref|XP_003613570.1|  Peptide transporter                                204   2e-58   
ref|XP_008787832.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      203   2e-58   
gb|EEC72017.1|  hypothetical protein OsI_04891                          202   3e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_008221752.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      204   3e-58   Prunus mume [ume]
gb|AEN81203.1|  AT1G69870-like protein                                  192   3e-58   Capsella rubella
ref|XP_008340336.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      203   5e-58   Malus domestica [apple tree]
gb|ADG38047.1|  AT1G69870-like protein                                  191   8e-58   Capsella grandiflora
ref|XP_010460223.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      202   1e-57   Camelina sativa [gold-of-pleasure]
gb|ADG38051.1|  AT1G69870-like protein                                  190   1e-57   Capsella grandiflora
gb|AAT45007.1|  nitrate transporter                                     194   2e-57   Xerophyta humilis
ref|XP_010923294.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      202   2e-57   Elaeis guineensis
ref|XP_006304643.1|  hypothetical protein CARUB_v10011778mg             200   5e-57   Capsella rubella
ref|XP_008340338.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      200   7e-57   
ref|XP_010477772.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           199   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009103775.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    199   1e-56   Brassica rapa
emb|CDY25813.1|  BnaA07g09690D                                          199   1e-56   Brassica napus [oilseed rape]
gb|ADG38053.1|  AT1G69870-like protein                                  188   1e-56   Neslia paniculata [ball mustard]
gb|KEH19852.1|  peptide/nitrate transporter                             199   2e-56   Medicago truncatula
ref|XP_007153856.1|  hypothetical protein PHAVU_003G070400g             199   2e-56   Phaseolus vulgaris [French bean]
ref|XP_009103122.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           197   4e-56   Brassica rapa
ref|XP_010498968.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      196   9e-56   Camelina sativa [gold-of-pleasure]
emb|CDY40280.1|  BnaA07g09200D                                          196   1e-55   Brassica napus [oilseed rape]
ref|XP_010933709.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       196   2e-55   Elaeis guineensis
ref|XP_010112576.1|  putative peptide/nitrate transporter               195   4e-55   Morus notabilis
ref|NP_174028.2|  nitrate transporter 1.6                               194   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317993.2|  proton-dependent oligopeptide transport fami...    194   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002893357.1|  predicted protein                                  193   9e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010552600.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    193   1e-54   Tarenaya hassleriana [spider flower]
emb|CDY28441.1|  BnaC07g12690D                                          193   1e-54   Brassica napus [oilseed rape]
gb|AAF79856.1|AC000348_9  T7N9.14                                       195   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932898.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      193   3e-54   Elaeis guineensis
ref|XP_008807862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      192   3e-54   Phoenix dactylifera
ref|XP_004510061.1|  PREDICTED: nitrate transporter 1.7-like            192   5e-54   Cicer arietinum [garbanzo]
ref|XP_009413298.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      191   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002517462.1|  nitrate transporter, putative                      191   2e-53   
ref|XP_010933657.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           191   2e-53   Elaeis guineensis
ref|XP_002517463.1|  nitrate transporter, putative                      189   3e-53   
ref|XP_010256190.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       190   4e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002442576.1|  hypothetical protein SORBIDRAFT_08g022290          189   6e-53   Sorghum bicolor [broomcorn]
ref|XP_002517461.1|  nitrate transporter, putative                      189   7e-53   Ricinus communis
ref|XP_006367063.1|  PREDICTED: probable peptide/nitrate transpor...    189   9e-53   Solanum tuberosum [potatoes]
ref|XP_008796643.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    188   1e-52   Phoenix dactylifera
ref|XP_011087208.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      187   2e-52   Sesamum indicum [beniseed]
ref|XP_004236178.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           187   2e-52   Solanum lycopersicum
ref|XP_009105658.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    187   3e-52   Brassica rapa
gb|EAZ28180.1|  hypothetical protein OsJ_12153                          185   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g             187   5e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002317995.2|  proton-dependent oligopeptide transport fami...    187   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002517459.1|  nitrate transporter, putative                      187   6e-52   
gb|ADE76434.1|  unknown                                                 187   8e-52   Picea sitchensis
ref|XP_002443661.1|  hypothetical protein SORBIDRAFT_08g023060          186   9e-52   Sorghum bicolor [broomcorn]
ref|XP_011464561.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    186   1e-51   Fragaria vesca subsp. vesca
ref|XP_004982146.1|  PREDICTED: probable peptide/nitrate transpor...    184   1e-51   
ref|XP_011042616.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      186   1e-51   Populus euphratica
emb|CDY38766.1|  BnaA07g28380D                                          185   1e-51   Brassica napus [oilseed rape]
ref|XP_010678901.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      186   1e-51   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AES91176.2|  peptide/nitrate transporter                             185   3e-51   Medicago truncatula
gb|KDP45469.1|  hypothetical protein JCGZ_09718                         185   3e-51   Jatropha curcas
gb|EEC75965.1|  hypothetical protein OsI_13072                          185   3e-51   Oryza sativa Indica Group [Indian rice]
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708              183   3e-51   Zea mays [maize]
gb|AAT85061.1|  nitrate transporter, putative                           185   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608979.1|  Nitrate transporter NRT1-2                         185   3e-51   
ref|XP_010546036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      185   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_002517444.1|  nitrate transporter, putative                      184   5e-51   Ricinus communis
ref|XP_010550650.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      184   5e-51   Tarenaya hassleriana [spider flower]
dbj|BAJ91042.1|  predicted protein                                      182   6e-51   Hordeum vulgare subsp. vulgare [barley]
gb|ACN27476.1|  unknown                                                 184   6e-51   Zea mays [maize]
ref|NP_001130360.1|  uncharacterized protein LOC100191455               184   6e-51   Zea mays [maize]
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       184   6e-51   Populus euphratica
gb|KDO76033.1|  hypothetical protein CISIN_1g007827mg                   182   6e-51   Citrus sinensis [Valencia orange]
ref|NP_001130581.1|  uncharacterized protein LOC100191680               182   6e-51   Zea mays [maize]
dbj|BAB19759.1|  putative nitrate transporter NRT1-4                    175   7e-51   Glycine max [soybeans]
ref|XP_010923295.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    184   7e-51   Elaeis guineensis
gb|ADH21397.1|  nitrate transporter                                     184   7e-51   Citrus trifoliata [hardy orange]
ref|NP_173322.1|  probable peptide/nitrate transporter                  184   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838790.1|  hypothetical protein AMTR_s00002p00259450          183   8e-51   Amborella trichopoda
ref|XP_002300021.1|  hypothetical protein POPTR_0001s34640g             184   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010923296.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    183   9e-51   Elaeis guineensis
ref|XP_002464068.1|  hypothetical protein SORBIDRAFT_01g011700          183   1e-50   Sorghum bicolor [broomcorn]
gb|KDO76032.1|  hypothetical protein CISIN_1g007827mg                   182   1e-50   Citrus sinensis [Valencia orange]
ref|XP_006439661.1|  hypothetical protein CICLE_v10019426mg             181   1e-50   Citrus clementina
ref|XP_008807860.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      183   1e-50   Phoenix dactylifera
emb|CDY11648.1|  BnaC06g30910D                                          182   1e-50   Brassica napus [oilseed rape]
ref|XP_004508785.1|  PREDICTED: probable peptide/nitrate transpor...    183   1e-50   
gb|EYU35890.1|  hypothetical protein MIMGU_mgv1a018347mg                176   1e-50   Erythranthe guttata [common monkey flower]
gb|KFK34096.1|  hypothetical protein AALP_AA5G101400                    183   1e-50   Arabis alpina [alpine rockcress]
ref|XP_008796703.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      183   2e-50   Phoenix dactylifera
ref|XP_004508784.1|  PREDICTED: probable peptide/nitrate transpor...    183   2e-50   Cicer arietinum [garbanzo]
gb|KDP45468.1|  hypothetical protein JCGZ_09717                         182   2e-50   Jatropha curcas
ref|XP_007032430.1|  Major facilitator superfamily protein              182   2e-50   Theobroma cacao [chocolate]
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...    182   2e-50   Zea mays [maize]
gb|KDO76031.1|  hypothetical protein CISIN_1g007827mg                   182   2e-50   Citrus sinensis [Valencia orange]
ref|XP_006367062.1|  PREDICTED: probable peptide/nitrate transpor...    182   2e-50   Solanum tuberosum [potatoes]
ref|XP_006476663.1|  PREDICTED: probable peptide/nitrate transpor...    182   3e-50   Citrus sinensis [Valencia orange]
dbj|BAJ96711.1|  predicted protein                                      182   3e-50   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ91141.1|  predicted protein                                      182   3e-50   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ94405.1|  predicted protein                                      182   3e-50   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK08097.1|  predicted protein                                      182   3e-50   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006439662.1|  hypothetical protein CICLE_v10019426mg             182   3e-50   Citrus clementina
gb|AHV83614.1|  nitrate transporter                                     182   4e-50   Camellia sinensis [black tea]
dbj|BAJ34570.1|  unnamed protein product                                182   5e-50   Eutrema halophilum
ref|XP_002517460.1|  nitrate transporter, putative                      181   5e-50   Ricinus communis
ref|XP_004236179.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      181   5e-50   Solanum lycopersicum
gb|KEH31902.1|  peptide/nitrate transporter                             181   5e-50   Medicago truncatula
ref|XP_006404313.1|  hypothetical protein EUTSA_v10010180mg             182   6e-50   Eutrema salsugineum
ref|XP_010532304.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    181   6e-50   Tarenaya hassleriana [spider flower]
dbj|BAJ93857.1|  predicted protein                                      181   6e-50   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      181   7e-50   Brachypodium distachyon [annual false brome]
emb|CDX68450.1|  BnaC01g25280D                                          181   9e-50   Brassica napus [oilseed rape]
ref|XP_004508786.1|  PREDICTED: probable peptide/nitrate transpor...    180   1e-49   
ref|XP_008364618.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      180   1e-49   Malus domestica [apple tree]
ref|XP_010678592.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      180   1e-49   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011013862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      178   1e-49   Populus euphratica
ref|XP_009400863.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      180   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      180   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007133916.1|  hypothetical protein PHAVU_010G003000g             179   2e-49   Phaseolus vulgaris [French bean]
ref|XP_002511509.1|  nitrate transporter, putative                      180   2e-49   Ricinus communis
ref|XP_009150736.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      180   2e-49   Brassica rapa
ref|XP_004963333.1|  PREDICTED: probable peptide/nitrate transpor...    180   2e-49   Setaria italica
ref|XP_002517390.1|  nitrate transporter, putative                      179   2e-49   Ricinus communis
ref|XP_011071716.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      179   2e-49   Sesamum indicum [beniseed]
ref|XP_004959036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    179   3e-49   
gb|EMT08635.1|  Peptide transporter PTR1                                179   3e-49   Aegilops tauschii
ref|XP_006301787.1|  hypothetical protein CARUB_v10022251mg             179   3e-49   Capsella rubella
ref|XP_007155346.1|  hypothetical protein PHAVU_003G193400g             179   3e-49   Phaseolus vulgaris [French bean]
gb|KDP45400.1|  hypothetical protein JCGZ_09649                         179   4e-49   Jatropha curcas
ref|XP_009117579.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       179   4e-49   Brassica rapa
ref|XP_009626986.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      179   5e-49   Nicotiana tomentosiformis
ref|XP_008807861.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      179   5e-49   Phoenix dactylifera
ref|XP_010474241.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    177   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010415653.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    178   5e-49   Camelina sativa [gold-of-pleasure]
emb|CBI15285.3|  unnamed protein product                                182   6e-49   Vitis vinifera
ref|NP_001147815.1|  ligA                                               178   6e-49   Zea mays [maize]
gb|KEH31904.1|  peptide/nitrate transporter plant                       178   7e-49   Medicago truncatula
dbj|BAJ85122.1|  predicted protein                                      178   7e-49   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010533412.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       178   8e-49   Tarenaya hassleriana [spider flower]
emb|CDX81902.1|  BnaC08g36990D                                          178   8e-49   Brassica napus [oilseed rape]
gb|KJB19308.1|  hypothetical protein B456_003G094400                    178   8e-49   Gossypium raimondii
ref|XP_004508781.1|  PREDICTED: probable peptide/nitrate transpor...    178   9e-49   Cicer arietinum [garbanzo]
gb|AAL16236.1|AF428467_1  AT3g47960/T17F15_170                          178   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270558.3|  PREDICTED: uncharacterized protein LOC100263850    181   9e-49   Vitis vinifera
ref|XP_004508783.1|  PREDICTED: probable peptide/nitrate transpor...    178   1e-48   
ref|NP_566896.2|  glucosinolate transporter 1                           178   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAK44017.1|AF370202_1  putative peptide transporter protein          178   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764700.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      177   1e-48   Nicotiana sylvestris
gb|KHN48655.1|  Putative peptide/nitrate transporter                    177   1e-48   Glycine soja [wild soybean]
ref|XP_010512049.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    177   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006658355.1|  PREDICTED: probable peptide/nitrate transpor...    175   2e-48   Oryza brachyantha
ref|XP_006304758.1|  hypothetical protein CARUB_v10012216mg             177   2e-48   Capsella rubella
ref|XP_010933675.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      177   2e-48   Elaeis guineensis
gb|KFK28007.1|  hypothetical protein AALP_AA8G459400                    177   2e-48   Arabis alpina [alpine rockcress]
ref|XP_003525480.1|  PREDICTED: probable peptide/nitrate transpor...    177   2e-48   Glycine max [soybeans]
ref|XP_009623435.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      177   2e-48   Nicotiana tomentosiformis
gb|ACN72639.1|  nitrate transporter                                     176   3e-48   Malus hupehensis
emb|CDY36913.1|  BnaA06g16980D                                          176   3e-48   Brassica napus [oilseed rape]
ref|XP_002276806.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           176   4e-48   Vitis vinifera
emb|CDY45756.1|  BnaC02g42260D                                          176   4e-48   Brassica napus [oilseed rape]
ref|XP_008453175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      176   4e-48   
ref|XP_009151387.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      176   5e-48   Brassica rapa
ref|XP_009149857.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    176   5e-48   Brassica rapa
ref|XP_009799219.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      176   5e-48   Nicotiana sylvestris
ref|XP_011087209.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      176   5e-48   Sesamum indicum [beniseed]
emb|CDY00315.1|  BnaA06g22160D                                          176   5e-48   Brassica napus [oilseed rape]
ref|XP_006290269.1|  hypothetical protein CARUB_v10016825mg             176   5e-48   Capsella rubella
gb|KJB50863.1|  hypothetical protein B456_008G190200                    173   6e-48   Gossypium raimondii
ref|XP_010459536.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            176   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010426267.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10           176   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009130227.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           176   7e-48   Brassica rapa
ref|XP_010503417.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      176   8e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002517465.1|  nitrate transporter, putative                      169   8e-48   
ref|XP_010459209.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      176   8e-48   Camelina sativa [gold-of-pleasure]
gb|KFK44035.1|  hypothetical protein AALP_AA1G207200                    175   8e-48   Arabis alpina [alpine rockcress]
ref|XP_010483980.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           175   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010242330.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       175   1e-47   Nelumbo nucifera [Indian lotus]
emb|CDP14880.1|  unnamed protein product                                175   1e-47   
emb|CDY30731.1|  BnaA02g33530D                                          175   1e-47   
ref|XP_004241514.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      175   1e-47   
ref|XP_010444119.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      175   1e-47   
gb|EYU35891.1|  hypothetical protein MIMGU_mgv1a021530mg                175   1e-47   
ref|XP_006390954.1|  hypothetical protein EUTSA_v10019805mg             174   1e-47   
ref|XP_006347445.1|  PREDICTED: probable peptide/nitrate transpor...    175   1e-47   
gb|EYU24424.1|  hypothetical protein MIMGU_mgv1a003540mg                174   1e-47   
ref|XP_002890304.1|  proton-dependent oligopeptide transport fami...    175   1e-47   
ref|XP_004138297.1|  PREDICTED: probable peptide/nitrate transpor...    174   1e-47   
ref|XP_008453172.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      174   2e-47   
ref|XP_010112577.1|  putative peptide/nitrate transporter               174   2e-47   
ref|XP_002877586.1|  hypothetical protein ARALYDRAFT_323400             175   2e-47   
emb|CDY51783.1|  BnaC03g75950D                                          174   2e-47   
gb|KJB50860.1|  hypothetical protein B456_008G190200                    173   2e-47   
ref|XP_009369361.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    174   2e-47   
ref|XP_009369363.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    174   2e-47   
gb|KJB50861.1|  hypothetical protein B456_008G190200                    174   2e-47   
gb|KJB50862.1|  hypothetical protein B456_008G190200                    174   3e-47   
gb|KHN18518.1|  Putative peptide/nitrate transporter                    173   3e-47   
ref|XP_002863114.1|  proton-dependent oligopeptide transport fami...    173   4e-47   
gb|KJB50859.1|  hypothetical protein B456_008G190200                    174   4e-47   
gb|KGN63647.1|  hypothetical protein Csa_1G008530                       173   4e-47   
ref|XP_006394362.1|  hypothetical protein EUTSA_v10003849mg             174   4e-47   
ref|XP_002461612.1|  hypothetical protein SORBIDRAFT_02g005420          174   5e-47   
ref|XP_008239651.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      173   5e-47   
ref|XP_003550765.1|  PREDICTED: probable peptide/nitrate transpor...    173   5e-47   
ref|XP_007210278.1|  hypothetical protein PRUPE_ppa003007mg             173   6e-47   
ref|XP_004138148.1|  PREDICTED: probable peptide/nitrate transpor...    173   7e-47   
ref|XP_010263538.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    171   1e-46   
ref|XP_004963332.1|  PREDICTED: probable peptide/nitrate transpor...    172   1e-46   
gb|EPS61327.1|  hypothetical protein M569_13470                         172   1e-46   
ref|XP_007037200.1|  Major facilitator superfamily protein, putative    172   1e-46   
gb|KHN48654.1|  Putative peptide/nitrate transporter                    172   1e-46   
emb|CDX83801.1|  BnaC08g18440D                                          172   1e-46   
ref|XP_009150212.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      172   1e-46   
ref|XP_010477090.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       172   1e-46   
ref|XP_009110311.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            172   1e-46   
ref|XP_003525007.2|  PREDICTED: probable peptide/nitrate transpor...    172   2e-46   
ref|XP_008374512.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            172   2e-46   
ref|XP_010263529.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    171   2e-46   
ref|XP_011465713.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       169   2e-46   
gb|EYU24423.1|  hypothetical protein MIMGU_mgv1a003414mg                171   2e-46   
emb|CDY69433.1|  BnaCnng63460D                                          172   2e-46   
gb|EMT03104.1|  Putative peptide transporter                            171   2e-46   
ref|XP_010498295.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       171   3e-46   
ref|XP_002270812.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           171   3e-46   
ref|XP_006282309.1|  hypothetical protein CARUB_v10028599mg             171   3e-46   
ref|XP_007037199.1|  Major facilitator superfamily protein isoform 4    169   4e-46   
ref|XP_010548836.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      171   5e-46   
gb|KHN18517.1|  Putative peptide/nitrate transporter                    170   5e-46   
ref|XP_003549658.1|  PREDICTED: probable peptide/nitrate transpor...    170   5e-46   
ref|NP_177144.1|  putative peptide/nitrate transporter                  170   6e-46   
ref|NP_201074.1|  glucosinolate transporter-2                           170   6e-46   
gb|KCW83497.1|  hypothetical protein EUGRSUZ_B00402                     170   6e-46   
ref|XP_010028698.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      170   7e-46   
ref|XP_010028687.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      170   7e-46   
gb|EMT23271.1|  Peptide transporter PTR5                                171   7e-46   
emb|CDP14879.1|  unnamed protein product                                170   8e-46   
gb|KJB48083.1|  hypothetical protein B456_008G052800                    169   9e-46   
gb|KJB48084.1|  hypothetical protein B456_008G052800                    169   1e-45   
ref|XP_007037198.1|  Major facilitator superfamily protein isoform 3    168   1e-45   
ref|XP_007210270.1|  hypothetical protein PRUPE_ppa003155mg             169   1e-45   
dbj|BAC83856.1|  putative nitrate transporter NRT1-5                    169   1e-45   
emb|CDY21692.1|  BnaA09g44430D                                          169   2e-45   
gb|EMT01658.1|  hypothetical protein F775_52171                         170   2e-45   
dbj|BAJ85580.1|  predicted protein                                      162   2e-45   
gb|EAZ38982.1|  hypothetical protein OsJ_23400                          170   2e-45   
gb|KDP29397.1|  hypothetical protein JCGZ_18318                         168   2e-45   
emb|CDP14876.1|  unnamed protein product                                169   2e-45   
ref|XP_007037197.1|  Major facilitator superfamily protein isoform 2    168   3e-45   
ref|XP_007037196.1|  Major facilitator superfamily protein isoform 1    168   3e-45   
ref|XP_002463917.1|  hypothetical protein SORBIDRAFT_01g008885          168   3e-45   
emb|CAE02899.1|  OSJNBa0015K02.16                                       168   4e-45   
gb|KHG08723.1|  hypothetical protein F383_35629                         168   4e-45   
ref|XP_002866507.1|  proton-dependent oligopeptide transport fami...    167   5e-45   
ref|XP_009149373.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       167   5e-45   
emb|CDY26715.1|  BnaA06g13070D                                          167   5e-45   
ref|NP_001054146.1|  Os04g0660900                                       167   6e-45   
ref|XP_003578426.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            167   7e-45   
ref|XP_008445656.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            167   7e-45   
emb|CDX83027.1|  BnaA01g20270D                                          167   9e-45   
ref|XP_008339682.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            167   9e-45   
gb|KCW49368.1|  hypothetical protein EUGRSUZ_K02913                     167   1e-44   
ref|XP_008239650.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      167   1e-44   
gb|ACN40168.1|  unknown                                                 167   1e-44   
ref|XP_009398399.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           166   1e-44   
gb|EYU27205.1|  hypothetical protein MIMGU_mgv1a025825mg                160   1e-44   
ref|XP_006439664.1|  hypothetical protein CICLE_v10019319mg             164   1e-44   
gb|EMT03778.1|  Peptide transporter PTR1                                165   2e-44   
ref|XP_007155347.1|  hypothetical protein PHAVU_003G193500g             166   2e-44   
emb|CDP10977.1|  unnamed protein product                                166   2e-44   
ref|XP_009356666.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       166   2e-44   
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          166   3e-44   
ref|XP_010037631.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    165   3e-44   
ref|XP_010037632.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    165   4e-44   
gb|EAY95911.1|  hypothetical protein OsI_17775                          166   4e-44   
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       165   5e-44   
emb|CDX96690.1|  BnaA08g22330D                                          165   6e-44   
ref|XP_004489981.1|  PREDICTED: nitrate transporter 1.7-like            165   6e-44   
ref|XP_006439663.1|  hypothetical protein CICLE_v10019319mg             164   7e-44   
ref|XP_007155348.1|  hypothetical protein PHAVU_003G193600g             164   1e-43   
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       164   1e-43   
gb|KDP44129.1|  hypothetical protein JCGZ_05596                         157   1e-43   
ref|XP_004965186.1|  PREDICTED: probable nitrite transporter At1g...    164   1e-43   
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    163   2e-43   
gb|EMT14752.1|  Peptide transporter PTR2                                163   2e-43   
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    163   2e-43   
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    163   2e-43   
ref|XP_004240340.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       163   2e-43   
ref|XP_009610425.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           163   2e-43   
ref|XP_006476665.1|  PREDICTED: probable peptide/nitrate transpor...    163   3e-43   
ref|XP_007153449.1|  hypothetical protein PHAVU_003G036200g             162   3e-43   
gb|KGN45953.1|  hypothetical protein Csa_6G037500                       162   3e-43   
dbj|BAB19760.1|  nitrate transporter NRT1-5                             162   3e-43   
ref|XP_006476666.1|  PREDICTED: probable peptide/nitrate transpor...    163   3e-43   
emb|CDP06231.1|  unnamed protein product                                162   3e-43   
dbj|BAG91755.1|  unnamed protein product                                161   3e-43   
ref|XP_004150669.1|  PREDICTED: probable nitrite transporter At1g...    162   3e-43   
ref|XP_004164473.1|  PREDICTED: probable nitrite transporter At1g...    162   3e-43   
ref|XP_006652957.1|  PREDICTED: nitrate transporter 1.7-like            162   4e-43   
ref|XP_010227773.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            162   4e-43   
ref|XP_006343460.1|  PREDICTED: probable nitrite transporter At1g...    162   4e-43   
ref|XP_007222139.1|  hypothetical protein PRUPE_ppa004666mg             161   4e-43   
ref|XP_006664784.1|  PREDICTED: probable peptide/nitrate transpor...    162   6e-43   
ref|XP_003517977.1|  PREDICTED: probable nitrite transporter At1g...    162   6e-43   
ref|XP_008801152.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    160   6e-43   
ref|XP_008808582.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       162   6e-43   
ref|NP_001061020.1|  Os08g0155400                                       161   7e-43   
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       161   7e-43   
dbj|BAJ98035.1|  predicted protein                                      162   7e-43   
ref|XP_008243217.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            161   8e-43   
ref|XP_010265161.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       161   9e-43   
gb|EPS71786.1|  nitrate transporter                                     161   9e-43   
ref|XP_006344125.1|  PREDICTED: probable nitrite transporter At1g...    161   1e-42   
ref|XP_008801151.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    160   1e-42   
ref|XP_010907324.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    159   2e-42   
dbj|BAC99394.1|  putative nitrate transporter                           160   2e-42   
gb|EPS64583.1|  hypothetical protein M569_10198                         155   2e-42   
ref|XP_010044269.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    160   2e-42   
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       160   2e-42   
emb|CDP14875.1|  unnamed protein product                                160   3e-42   
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    159   3e-42   
ref|XP_010907323.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    159   4e-42   
emb|CCN27391.1|  low affinity nitrate transporter                       151   5e-42   
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   5e-42   
ref|XP_010910247.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       159   5e-42   
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    159   5e-42   
ref|XP_010678590.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       159   6e-42   
gb|ACR34962.1|  unknown                                                 159   6e-42   
ref|XP_009757138.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            159   6e-42   
dbj|BAJ90348.1|  predicted protein                                      159   7e-42   
ref|NP_001145735.1|  uncharacterized protein LOC100279242               159   7e-42   
ref|XP_009343431.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      159   7e-42   
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   7e-42   
emb|CCN27385.1|  low affinity nitrate transporter                       150   8e-42   
ref|XP_009610945.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            159   8e-42   
gb|ADG39311.1|  AT5G62680-like protein                                  151   8e-42   
ref|XP_006378491.1|  hypothetical protein POPTR_0010s13620g             157   9e-42   
ref|XP_002967819.1|  hypothetical protein SELMODRAFT_88337              159   9e-42   
ref|XP_002981698.1|  hypothetical protein SELMODRAFT_444972             159   9e-42   
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    159   9e-42   
ref|XP_003524995.1|  PREDICTED: probable peptide/nitrate transpor...    158   1e-41   
ref|XP_009414362.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       158   1e-41   
ref|NP_001136757.1|  hypothetical protein                               156   1e-41   
gb|KHN48656.1|  Putative peptide/nitrate transporter                    158   1e-41   
gb|KHG04001.1|  hypothetical protein F383_28667                         158   1e-41   
ref|XP_009401275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            158   1e-41   
ref|XP_004299089.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            158   1e-41   
ref|XP_006378493.1|  hypothetical protein POPTR_0010s13620g             157   1e-41   
ref|XP_006416555.1|  hypothetical protein EUTSA_v10007154mg             158   2e-41   
emb|CDY45754.1|  BnaC02g42280D                                          158   2e-41   
emb|CDX84344.1|  BnaC03g51560D                                          158   2e-41   
ref|XP_008389297.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       157   2e-41   
ref|XP_010037637.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       157   2e-41   
ref|XP_002314866.2|  hypothetical protein POPTR_0010s13620g             157   2e-41   
gb|KHN12178.1|  Putative nitrite transporter                            157   2e-41   
ref|NP_001057335.1|  Os06g0264500                                       157   2e-41   
gb|EPS69660.1|  hypothetical protein M569_05105                         157   3e-41   
ref|XP_011008009.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            157   3e-41   
gb|EYU20822.1|  hypothetical protein MIMGU_mgv1a003218mg                157   3e-41   
ref|XP_007155636.1|  hypothetical protein PHAVU_003G218500g             155   3e-41   
gb|EMT10378.1|  Nitrate/chlorate transporter                            157   3e-41   
gb|KHN18519.1|  Putative peptide/nitrate transporter                    157   3e-41   
ref|XP_004987224.1|  PREDICTED: nitrate transporter 1.1-like            150   4e-41   
ref|XP_009356281.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       156   4e-41   
ref|XP_001784091.1|  predicted protein                                  157   4e-41   
ref|XP_010101985.1|  putative nitrite transporter                       156   5e-41   
ref|XP_006354833.1|  PREDICTED: probable peptide/nitrate transpor...    156   5e-41   
gb|KJB80006.1|  hypothetical protein B456_013G077000                    156   5e-41   
ref|XP_010551275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            156   5e-41   
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       156   6e-41   
emb|CDX76167.1|  BnaA04g04310D                                          156   7e-41   
ref|XP_009798934.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-lik...    155   7e-41   
emb|CDY38595.1|  BnaC06g30180D                                          156   7e-41   
gb|KHG24776.1|  Uncharacterized protein F383_04224                      156   8e-41   
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            155   8e-41   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         155   8e-41   
ref|XP_009798933.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-lik...    155   9e-41   
gb|KJB20885.1|  hypothetical protein B456_003G170300                    155   9e-41   
gb|KHN42706.1|  Nitrate transporter 1.1                                 155   9e-41   
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            155   1e-40   
ref|XP_010535565.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.7-like...    155   1e-40   
emb|CDP14878.1|  unnamed protein product                                158   1e-40   
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             155   1e-40   
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             155   1e-40   
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       155   1e-40   
gb|ACG41138.1|  peptide transporter PTR2                                155   1e-40   
ref|XP_010535567.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.7-like...    155   1e-40   
gb|KFK41277.1|  hypothetical protein AALP_AA2G109200                    155   1e-40   
ref|XP_010678591.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       155   1e-40   
gb|KHG27943.1|  Uncharacterized protein F383_15837                      155   1e-40   
gb|EYU29570.1|  hypothetical protein MIMGU_mgv1a021473mg                148   1e-40   
ref|NP_001237970.1|  nitrate transporter NRT1-2                         155   1e-40   
ref|XP_009788955.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    155   2e-40   
ref|XP_006362448.1|  PREDICTED: peptide transporter PTR1-like           155   2e-40   
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       155   2e-40   
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            155   2e-40   
ref|NP_190151.1|  nitrate excretion transporter1                        155   2e-40   
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                155   2e-40   
dbj|BAB19756.1|  nitrate transporter NRT1-1                             155   2e-40   



>ref|XP_011086410.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Sesamum indicum]
Length=614

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 161/201 (80%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LGR F+IP GSL V+S++TI + LPFYDRVLVP  RK TR+ GGI++LQRMGIG+ FSIL
Sbjct  393  LGRNFKIPPGSLSVISMITIGIWLPFYDRVLVPSLRKVTRLEGGISLLQRMGIGIVFSIL  452

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RRA+A       G +PL+V WL PQLM+MGFAEAFNI+GQIEFYNKEFP
Sbjct  453  SMIVAGLVEPMRRASAIMHAGEDGIAPLTVFWLAPQLMLMGFAEAFNIIGQIEFYNKEFP  512

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S MLVN VHKTTG HGRPDWL  DINAG++EN YF+IAG
Sbjct  513  ENMSSVANSLFSCTMAGASYLSAMLVNIVHKTTGRHGRPDWLTKDINAGKVENLYFLIAG  572

Query  527  MGVVNLVYFMVVARRYRYKSK  589
            +GV+NL YF+ VAR Y+YKSK
Sbjct  573  LGVLNLGYFLWVARGYQYKSK  593



>emb|CDP00275.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP GSL V+S++TI + LP YDR++VP  R+ T+V GGIT+LQR+G+G+ FSIL
Sbjct  403  LGPKFQIPPGSLAVISMVTIGIWLPVYDRIVVPRLRRITKVEGGITLLQRLGVGMVFSIL  462

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +MAV+GFVE KRRA A       G++P++V WL PQL++MGFAEAFNI+GQIE YNKEFP
Sbjct  463  SMAVAGFVERKRRAEAIKHGGPDGSAPITVMWLAPQLILMGFAEAFNIIGQIELYNKEFP  522

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM S+ NS++S+T+  A Y+S ++VN +H TTG  G PDWL  +INAGRLENFYFVIAG
Sbjct  523  ENMTSVANSIMSITFAGANYLSAIIVNIIHNTTGGRGHPDWLAKNINAGRLENFYFVIAG  582

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL YF+ VA  YRYKS+V VD
Sbjct  583  LGVLNLTYFLYVAPNYRYKSRVRVD  607



>ref|XP_009610610.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 isoform X1 [Nicotiana 
tomentosiformis]
Length=612

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAG+L V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL
Sbjct  391  LGPKFQIPAGTLSVISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMVFSIL  450

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G +E  RR +A       G +P++V WL PQL++MGFAEAFNI+GQIEFYNKEFP
Sbjct  451  SMVVAGQIEKVRRNSAIMHGSGDGIAPITVMWLAPQLILMGFAEAFNIIGQIEFYNKEFP  510

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S+ LVN +H TTG HG PDWL  DIN GR+EN+Y++IAG
Sbjct  511  ENMSSLANSLFSCTVAGASYLSSFLVNILHNTTGGHGHPDWLTKDINEGRVENYYYLIAG  570

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL +F+ VARRY+YK+++ VD
Sbjct  571  LGVLNLFWFIYVARRYQYKTRLEVD  595



>ref|XP_009775473.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Nicotiana sylvestris]
Length=610

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAG+L V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL
Sbjct  389  LGPKFQIPAGTLSVISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMIFSIL  448

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G +E  RR +A       G +P++V WL PQL++MGFAEAFNI+GQIEFYNKEFP
Sbjct  449  SMVVAGQIEKVRRNSAIMHGSADGIAPITVLWLAPQLILMGFAEAFNIIGQIEFYNKEFP  508

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S+ LVN +H TTG HG PDWL  DIN GR+EN+Y++IAG
Sbjct  509  ENMSSVANSLFSCTVAGASYLSSFLVNILHNTTGGHGHPDWLTKDINQGRVENYYYLIAG  568

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL +F+ VARRY+YK+++ VD
Sbjct  569  LGVLNLFWFIYVARRYQYKTRLEVD  593



>ref|XP_009610611.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 isoform X2 [Nicotiana 
tomentosiformis]
Length=612

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAG+L V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL
Sbjct  391  LGPKFQIPAGTLSVISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMVFSIL  450

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G +E  RR +A       G +P++V WL PQL++MGFAEAFNI+GQIEFYNKEFP
Sbjct  451  SMVVAGQIEKVRRNSAIMHGSGDGIAPITVMWLAPQLILMGFAEAFNIIGQIEFYNKEFP  510

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S+ LVN +H TTG HG PDWL  DIN GR+EN+Y++IAG
Sbjct  511  ENMSSLANSLFSCTVAGASYLSSFLVNILHNTTGGHGHPDWLTKDINEGRVENYYYLIAG  570

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL +F+ VARRY+YK+++ VD
Sbjct  571  LGVLNLFWFIYVARRYQYKTRLEVD  595



>ref|XP_006357252.1| PREDICTED: nitrate transporter 1.7-like [Solanum tuberosum]
Length=606

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 159/205 (78%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GSL V+S++T+ + LP YDR ++P   K TR+ GGIT+LQR+GIG+ FSIL
Sbjct  385  LGPNFQIPPGSLSVISMITVGIWLPVYDRFIMPSVTKITRIEGGITLLQRIGIGMVFSIL  444

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G  E  RR +A       G +P++V WL PQL++MGFAEAFNILGQIEFYNKEFP
Sbjct  445  SMVVAGITEKIRRNSAITHNSPDGIAPVTVMWLAPQLVLMGFAEAFNILGQIEFYNKEFP  504

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S++LVN +H TTG HG PDWL +DIN GR++N+Y++IAG
Sbjct  505  ENMSSVANSLFSCTVAGASYISSLLVNLLHNTTGGHGHPDWLTNDINEGRVDNYYYLIAG  564

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL YF+ VARRY+YK++V VD
Sbjct  565  LGVLNLFYFLYVARRYQYKTRVIVD  589



>gb|EYU28693.1| hypothetical protein MIMGU_mgv1a004515mg [Erythranthe guttata]
Length=523

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 156/205 (76%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            L   FQIPAGSL V+S++T+ + LP YDR++VP  RK T + GGI++LQRMGIG+ FS+L
Sbjct  304  LSPNFQIPAGSLAVISMVTVGIWLPIYDRLIVPALRKITGLEGGISLLQRMGIGIVFSVL  363

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M  +G  E  RRA+A       G +PL+V WL PQLM+MGFAEAFNI+GQIEFYNKEFP
Sbjct  364  SMVAAGIFERVRRASAVAHAGPDGVAPLTVFWLAPQLMLMGFAEAFNIIGQIEFYNKEFP  423

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S +LVN VH TTG  GRPDWL  DINAGR+EN YF+IAG
Sbjct  424  ENMSSVANSLFSCTMAGANYLSAVLVNVVHGTTGGDGRPDWLTRDINAGRVENLYFLIAG  483

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            MGV+NL YF+ VAR Y+YKSK  VD
Sbjct  484  MGVLNLGYFLWVARGYQYKSKYRVD  508



>ref|XP_003551991.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
 gb|KHN04835.1| Nitrate transporter 1.7 [Glycine soja]
Length=622

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+SL+TIA+ LPFYDR+LVP  RK T+  GGIT+L R+GIG+ FSIL
Sbjct  405  LGAKFQIPAGSVSVISLITIALWLPFYDRILVPKLRKMTKHEGGITLLLRIGIGMVFSIL  464

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G+VE  RR +AN      G +P+SV WL P L++MG  EAFNI+GQIEF+N++FP
Sbjct  465  SMVVAGYVEKVRRDSANSNPTPLGIAPMSVLWLAPHLILMGLCEAFNIIGQIEFFNRQFP  524

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNS  S ++GV+ YVS+++VN VH +T  H  PDWL DDINAGRL+ FY++IAG
Sbjct  525  EHMRSIGNSFFSCSFGVSSYVSSIIVNIVHHSTRTHSHPDWLTDDINAGRLDYFYYLIAG  584

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +  +NLV+F+ VARRY+YK  V
Sbjct  585  LTSLNLVFFIYVARRYQYKGNV  606



>gb|EPS62066.1| hypothetical protein M569_12727, partial [Genlisea aurea]
Length=550

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQIPAGSL ++S+LTIAV LP YD  +VP+ RKRT+++ GIT+LQRMGIGL FS++
Sbjct  348  MGPHFQIPAGSLLIISMLTIAVWLPIYDLTIVPYLRKRTKIVSGITLLQRMGIGLVFSVI  407

Query  182  AMAVSGFVEIKRRAAA-NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G +E  RRA++ +   +P+SV WL PQL++MGF+EAF+ILGQIEFYNKEFPENM+
Sbjct  408  SMVVAGLIERMRRASSLSHPEAPISVFWLAPQLILMGFSEAFSILGQIEFYNKEFPENMS  467

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+ NSL S+T   A Y+ST+LVN VH TTG  G PDWL  DI+ GR++ FY+++A MGV+
Sbjct  468  SVANSLFSITMVGASYLSTLLVNVVHGTTGRKGHPDWLTKDIDQGRVDYFYYLVAAMGVL  527

Query  539  NLVYFMVVARRYRYKSK  589
            N  YF+ VAR+Y YKS+
Sbjct  528  NFGYFVWVARKYAYKSQ  544



>gb|KJB77129.1| hypothetical protein B456_012G121800 [Gossypium raimondii]
Length=531

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 155/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSIL
Sbjct  318  LGPKFQIPAGSISVISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSIL  377

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            AM  +G  E KRR +A  + GA+P+SV WL PQL++MGF EAFNILGQIEF+NK+FPE+M
Sbjct  378  AMVAAGVFEQKRRNSATLHPGAAPISVFWLSPQLILMGFCEAFNILGQIEFFNKQFPEHM  437

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL+  +   + Y+S+++VN VH  TG HG PDWL +DINAGRL+ FY+++A M  
Sbjct  438  RSIANSLIFCSLAGSSYLSSIVVNVVHHVTGGHGHPDWLTNDINAGRLDYFYYILAVMSA  497

Query  536  VNLVYFMVVARRYRYKSKVWVD  601
            +N +YF+ VA RYRYK +V ++
Sbjct  498  LNFLYFLYVAHRYRYKGQVRIE  519



>gb|KHG14034.1| Nitrate transporter 1.7 -like protein [Gossypium arboreum]
Length=602

 Score =   246 bits (628),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSIL
Sbjct  389  LGPKFQIPAGSMGVISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSIL  448

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            AM  +G  E KRR +A  + GA+P+SV WL PQL++MGF EAFNILGQIEF+NK+FPE+M
Sbjct  449  AMVAAGVFEQKRRNSATLHPGAAPISVFWLSPQLILMGFCEAFNILGQIEFFNKQFPEHM  508

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL+  +W  + Y+S+++VN VH  TG HG PDWL +DINAGRL+ FY+++A M  
Sbjct  509  RSIANSLIFCSWAGSSYLSSIVVNVVHHVTGGHGHPDWLTNDINAGRLDYFYYILAVMSA  568

Query  536  VNLVYFMVVARRYRYKSKVWVD  601
             N +YF+ VA RYRYK +  ++
Sbjct  569  FNFLYFLYVAHRYRYKGQARIE  590



>ref|XP_007157410.1| hypothetical protein PHAVU_002G067700g [Phaseolus vulgaris]
 gb|ESW29404.1| hypothetical protein PHAVU_002G067700g [Phaseolus vulgaris]
Length=630

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+S LTI + +PFYDR++VP  RK T++ GGIT+LQR+GIG+ FSIL
Sbjct  401  LGPKFQIPAGSLGVISFLTIGLWVPFYDRIMVPAVRKVTKLEGGITLLQRIGIGMVFSIL  460

Query  182  AMAVSGFVEIKRRAAANGGASPL-----SVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+  VE  RR  AN   SPL     SV WL PQL++MG  EAFNI+GQIEF+NK+FP
Sbjct  461  SMVVAALVEKVRRDMANANPSPLGIAPMSVLWLVPQLVLMGMCEAFNIIGQIEFFNKQFP  520

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM SI N+L S ++  A YVS+ LV +VH  T  H  PDWL +DIN+GRL+ FY+++AG
Sbjct  521  ENMRSIANALFSCSFAGASYVSSALVTSVHHATRTHSHPDWLTNDINSGRLDYFYYLVAG  580

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV+N +YF+ VA+RY+YK
Sbjct  581  IGVLNFIYFLFVAQRYQYK  599



>ref|XP_002269340.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Vitis vinifera]
 emb|CBI32029.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+S+LT+ + +PFYDR+LVP  +K T+  GGIT+LQRMGIG+ FSIL
Sbjct  400  LGPKFQIPAGSLIVISMLTVGIWVPFYDRILVPALQKITKHEGGITLLQRMGIGIVFSIL  459

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M VSG VE +RRA+A       G +P+SV WL PQL++MGFAEAFNI+GQIEFYNKEFP
Sbjct  460  SMVVSGLVERERRASAILQAGPHGIAPMSVMWLAPQLILMGFAEAFNIIGQIEFYNKEFP  519

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM SI NSL   T   A Y+S+++V  VH  TG  GR  WL  +IN G+++ +Y+++AG
Sbjct  520  ENMRSIANSLFFCTIAGASYLSSLVVVIVHDVTGKAGRSAWLTKNINQGKVDYYYYLLAG  579

Query  527  MGVVNLVYFMVVARRYRYKS  586
            MGV+NL+YF+  ARRYRYKS
Sbjct  580  MGVLNLIYFLFCARRYRYKS  599



>ref|XP_004489968.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=610

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIPAGSL V+SL+ I + +PFYDRV VP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  381  LGPNFQIPAGSLGVISLIIIGLWVPFYDRVCVPSLRKITKHEGGITLLQRIGIGMVFSIL  440

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR  AN      G +P+SV WLFPQL+++GF EAFNI+G IEF+N++FP
Sbjct  441  SMIVAGLVEKIRRDVANSNPNPQGIAPMSVMWLFPQLILLGFCEAFNIIGLIEFFNRQFP  500

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S ++ +A YVST+LV +VH  TG    PDWL +DINAGRL+ FY+++AG
Sbjct  501  DHMRSIANALFSCSFALANYVSTILVTSVHHVTGTEHHPDWLTNDINAGRLDYFYYLLAG  560

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +GV+NLVYF+ VA+RY YK  V
Sbjct  561  IGVLNLVYFLFVAQRYHYKGSV  582



>gb|KDO39248.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=478

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  264  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  323

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  324  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMK  383

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  384  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  443

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  444  NIVYFLYCARRYRYKSGI  461



>ref|XP_006438562.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
 gb|ESR51802.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
Length=481

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  264  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  323

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  324  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMR  383

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  384  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  443

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  444  NIVYFLYCARRYRYKSGI  461



>gb|KDP21241.1| hypothetical protein JCGZ_21712 [Jatropha curcas]
Length=615

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIPAGS+ V+S++TIA+ LP YDR+LVP  RK T+  GGIT+LQR+GIG+ FS+L
Sbjct  397  LGSNFQIPAGSMGVISMITIAIWLPIYDRILVPALRKITKHEGGITLLQRIGIGIIFSLL  456

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE +RRAAA  +   +P+SV WL PQL++MGF EAFN +GQIEFYNKEFPENM
Sbjct  457  SMVVAGLVERERRAAAILHPNGAPISVMWLAPQLVLMGFCEAFNFIGQIEFYNKEFPENM  516

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL   +   A YVS++++  VHK T     PDWL +D+N G+L+NFYF++AGMG+
Sbjct  517  RSIANSLFFCSIAGASYVSSLVITIVHKVTRTRNHPDWLTNDLNKGKLDNFYFLLAGMGI  576

Query  536  VNLVYFMVVARRYRYKSK  589
            +N  YF+  ARRY YKS 
Sbjct  577  LNFFYFLFCARRYSYKSN  594



>gb|KJB77128.1| hypothetical protein B456_012G121800 [Gossypium raimondii]
Length=602

 Score =   244 bits (623),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 117/202 (58%), Positives = 155/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSIL
Sbjct  389  LGPKFQIPAGSISVISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSIL  448

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            AM  +G  E KRR +A  + GA+P+SV WL PQL++MGF EAFNILGQIEF+NK+FPE+M
Sbjct  449  AMVAAGVFEQKRRNSATLHPGAAPISVFWLSPQLILMGFCEAFNILGQIEFFNKQFPEHM  508

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL+  +   + Y+S+++VN VH  TG HG PDWL +DINAGRL+ FY+++A M  
Sbjct  509  RSIANSLIFCSLAGSSYLSSIVVNVVHHVTGGHGHPDWLTNDINAGRLDYFYYILAVMSA  568

Query  536  VNLVYFMVVARRYRYKSKVWVD  601
            +N +YF+ VA RYRYK +V ++
Sbjct  569  LNFLYFLYVAHRYRYKGQVRIE  590



>gb|KHN01163.1| Nitrate transporter 1.7 [Glycine soja]
Length=560

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 150/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+S +TI V +PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL
Sbjct  342  LGPKFQIPAGSLGVISFITIGVWVPFYDRIMVPTLRRVTKHEGGITLLQRIGIGMVFSIL  401

Query  182  AMAVSGFVEIKRRAAANGGASPL-----SVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+  VE  RR  AN   SPL     SV WL PQL++MG  EAFN++GQIEF+N++FP
Sbjct  402  SMVVAALVEKVRRDLANANPSPLGIAPMSVLWLVPQLVLMGLCEAFNVIGQIEFFNRQFP  461

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S ++  A YVS+ LV TVH  T  H  PDWL +DINAGRL+ FY+++AG
Sbjct  462  DHMRSIANALFSCSFAGASYVSSALVTTVHHVTRTHSHPDWLTNDINAGRLDYFYYLVAG  521

Query  527  MGVVNLVYFMVVARRYRYK  583
             GV+NLVYF++VA+RY YK
Sbjct  522  TGVLNLVYFLIVAQRYHYK  540



>ref|XP_007044382.1| Nitrate transporter 1.7, putative [Theobroma cacao]
 gb|EOY00214.1| Nitrate transporter 1.7, putative [Theobroma cacao]
Length=610

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 154/202 (76%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG + QIPAGS+ ++S++TI + LP YDR++VP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  395  LGSKIQIPAGSIVIISMITIGIFLPVYDRIIVPGLRKFTKHEGGITLLQRIGIGIFFSIL  454

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            AM V+G +E KRR +A  + G +P+SV WL PQL++MGF EAFNI+GQIEF+NK+FPE+M
Sbjct  455  AMIVAGVMEKKRRDSAMLHPGVAPISVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPEHM  514

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL+  +   A Y+S+++VN VH  TG HG PDWL  DINAG+L+ FY+++AGMG 
Sbjct  515  RSIANSLLFCSLAGASYLSSIVVNIVHHVTGGHGHPDWLTSDINAGKLDYFYYLLAGMGA  574

Query  536  VNLVYFMVVARRYRYKSKVWVD  601
             N +YF+ VA  YRYK  V ++
Sbjct  575  FNFLYFLYVAYHYRYKGNVQME  596



>gb|KDO39247.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=575

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  361  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  420

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  421  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMK  480

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  481  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  540

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  541  NIVYFLYCARRYRYKSGI  558



>gb|KDO39246.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=587

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  373  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  432

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  433  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMK  492

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  493  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  552

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  553  NIVYFLYCARRYRYKSGI  570



>ref|XP_004509940.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=595

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 154/197 (78%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G +FQIPAGS+ V+SL+T+A+ LPFYDR LVP  RK T   GGIT+LQR+GIG+ FSIL
Sbjct  385  IGPKFQIPAGSMSVISLITVALCLPFYDRFLVPTLRKITNHEGGITLLQRIGIGMVFSIL  444

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M V+GFVE  RR ++N   S LSV WL PQL++MG  EAFN+LGQIEF+N++FP++M S
Sbjct  445  SMIVAGFVEKVRRDSSN---STLSVMWLAPQLILMGLCEAFNVLGQIEFFNRQFPDHMRS  501

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            IGNSL S ++G++ YVS+++V  +H TT  +  PDWL +DIN GR++ FY++IA +G +N
Sbjct  502  IGNSLFSCSFGMSNYVSSIIVTIIHHTTKTNDHPDWLTNDINHGRIDYFYYLIAVIGTLN  561

Query  542  LVYFMVVARRYRYKSKV  592
             VYF+ VAR+Y+YK  V
Sbjct  562  FVYFIHVARKYQYKGSV  578



>ref|XP_006378165.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP55962.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=599

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 149/196 (76%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPA S+ VVSL+TI + LPFYDRVLVP  RK T+  GGITILQR+GIG  FS+L
Sbjct  396  LGEKFQIPASSIIVVSLITIGIWLPFYDRVLVPAIRKVTKHEGGITILQRIGIGNVFSVL  455

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE +RRAAA  +  A+P+SV WL PQL+VMG  EAF   GQIEFYNK+FP++M
Sbjct  456  SMVVAGLVERERRAAAISHPEAAPMSVFWLAPQLVVMGLCEAFVGTGQIEFYNKQFPDHM  515

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+GNSL   ++  A Y+STML + VHK TG    PDWL +D+NAG L+ FYF++AGMGV
Sbjct  516  RSLGNSLFFCSFAGASYLSTMLGSIVHKVTGTRHHPDWLTNDLNAGNLDYFYFLLAGMGV  575

Query  536  VNLVYFMVVARRYRYK  583
            VN  YF++ A RYRYK
Sbjct  576  VNWFYFLLCAHRYRYK  591



>ref|XP_006483256.1| PREDICTED: nitrate transporter 1.7-like isoform X2 [Citrus sinensis]
Length=578

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  361  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  420

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  421  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMR  480

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  481  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  540

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  541  NIVYFLYCARRYRYKSGI  558



>ref|XP_009105593.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Brassica rapa]
Length=242

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G +F++PAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  21   MGPKFEVPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  80

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A+   G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  81   SMIVAGLVERVRRTRSIKASDPTGMTPMSVVWLSPQLILMGLCEAFNIIGQIEFFNSQFP  140

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S+++  + Y+S+ LV  VHK +G H RPDWLN D+NAG+L+ FY++IA 
Sbjct  141  DHMRSIANALFSLSFAGSSYLSSFLVTVVHKFSGGHDRPDWLNKDLNAGKLDYFYYLIAV  200

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  201  LGVVNLVYFWYCARGYRYK  219



>ref|XP_010044698.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Eucalyptus grandis]
 gb|KCW86796.1| hypothetical protein EUGRSUZ_B03404 [Eucalyptus grandis]
Length=646

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG RFQIP+GSL V+S LTI + LPFYDR+LVP  RK T   GGIT+LQR+GIG  FS+L
Sbjct  431  LGPRFQIPSGSLVVISFLTIGLWLPFYDRILVPALRKVTGHEGGITLLQRIGIGTVFSVL  490

Query  182  AMAVSGFVEIKRRAAANG--GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE  RRA AN   G  P+SV WL PQL++MGF EAFNI+GQIEF+N++FP+NM
Sbjct  491  SMVVAGLVERDRRAHANSHPGQPPISVFWLAPQLILMGFCEAFNIIGQIEFFNRQFPDNM  550

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL   ++  + Y+S++++  VH+ TG  GRP+WL +D+NAGRL+ +Y+++A MG+
Sbjct  551  RSIANSLFFCSFAGSSYLSSVVIAVVHRVTGGDGRPNWLVNDLNAGRLDYYYYLLAAMGI  610

Query  536  VNLVYFMVVARRYRYKSKV  592
            VN  YF+VVA RYRYKS +
Sbjct  611  VNFGYFLVVAHRYRYKSPL  629



>ref|XP_010551494.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Tarenaya hassleriana]
Length=596

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 155/200 (78%), Gaps = 5/200 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +GR FQ+PAGS+ V+SLLTI + LPFYDR+ VP  RK T    GIT+LQR+G+G+ F+IL
Sbjct  372  IGRNFQVPAGSMSVISLLTIGIWLPFYDRIFVPSIRKITGHKSGITLLQRVGVGIVFAIL  431

Query  182  AMAVSGFVE-IKRRAAANGGA----SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE ++R AA N G     + +SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  432  SMVVAGLVERVRRNAAVNAGDPTGMTEMSVFWLAPQLILMGLCEAFNIIGQIEFFNSQFP  491

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK +G +GRPDWLN DINAG+L+ FY++IAG
Sbjct  492  EHMRSIANSLFSLSFAGSSYLSSVIVTTVHKFSGGNGRPDWLNKDINAGKLDYFYYLIAG  551

Query  527  MGVVNLVYFMVVARRYRYKS  586
            +GVVNLVYF   AR YRYKS
Sbjct  552  LGVVNLVYFWYCARSYRYKS  571



>gb|KHN28716.1| Nitrate transporter 1.7 [Glycine soja]
Length=571

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+S +T+ V +PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL
Sbjct  342  LGAKFQIPAGSLGVISFITVGVWVPFYDRIMVPTLRRITKHEGGITLLQRIGIGMVFSIL  401

Query  182  AMAVSGFVEIKRRAAANGGASPL-----SVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M  +  VE  RR  AN   SPL     SV WL PQL++MG  EAFN++GQIEF+N++FP
Sbjct  402  SMVAAALVEKVRRDLANANPSPLGIAPMSVLWLVPQLVLMGLCEAFNVIGQIEFFNRQFP  461

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI N+L   ++  A YVS+ LV TVH  T  H  PDWL +DINAGRL+ FY+++AG
Sbjct  462  EHMRSIANALFFCSYAGANYVSSALVTTVHHVTRTHSHPDWLTNDINAGRLDYFYYLVAG  521

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV+NLVYF++VA+RY YK
Sbjct  522  IGVLNLVYFLIVAQRYHYK  540



>ref|XP_006438561.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
 gb|ESR51801.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
Length=614

 Score =   241 bits (615),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  397  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  456

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  457  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMR  516

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  517  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  576

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  577  NIVYFLYCARRYRYKSGI  594



>ref|XP_003613558.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES96516.1| peptide/nitrate transporter [Medicago truncatula]
Length=608

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+SL+ I + +PFYDR+ VP  RK T+  GGIT+LQR+GIG+ FSI+
Sbjct  379  LGPKFQIPAGSLGVISLIVIGLWVPFYDRICVPSLRKITKNEGGITLLQRIGIGMVFSII  438

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR  AN      G +P+SV WLFPQL++MGF EAFNI+G IEF+N++FP
Sbjct  439  SMIVAGLVEKVRRDVANSNPTPQGIAPMSVMWLFPQLVLMGFCEAFNIIGLIEFFNRQFP  498

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S ++ +A YVS++LV TVH  T  H  PDWL ++IN GRL+ FY+++AG
Sbjct  499  DHMRSIANALFSCSFALANYVSSILVITVHSVTKTHNHPDWLTNNINEGRLDYFYYLLAG  558

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +GV+NLVYF+ V++RY YK  V
Sbjct  559  VGVLNLVYFLYVSQRYHYKGSV  580



>ref|XP_006483255.1| PREDICTED: nitrate transporter 1.7-like isoform X1 [Citrus sinensis]
Length=614

 Score =   241 bits (614),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 116/198 (59%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIP G++ V+S++TI + LPFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL
Sbjct  397  LGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSIL  456

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRA+A+    S +SV WL PQL++MGF EAFNI+GQIEF+NK+FP++M 
Sbjct  457  SMIVAGLVERGRRASAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMR  516

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+  ++G A Y+S++L+  VH  T  HG PDWL +DI+AGRL+ FYF+IAG+G +
Sbjct  517  SIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGL  576

Query  539  NLVYFMVVARRYRYKSKV  592
            N+VYF+  ARRYRYKS +
Sbjct  577  NIVYFLYCARRYRYKSGI  594



>ref|XP_003519778.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
Length=629

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL V+S +T+ V +PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL
Sbjct  400  LGAKFQIPAGSLGVISFITVGVWVPFYDRIMVPTLRRITKHEGGITLLQRIGIGMVFSIL  459

Query  182  AMAVSGFVEIKRRAAANGGASPL-----SVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M  +  VE  RR  AN   SPL     SV WL PQL++MG  EAFN++GQIEF+N++FP
Sbjct  460  SMVAAALVEKVRRDLANANPSPLGIAPMSVLWLVPQLVLMGLCEAFNVIGQIEFFNRQFP  519

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI N+L   ++  A YVS+ LV TVH  T  H  PDWL +DINAGRL+ FY+++AG
Sbjct  520  EHMRSIANALFFCSYAGANYVSSALVTTVHHVTRTHSHPDWLTNDINAGRLDYFYYLVAG  579

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV+NLVYF++VA+RY YK
Sbjct  580  IGVLNLVYFLIVAQRYHYK  598



>ref|XP_004297809.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Fragaria vesca 
subsp. vesca]
Length=622

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG++F+IPAGSL V+SLLTI + LP YDR+LVP  RK T+  GGIT+LQR+GIG  FS+L
Sbjct  405  LGQKFEIPAGSLIVISLLTIGIFLPVYDRLLVPALRKVTKDEGGITVLQRIGIGCIFSVL  464

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            AM V+GF+E +RR  AN     P+S  WL PQL++MG  EAF+++G +EF+N+EFP+++ 
Sbjct  465  AMLVAGFIEKERRDMANLHPHEPVSFMWLAPQLILMGLCEAFSVIGLLEFFNREFPDHIR  524

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+L+S ++  + Y+S++LV  VH+ TG H +PDWL +DINAGRL+ FYF++AG+G +
Sbjct  525  SVGNALLSCSFAGSSYLSSVLVTVVHRVTGTHSKPDWLTNDINAGRLDLFYFLLAGIGFL  584

Query  539  NLVYFMVVARRYRYKSKV  592
            N  YF+  A+RY+YK  V
Sbjct  585  NFFYFLFCAQRYKYKGTV  602



>ref|XP_004238760.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Solanum lycopersicum]
Length=607

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 155/205 (76%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GSL V+S++T+ + LP YDR++VP   K TR+ GGIT+L R+GIG+AFSIL
Sbjct  385  LGPNFQIPPGSLSVISMITVGIWLPVYDRLIVPSLTKVTRIEGGITLLHRIGIGIAFSIL  444

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G  E  RR +A       G +P++V  L PQL++MGFAEAFNILGQIEFYNKEFP
Sbjct  445  SMVVAGITEKMRRNSAITHNSPDGIAPVTVMRLAPQLVLMGFAEAFNILGQIEFYNKEFP  504

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM+S+ NSL S T   A Y+S++LVN +H TTG +G  DWL +DIN GR++ +Y++IAG
Sbjct  505  ENMSSVANSLFSCTVAGASYLSSLLVNVLHNTTGGNGHLDWLTNDINKGRIDYYYYLIAG  564

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+NL YF+ VA RY YK++V +D
Sbjct  565  LGVLNLFYFLYVASRYEYKTRVVID  589



>ref|XP_002520155.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF42210.1| nitrate transporter, putative [Ricinus communis]
Length=621

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 150/201 (75%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V S++TIA+ LPFYDR+ VP  RK T+  GGIT+LQR+GIG+ FS+L
Sbjct  403  LGHKFQIPAGSISVFSMITIAIWLPFYDRIAVPALRKITKHEGGITLLQRIGIGIVFSVL  462

Query  182  AMAVSGFVEIKRRAAA-NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G VE  RRAAA +   +P+SV WL PQL++MG  EAFNI+G IEFYNKEFP +M 
Sbjct  463  SMIVAGLVERDRRAAAISNPGTPMSVMWLVPQLVIMGLCEAFNIIGHIEFYNKEFPGHMR  522

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+ NSL   ++  A Y+ST++++ VHK T     PDWL  D+NAG+L+ +YFV+AGMG++
Sbjct  523  SMANSLFFCSFAGASYLSTLVISIVHKVTRTRDHPDWLTKDLNAGKLDRYYFVLAGMGIL  582

Query  539  NLVYFMVVARRYRYKSKVWVD  601
               YF+  AR Y+YK+ V +D
Sbjct  583  TFFYFLYCARLYQYKTPVQID  603



>ref|XP_011006584.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Populus euphratica]
Length=605

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 149/196 (76%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPA S+ VVSL+TI + LPFYDR+LVP  RK T+  GGITILQR+GIG+ FS+L
Sbjct  396  LGEKFQIPASSIIVVSLITIGIWLPFYDRILVPAIRKVTKREGGITILQRIGIGIVFSVL  455

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE +RRAAA  +  A+ +SV WL PQL+VMG  EAF   GQIEFYN++FP++M
Sbjct  456  SMVVAGLVERERRAAAISHPEAAAMSVFWLAPQLVVMGLCEAFVGTGQIEFYNEQFPDHM  515

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+GNSL   ++  A Y+STM+ + VHK TG    PDWL +D+N+G L+ FYF++AGMGV
Sbjct  516  RSLGNSLFFCSFAGASYLSTMVGSIVHKVTGTRHHPDWLTNDLNSGNLDYFYFLLAGMGV  575

Query  536  VNLVYFMVVARRYRYK  583
            VN  YF++ A RYRYK
Sbjct  576  VNWFYFLLCAHRYRYK  591



>ref|XP_010096325.1| Nitrate transporter 1.7 [Morus notabilis]
 gb|EXB63800.1| Nitrate transporter 1.7 [Morus notabilis]
Length=616

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PAGS+ V+SLLTIA+ LPFYDR LVP  R+ T    GIT+LQRMGIG+ FS L
Sbjct  398  LGPTFLVPAGSISVISLLTIALFLPFYDRFLVPALRRITGHDTGITLLQRMGIGIVFSTL  457

Query  182  AMAVSGFVEIKRRAAANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G +E +RR +AN    S +SV WL PQL++MG  EAFNI+GQIEF+N++FPENM 
Sbjct  458  SMVVAGLIEKERRTSANNPHYSEMSVFWLSPQLILMGLCEAFNIIGQIEFFNRQFPENMR  517

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+L S ++  A Y+ST++V  VH  TG   RPDWL +DIN GRL+ FYF+IA +GV+
Sbjct  518  SVGNALFSCSFAGASYISTLMVTLVHSFTGTKHRPDWLTNDINRGRLDYFYFLIALVGVL  577

Query  539  NLVYFMVVARRYRYK  583
            NLV F+  A+RYRYK
Sbjct  578  NLVSFLYCAKRYRYK  592



>gb|KEH19853.1| peptide/nitrate transporter [Medicago truncatula]
Length=602

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 152/205 (74%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+SL+TIA+ LP Y++ LVP  RK T    GIT+LQR+G+G+ FSIL
Sbjct  386  LGPKFQIPAGSMGVISLITIALWLPLYEKYLVPTLRKMTNKKEGITLLQRIGVGMLFSIL  445

Query  182  AMAVSGFVEIKRRAAANGGASPLSVA-----WLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+GFVE  RR +A    SPL +A     WL PQL++MG  EAFNILGQIEF+N +FP
Sbjct  446  SMIVAGFVEKIRRDSAKSNPSPLEIAPMSVLWLAPQLILMGLCEAFNILGQIEFFNMQFP  505

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SIGNSL + ++  A YVS++LVN +H TT  H  PDWL +DIN G+++ FY++IA 
Sbjct  506  DHMRSIGNSLFACSFAGASYVSSILVNIIHHTTRTHDHPDWLVNDINKGKIDYFYYLIAM  565

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +G +N V+F+ VARRY+YK  V +D
Sbjct  566  IGTLNFVFFIYVARRYQYKGVVNLD  590



>ref|XP_002863113.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39372.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=619

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 147/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  395  LGPHFEIPAGSLSVISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIIFAIF  454

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  455  SMIVAGIVERMRRIRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  514

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S++LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  515  EHMRSIANSLFSLSFAGSSYLSSLLVTVVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAI  574

Query  527  MGVVNLVYFMVVARRYRYK  583
            MGVVNLVYF   AR YRYK
Sbjct  575  MGVVNLVYFWYCARGYRYK  593



>emb|CDY38767.1| BnaA07g28390D [Brassica napus]
Length=622

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  MGPNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVERKRRIRSINAGDATGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVH+ +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHRFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  578  LGVFNLVYFWYCARGYRYK  596



>ref|XP_009105659.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Brassica rapa]
Length=622

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  MGPNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVERKRRIRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVH+ +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHRFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  578  LGVFNLVYFWYCARGYRYK  596



>ref|XP_006302005.1| hypothetical protein CARUB_v10019982mg [Capsella rubella]
 gb|EOA34903.1| hypothetical protein CARUB_v10019982mg [Capsella rubella]
Length=619

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI + LPFYDRV VP+AR+ T    GIT+LQR+G G+ F+I 
Sbjct  396  LGPNFEIPAGSLSVISLLTIGIFLPFYDRVFVPFARRVTGHKSGITLLQRIGTGIVFAIF  455

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  456  SMIVAGIVERMRRIRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  515

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK TG H RPDWLN ++NAG+L+ FY++IA 
Sbjct  516  EHMRSIANSLFSLSFAGSSYLSSFLVTIVHKFTGGHDRPDWLNKNLNAGKLDYFYYLIAV  575

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  576  LGVFNLVYFWYCARGYRYK  594



>ref|NP_564979.1| nitrate transporter 1.7 [Arabidopsis thaliana]
 sp|Q8RX77.1|PTR21_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.13; Short=AtNPF2.13; 
AltName: Full=Nitrate transporter 1.7 [Arabidopsis thaliana]
 gb|AAL90918.1| At1g69870/T17F3_10 [Arabidopsis thaliana]
 gb|AAM78041.1| At1g69870/T17F3_10 [Arabidopsis thaliana]
 gb|AEE34993.1| nitrate transporter 1.7 [Arabidopsis thaliana]
Length=620

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 147/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +F+IPAGSL V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  396  LGPKFEIPAGSLSVISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  455

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  456  SMIVAGIVERMRRIRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  515

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  516  EHMRSIANSLFSLSFAGSSYLSSFLVTVVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  575

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  576  LGVVNLVYFWYCARGYRYK  594



>gb|AAG52567.1|AC010675_15 putative peptide transporter; 37139-33250 [Arabidopsis thaliana]
Length=644

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 147/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +F+IPAGSL V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  420  LGPKFEIPAGSLSVISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  479

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  480  SMIVAGIVERMRRIRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  539

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  540  EHMRSIANSLFSLSFAGSSYLSSFLVTVVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  599

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  600  LGVVNLVYFWYCARGYRYK  618



>emb|CDY48389.1| BnaA07g24080D [Brassica napus]
Length=607

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G +F++PAGSL V+SLLTI V LP YDR+LVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  386  MGPKFEVPAGSLSVISLLTIGVFLPLYDRILVPFLRRITGHKSGITLLQRIGTGIVFAIL  445

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A+   G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  446  SMIVAGLVERVRRTRSIKASDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  505

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S+++  + Y+S+ LV  VHK +G H RPDWLN D+NAG+L+ FY++IA 
Sbjct  506  DHMRSIANALFSLSFAGSSYLSSFLVTVVHKFSGGHDRPDWLNKDLNAGKLDYFYYLIAV  565

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  566  LGVVNLVYFWYCARGYRYK  584



>ref|XP_009127767.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Brassica rapa]
Length=591

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  367  IGPNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFFRRITGHKSGITLLQRIGTGIVFAIL  426

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A  + G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  427  SMIVAGLVERMRRTRSINAGDSTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  486

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  487  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  546

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   A+ YRYK
Sbjct  547  LGVFNLVYFWYCAQGYRYK  565



>emb|CDY56086.1| BnaA02g35730D [Brassica napus]
Length=591

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  367  IGPNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFFRRITGHKSGITLLQRIGTGIVFAIL  426

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A  + G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  427  SMIVAGLVERMRRTRSINAGDSTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  486

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  487  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  546

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   A+ YRYK
Sbjct  547  LGVFNLVYFWYCAQGYRYK  565



>ref|XP_010256203.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Nelumbo nucifera]
Length=626

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 152/199 (76%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGSL ++S++TI + LPFYDRVLVP  R+ T+  GGIT+LQR+GIG+ F+ +
Sbjct  398  LGPKFQIPAGSLMIISMITIGLWLPFYDRVLVPALRRVTKQEGGITLLQRIGIGMVFAPV  457

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR++A       G +P+SV WL PQL++MGFAEAF+ +GQIEFY K+FP
Sbjct  458  SMVVAGLVEKKRRSSAISHARPDGMAPISVLWLAPQLVLMGFAEAFSNIGQIEFYYKQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M S+ N+L   T   + Y+++++V  VH  TG HG+P WL+++INAGRL+ FYFVIA 
Sbjct  518  EQMRSMANALFFCTLAGSNYLNSLVVTMVHLITGKHGQPKWLDNNINAGRLDYFYFVIAA  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +G++N++Y+++ AR Y YK
Sbjct  578  LGILNIIYYLICARYYHYK  596



>emb|CDY53067.1| BnaCnng24110D [Brassica napus]
Length=594

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  370  IGPNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFFRRITSHKSGITLLQRIGTGIVFAIL  429

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  430  SMIVAGLVERMRRMRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  489

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  490  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  549

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   A+ YRYK
Sbjct  550  LGVFNLVYFWYCAQGYRYK  568



>emb|CDY11647.1| BnaC06g30920D [Brassica napus]
Length=619

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +GR F+IPAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  MGRNFEIPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVERKRRIRSINAGDPTGMTPMSVFWLSPQLVLMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVH+ +G H R DWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHRFSGGHDRLDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  578  LGVFNLVYFWYCARGYRYK  596



>ref|XP_007222023.1| hypothetical protein PRUPE_ppa002984mg [Prunus persica]
 gb|EMJ23222.1| hypothetical protein PRUPE_ppa002984mg [Prunus persica]
Length=615

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++PAGSL V+SLLTI + LPFYDR+LVP  RK T+  GGIT+LQR GIG+ FS+L
Sbjct  398  LGPHFEVPAGSLSVISLLTIGLWLPFYDRLLVPALRKFTKHEGGITVLQRCGIGIIFSVL  457

Query  182  AMAVSGFVEIKRRA-AANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G +E +RR+ A       +S AWL PQL++MG  EAFNI+  IEF+N+EFP+++ 
Sbjct  458  SMLVAGLIERERRSFALLHPNEHVSFAWLVPQLVLMGLCEAFNIIALIEFFNREFPDHLR  517

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+L+S  +  + Y+S+++VN VH  TG + RPDWL  DINAGRL+ FYF++AG+GV+
Sbjct  518  SVGNALLSCAFAGSSYLSSLVVNIVHHVTGRNKRPDWLTKDINAGRLDYFYFLLAGIGVL  577

Query  539  NLVYFMVVARRYRYKSK  589
            N  YF+  A+RY YK+K
Sbjct  578  NFFYFVYCAQRYHYKTK  594



>dbj|BAJ33974.1| unnamed protein product [Thellungiella halophila]
Length=622

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  MGPNFEVPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVERVRRTRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK TG   RPDWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHKFTGGRDRPDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  578  LGVVNLVYFWYCARGYRYK  596



>ref|XP_006390953.1| hypothetical protein EUTSA_v10018285mg [Eutrema salsugineum]
 gb|ESQ28239.1| hypothetical protein EUTSA_v10018285mg [Eutrema salsugineum]
Length=622

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGSL V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  MGPNFEVPAGSLSVISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVERVRRTRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+++V TVHK TG   RPDWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANSLFSLSFAGSNYLSSLIVTTVHKFTGGRDRPDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  578  LGVVNLVYFWYCARGYRYK  596



>ref|XP_008353106.1| PREDICTED: uncharacterized protein LOC103416653 [Malus domestica]
Length=1143

 Score =   234 bits (596),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 107/202 (53%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  2     LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
             LG  F++PAGS+ V+S LTI + LP YDR+LVP  RK T+  GG+T+LQR GIG+ FS+L
Sbjct  932   LGANFEVPAGSISVISFLTIGLWLPIYDRILVPSLRKITKREGGVTVLQRCGIGIIFSVL  991

Query  182   AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
             +M V+G +E +RR  AN   A+ +S  WL PQL++MG  EAFN++G +EF+N+EFP++M 
Sbjct  992   SMTVAGVIEKERRNFANLHPAAHVSFLWLAPQLILMGLCEAFNMIGLLEFFNREFPDHMR  1051

Query  359   SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
             SIGN+LVS ++  + Y+S+++VN VH  +G    PDWL +DINAGRL+ FYF++AG+GV+
Sbjct  1052  SIGNALVSCSFAGSSYLSSLVVNVVHHVSGTEKHPDWLTNDINAGRLDYFYFLLAGIGVL  1111

Query  539   NLVYFMVVARRYRYK-SKVWVD  601
             N  YF+  A+RY YK + V+VD
Sbjct  1112  NFPYFLYCAQRYHYKATNVYVD  1133



>ref|XP_010512052.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Camelina sativa]
Length=621

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  397  LGPHFEIPAGSLSVISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  456

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  457  SMIVAGIVERMRRRRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  516

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  517  EHMRSIANSLFSLSFAGSNYLSSFLVTFVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  576

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  577  LGVFNLVYFWYCARGYRYK  595



>ref|XP_007153857.1| hypothetical protein PHAVU_003G070500g [Phaseolus vulgaris]
 gb|ESW25851.1| hypothetical protein PHAVU_003G070500g [Phaseolus vulgaris]
Length=589

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 149/202 (74%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIPAGSL V+SL+TIA+ LPFYD  LVP  RK T+  GGIT+L R+GIG+ FSIL
Sbjct  372  LGPNFQIPAGSLMVISLITIALWLPFYDSFLVPKLRKITKHEGGITLLLRIGIGMVFSIL  431

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V G VE  RR +AN      G +P+SV WL P L++MG  EAFNI+GQIEF+N +FP
Sbjct  432  SMVVVGMVEKVRRDSANSNPTPLGIAPMSVLWLAPHLILMGLCEAFNIIGQIEFFNSQFP  491

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNSL S ++  A YVST++VN VH TT  H  PDWL +DIN+GR++ FY++IA 
Sbjct  492  EHMRSIGNSLFSCSFAAANYVSTIMVNVVHHTTTTHSHPDWLTNDINSGRIDYFYYLIAV  551

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +  +NL++F  VARRY+YK  V
Sbjct  552  LSTLNLIFFTFVARRYQYKGSV  573



>ref|XP_010415654.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=621

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  397  LGPNFEIPAGSLSVISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  456

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  457  SMIVAGIVERMRRRRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  516

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  517  EHMRSIANSLFSLSFAGSNYLSSFLVTFVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  576

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  577  LGVFNLVYFWYCARGYRYK  595



>ref|XP_010470990.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Camelina sativa]
Length=621

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  397  LGPNFEIPAGSLSVISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  456

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  457  SMIVAGIVERMRRRRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  516

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL S+++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  517  EHMRSIANSLFSLSFAGSNYLSSFLVTFVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  576

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  577  LGVFNLVYFWYCARGYRYK  595



>ref|XP_010683278.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 142/194 (73%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G +FQIP GS+ ++S+L I V +P YDR LVP  RK T+   G T+LQRMGIGL FSI+
Sbjct  406  IGPKFQIPPGSIGIISMLAIGVWVPIYDRFLVPSLRKITKHEHGFTLLQRMGIGLVFSII  465

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M V+G VE KRR  AN     LS+ WL PQL+++G AE FN + QIEFYNK+FPEN+ S
Sbjct  466  SMIVAGLVEQKRRNTANIHHQRLSIIWLVPQLVMLGLAEGFNFIAQIEFYNKQFPENLRS  525

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            I  S+  +T   A Y+S+ +VN VHK T  HG+PDWL +DIN GR++ FY+++A MGV+N
Sbjct  526  IATSMFFITVAGASYLSSAVVNLVHKYTSRHGKPDWLTNDINQGRVDFFYYLLAIMGVLN  585

Query  542  LVYFMVVARRYRYK  583
             +YF++ AR+Y+YK
Sbjct  586  FIYFIICARKYKYK  599



>gb|KFK41407.1| hypothetical protein AALP_AA2G126900 [Arabis alpina]
Length=622

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 147/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +F+IPAGSL V+SLLTI V LP Y+R+ VP+ R+ T    GIT+LQR+G G+ F+IL
Sbjct  398  LGPKFEIPAGSLSVISLLTIGVFLPVYERLFVPFMRRITGHNSGITLLQRIGTGIVFAIL  457

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FP
Sbjct  458  SMIVAGLVEEARRTRSIKAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFP  517

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI N+L S+++  + Y+S+++V  VHK TG   RPDWLN ++NAG+L+ FY++IA 
Sbjct  518  EHMRSIANALFSLSFAGSSYLSSLIVTIVHKFTGGRDRPDWLNKNLNAGKLDYFYYLIAV  577

Query  527  MGVVNLVYFMVVARRYRYK  583
            MGV+NLVYF   AR YRYK
Sbjct  578  MGVINLVYFWYCARGYRYK  596



>ref|XP_008221697.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=613

 Score =   224 bits (571),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 107/197 (54%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI + LP YDR+LVP  RK T+  GGIT+LQR GIG+ FS++
Sbjct  396  LGPHFEIPAGSLGVISLLTIGLWLPAYDRLLVPALRKFTKHEGGITVLQRCGIGIVFSVM  455

Query  182  AMAVSGFVEIKRRAAANGGASP-LSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +M V+G +E +RR+ A    +  +S AWL PQL++MG  EAFNI+  IEF+N+EFP+++ 
Sbjct  456  SMLVAGLIERERRSFALLHPNEHVSFAWLVPQLVLMGLCEAFNIIALIEFFNREFPDHLR  515

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+L+S  +  + Y+S+++VN VH  TG + RPDWL  DINAGRL+ FYF++AG GV+
Sbjct  516  SVGNALLSCAFAGSSYLSSLVVNIVHHVTGRNKRPDWLTKDINAGRLDYFYFLLAGTGVL  575

Query  539  NLVYFMVVARRYRYKSK  589
            N  YF+  A+RY YK+K
Sbjct  576  NFFYFVYCAQRYHYKAK  592



>ref|XP_009360408.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Pyrus x bretschneideri]
Length=622

 Score =   223 bits (569),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/196 (52%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++PAGS+ V+S LTI + LP YDR++VP  RK T++ GGIT+LQR GIG+ FS+L
Sbjct  405  LGANFEVPAGSISVISFLTIGLWLPIYDRIIVPSLRKITKLEGGITVLQRCGIGIIFSVL  464

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +MAV+G +E +RR  AN    + +S  WL PQL++MG  EAFNI+G +EF+N+EFP++M 
Sbjct  465  SMAVAGVIEKERRDFANLHPDAHVSFLWLAPQLILMGLCEAFNIIGLLEFFNREFPDHMR  524

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+L+S ++  + Y+S+ +V  VH  TG    PDWL +D+NAGRL+ FYF++AG+GV+
Sbjct  525  SVGNALLSCSFAGSSYLSSFMVTVVHHVTGTEKHPDWLTNDLNAGRLDYFYFLLAGIGVL  584

Query  539  NLVYFMVVARRYRYKS  586
               YF+  A+RY YK+
Sbjct  585  TFAYFLFCAQRYHYKA  600



>ref|XP_010475864.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=624

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V+LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  397  LGPNFEIPAGSLSVISLLTICVILPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  456

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFN +GQ+EF+N +FP
Sbjct  457  SMIVAGIVERMRRRRSISAGDPTGITPMSVFWLSPQLILMGLCEAFNAIGQLEFFNSQFP  516

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL  +++  + Y+S++LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  517  EHMRSIANSLFFLSFAGSSYLSSVLVTIVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  576

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  577  LGVFNLVYFWYCARGYRYK  595



>ref|XP_007226812.1| hypothetical protein PRUPE_ppa024795mg, partial [Prunus persica]
 gb|EMJ28011.1| hypothetical protein PRUPE_ppa024795mg, partial [Prunus persica]
Length=550

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 142/201 (71%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGS+ ++SL+T+ + LPFYDRVL P  RK T+   GIT LQR+GIG  FSIL
Sbjct  337  IGPNFEMPAGSVKMMSLITLCICLPFYDRVLQPALRKITKHENGITPLQRIGIGYLFSIL  396

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M V+G VE +RRA+A       G +P+SV WLFPQLM++G  E F I+G IE YNKEFP
Sbjct  397  FMVVAGLVERQRRASALSQASEDGVAPISVFWLFPQLMLLGMVELFGIVGHIELYNKEFP  456

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL+ +    A Y+S ++ + V+  TG HG P+WL++DINAGRL+ FYF+IA 
Sbjct  457  EKMRSIGNSLIYLCTAGATYLSAVVASIVYSVTGKHGEPNWLDNDINAGRLDYFYFLIAA  516

Query  527  MGVVNLVYFMVVARRYRYKSK  589
            +GV+N VYF   AR Y Y S 
Sbjct  517  LGVLNFVYFWSCARGYTYTSS  537



>ref|XP_010443122.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=553

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V+LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  329  LGPNFEIPAGSLSVISLLTICVILPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  388

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +  V+G VE  RR     A    G +P+SV WL PQL++MG  EAFN +GQ+EF+N +FP
Sbjct  389  STIVAGIVERMRRRRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNAIGQLEFFNSQFP  448

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL  +++  + Y+S++LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  449  EHMRSIANSLFFLSFAGSSYLSSVLVTIVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  508

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NLVYF   AR YRYK
Sbjct  509  LGVFNLVYFWYCARGYRYK  527



>ref|XP_008367039.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Malus domestica]
Length=620

 Score =   222 bits (566),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 102/196 (52%), Positives = 145/196 (74%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++PAGS+ V+S LTI + LP YDR++VP  RK T++ GGIT+LQR GIG+ FS+L
Sbjct  403  LGANFEVPAGSISVISFLTIGLWLPIYDRIIVPSLRKFTKLEGGITVLQRCGIGIIFSVL  462

Query  182  AMAVSGFVEIKRRAAAN-GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +MAV+G +E +RR  AN    + +S  WL PQL++MG  EAFNI+G +EF+N+EFP++M 
Sbjct  463  SMAVAGVIEKERRDFANLHPDAHVSFLWLAPQLILMGLCEAFNIIGLLEFFNREFPDHMR  522

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            S+GN+LVS ++  A Y+S+  V  +H  TG    PDWL +D+NAGRL+ FYF++AG+GV+
Sbjct  523  SVGNALVSCSFAGASYLSSFTVTVLHHVTGTEKHPDWLTNDLNAGRLDYFYFLLAGIGVL  582

Query  539  NLVYFMVVARRYRYKS  586
               YF+  A+RY YK+
Sbjct  583  TFAYFLFCAQRYHYKA  598



>ref|XP_010482935.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=619

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGSL V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I 
Sbjct  396  LGPNFEIPAGSLSVISLLTICVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIF  455

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     A    G +P+SV WL PQL++MG  EAFN +GQ+EF+N +FP
Sbjct  456  SMIVAGIVERMRRRRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNAIGQLEFFNSQFP  515

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SI NSL  +++  + Y+S++LV  VHK +G H RPDWLN ++NAG+L+ FY++IA 
Sbjct  516  EHMRSIANSLFFLSFAGSSYLSSVLVTIVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAV  575

Query  527  MGVVNLVYFMVVARRYRYK  583
            +G+ NLVYF   AR YRYK
Sbjct  576  LGMFNLVYFWYCARGYRYK  594



>ref|XP_008221751.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=586

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGS+ ++SL+T+ + LPFYDRVL P  RK T+   GIT LQR+GIG  FS L
Sbjct  373  IGPNFEMPAGSVKMMSLITLCISLPFYDRVLQPALRKITKHENGITPLQRIGIGYLFSFL  432

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M V+G VE +RRA+A       G +P+SV WLFPQLM +G  E F I+G IE YNKEFP
Sbjct  433  FMVVAGLVERQRRASALSQASEDGVAPMSVFWLFPQLMFLGMVELFGIVGHIELYNKEFP  492

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL+ +    A Y+S +L + V+  TG HG P+WL++DINAGRL+ FYF+IA 
Sbjct  493  EKMRSIGNSLIYLCTAGATYLSAVLASIVYSVTGKHGEPNWLDNDINAGRLDYFYFLIAA  552

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +GV+N VYF   AR Y Y S V
Sbjct  553  LGVLNFVYFWSCARGYTYTSSV  574



>ref|XP_006645212.1| PREDICTED: nitrate transporter 1.7-like [Oryza brachyantha]
Length=490

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 140/195 (72%), Gaps = 2/195 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  F+IPAGS+  +SL+ + + +P YDR+LVP AR+ T V  GIT+LQR GIGL  S ++
Sbjct  266  GMHFEIPAGSVVSISLIALTIFIPIYDRILVPIARRFTGVESGITLLQRQGIGLVISSIS  325

Query  185  MAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            M V+G VE KRR +A  NGG SP+SV WL PQL++MG AEAFN +GQIEFYNK+FPENM 
Sbjct  326  MVVAGLVEHKRRNSALSNGGISPMSVMWLAPQLVLMGIAEAFNAVGQIEFYNKQFPENMQ  385

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            ++  SL   T   A Y+ST +VN + + T   G+  WL DDIN G+L+ F++ IA MGV+
Sbjct  386  TLAGSLFFCTIAGANYLSTAMVNIMRRVTTRDGQSSWLTDDINLGKLDYFFYFIALMGVL  445

Query  539  NLVYFMVVARRYRYK  583
            NL+YF++ +  Y+YK
Sbjct  446  NLIYFLICSHYYQYK  460



>emb|CDY23545.1| BnaC06g25140D [Brassica napus]
Length=607

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G +F+ PAGSL V+SLLTI + LP YDRVLVP+ R+ T    GIT LQR+G G+ F+IL
Sbjct  386  MGPKFEAPAGSLSVISLLTIGIFLPIYDRVLVPFLRRITGHKSGITRLQRIGTGIVFAIL  445

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR     +    G +P+SV WL PQL++MG  EA NI+GQIEF+N +FP
Sbjct  446  SMIVAGLVERVRRTRSIKSGDPTGMTPMSVFWLSPQLILMGLCEALNIIGQIEFFNSQFP  505

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ++M SI N+L S+++  + Y+S+ LV  VHK +G H RPDWL+ ++NAG+L+ FY++IA 
Sbjct  506  DHMRSIANALFSLSFAGSSYLSSFLVTVVHKFSGGHDRPDWLDKNLNAGKLDYFYYLIAI  565

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GVVNLVYF   AR YRYK
Sbjct  566  LGVVNLVYFWYCARGYRYK  584



>dbj|BAK04665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 138/197 (70%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGS+  +SL+ +   LP YDR+LVP AR+ TRV  GIT+LQR GIGL  S +
Sbjct  381  LGTHFEIPAGSVISISLIALTAFLPIYDRILVPIARRFTRVESGITLLQRQGIGLVISPI  440

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR  A +NGG SP+SV WL PQL++MG AEAFN +GQIEFYNK+FPE M
Sbjct  441  SMVVAGLVEQKRRNSALSNGGKSPMSVLWLAPQLILMGIAEAFNAVGQIEFYNKQFPEQM  500

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL  VT   A Y+ST L N   K T   G   WL DDIN G+L+ F++ IA +GV
Sbjct  501  LTLAGSLFFVTLAGANYLSTALANITRKVTTRDGHTSWLTDDINLGKLDYFFYFIALIGV  560

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF++ +  Y+YKS
Sbjct  561  LNLFYFLICSHYYQYKS  577



>ref|XP_008446297.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.13-like 
[Cucumis melo]
Length=598

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 136/203 (67%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQIP  S+ V+S LTI   +P YDR LVP  RK T    GIT LQRM IG+ F++L
Sbjct  380  MGSNFQIPPASIIVISFLTITFFIPLYDRFLVPTLRKFTGHPNGITELQRMAIGIIFAVL  439

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M V+G VE++RR  AN   S +SV WL PQ  +MG  EAFNI+GQIEF+NKEFPE+M +
Sbjct  440  SMVVAGLVEMQRRNQANNDGSIMSVFWLTPQFFLMGLCEAFNIIGQIEFFNKEFPEHMRT  499

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTT---GVHGRPDWLNDDINAGRLENFYFVIAGMG  532
            +GN+  S +  ++ Y++T +V  VH+TT   G HG+PDWL DD+N GRL+ FY+++A   
Sbjct  500  MGNAFSSCSIALSSYINTAMVLIVHRTTGRGGAHGKPDWLIDDLNKGRLDYFYYIVAATA  559

Query  533  VVNLVYFMVVARRYRYKSKVWVD  601
              N   F+  A+ YRYK  V  D
Sbjct  560  FCNFXLFLYCAKNYRYKGHVSDD  582



>ref|XP_010926623.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Elaeis guineensis]
Length=592

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GS+  +SLL +A+ LP YD+V VP AR+ TR+  GIT+LQR G+GL FS L
Sbjct  390  LGSHFQIPPGSVGTISLLALALFLPIYDKVFVPMARRITRIETGITLLQRQGVGLVFSTL  449

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+  VE KRR +A  +G A+P+SV WL PQL++ G AE FN +GQ+EFYN++FPE+M
Sbjct  450  SMVVAALVEHKRRDSALSHGRATPMSVLWLAPQLILTGIAEGFNAVGQVEFYNRQFPEHM  509

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL   +   A Y+S+ LV+ V KTTG  GR  WL+++IN GR++ +Y+VI  MGV
Sbjct  510  QTLAGSLFFCSLAGANYLSSFLVSVVKKTTGGSGRASWLDNNINIGRVDYYYYVITIMGV  569

Query  536  VNLVYFMVVARRYRYK  583
            VNL+YF+V A  YRYK
Sbjct  570  VNLLYFLVCAHYYRYK  585



>ref|XP_010926624.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Elaeis guineensis]
Length=597

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GS+  ++LL +A+ LP YD+V VP AR+ TR+  GIT+LQR G+GL FS L
Sbjct  395  LGSHFQIPPGSVGTINLLALALFLPIYDKVFVPMARRITRIETGITLLQRQGVGLVFSSL  454

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+  VE KRR +A  +GGA+P+S  WL PQL++ G AE FN +GQ+EFYN++FPE+M
Sbjct  455  SMVVAALVERKRRDSALSHGGATPMSFLWLAPQLILTGIAEGFNAVGQVEFYNRQFPEHM  514

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL   +   A Y+S+ LV+ V KTTG  GR  WL+++IN GR++ +Y+VIA MGV
Sbjct  515  QTLAGSLFFCSLAGANYLSSFLVSIVKKTTGGGGRASWLDNNINIGRVDYYYYVIAIMGV  574

Query  536  VNLVYFMVVARRYRYK  583
            VNL+YF+V A  YRYK
Sbjct  575  VNLLYFLVCAHYYRYK  590



>ref|XP_007044381.1| Nitrate transporter 1.7, putative [Theobroma cacao]
 gb|EOY00213.1| Nitrate transporter 1.7, putative [Theobroma cacao]
Length=587

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G   +IPAGS+ V++L+ IAV LPFYDRVLVP   K T+  GGIT+LQR+GIG  FSIL 
Sbjct  384  GPYIKIPAGSVGVITLIAIAVWLPFYDRVLVPALEKITKQEGGITLLQRIGIGNLFSILT  443

Query  185  MAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
            M VSG +E KRR +A       G +P+SV WL PQL+++GF+E F+I+G IEFYNK+FPE
Sbjct  444  MLVSGLIETKRRHSALSHGGPDGVAPMSVMWLAPQLVLIGFSEIFSIVGLIEFYNKQFPE  503

Query  350  NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
            +M SIGNSL+ +T+ +A Y S+ ++  VH  T   G  +WL+DD+N  +L+ FYF+IAG+
Sbjct  504  HMRSIGNSLIYLTFSLASYASSSVITVVHSVTERKGS-NWLSDDVNTSKLDYFYFLIAGL  562

Query  530  GVVNLVYFMVVARRYRYKSKV  592
             ++N V+F+  ARRY YK  V
Sbjct  563  SLLNFVFFLFCARRYHYKGSV  583



>gb|KJB48086.1| hypothetical protein B456_008G052800 [Gossypium raimondii]
Length=512

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G   +IPAGS+ V++L+ IA+ LPFYDRV+V    K T+  GGIT+LQR+GIG  FSIL 
Sbjct  310  GPSIKIPAGSVGVITLIAIAIWLPFYDRVVVAALEKVTKQEGGITLLQRIGIGNLFSILT  369

Query  185  MAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
            M VSGF+E +RR +A       G +P++V WL PQL+++GF+E F+I+G IEFYNK+FPE
Sbjct  370  MLVSGFIETERRLSALSHGGTDGIAPMTVMWLTPQLILIGFSEIFSIVGLIEFYNKQFPE  429

Query  350  NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
            +M SIGNSL+ +T+  A Y S+++++ VH  +  HG  +WL+DDIN  +L+ FYF+IAG+
Sbjct  430  HMRSIGNSLIYLTFSFASYASSIVISVVHDVSARHGS-NWLSDDINTSKLDYFYFLIAGI  488

Query  530  GVVNLVYFMVVARRYRYKSKV  592
              +N ++F+  ARRY Y+S V
Sbjct  489  SSLNFLFFLFCARRYHYRSSV  509



>ref|XP_004155325.1| PREDICTED: LOW QUALITY PROTEIN: nitrate transporter 1.7-like 
[Cucumis sativus]
Length=598

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 137/203 (67%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQIP  S+ V+S LTI   +PFYD+ LVP  RK T    GIT LQRM IG+ F++L
Sbjct  380  MGSNFQIPPASIIVISFLTITFFIPFYDQFLVPTLRKFTGHPNGITELQRMAIGIVFAVL  439

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M V+G +E++RR  AN   S +SV WL PQ  +MG  EAFNI+GQIEF+NKEFPE+M +
Sbjct  440  SMVVAGLIEMQRRNQANNNGSIMSVFWLTPQFFLMGLCEAFNIIGQIEFFNKEFPEHMRT  499

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTT---GVHGRPDWLNDDINAGRLENFYFVIAGMG  532
            +GN+  S +  ++ Y++T +V  VH+TT   G HG+PDWL DD+N GRL+ FY+V+A   
Sbjct  500  MGNAFSSCSIALSSYINTAMVLIVHRTTGRGGAHGKPDWLIDDLNKGRLDYFYYVVAATA  559

Query  533  VVNLVYFMVVARRYRYKSKVWVD  601
               +  F+  A+ YRYK  V  D
Sbjct  560  FFXIFLFLYCAKNYRYKGHVSDD  582



>ref|XP_008221696.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=605

 Score =   216 bits (549),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 106/205 (52%), Positives = 145/205 (71%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQ+PAGS+ ++SL+++ + LPFYDRVL P  +K T+   GIT LQR+G+G  FSIL
Sbjct  390  IGPNFQMPAGSIKMMSLISLCICLPFYDRVLQPALKKITKHENGITTLQRIGLGYLFSIL  449

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
              AV+G VE +RRA+A       G +P+S+ WLFPQLM++G  E F ++G IE YNKEFP
Sbjct  450  FAAVAGLVEQQRRASALSHASADGVAPMSLFWLFPQLMLLGLFELFGVVGHIELYNKEFP  509

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SI NSL+ +      Y+ST++V+ V++ TG HG+P+WL +DINAGRL+ FYF+IA 
Sbjct  510  EKMRSIANSLIYLCVAGGTYLSTLVVSIVYRVTGKHGQPNWLGNDINAGRLDYFYFLIAA  569

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+N VYF   AR Y Y  K  V+
Sbjct  570  LGVLNFVYFWSCARGYTYNYKANVN  594



>ref|XP_009389042.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GSL ++ L+ I + +P YD++LVP A   T V GGIT+LQR G G+A +IL
Sbjct  371  LGPSFQIPPGSLGIICLMAIVLFIPVYDQILVPMATSITGVEGGITLLQRQGAGMAIAIL  430

Query  182  AMAVSGFVEIKRR--AAANGGA---SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR  A A+GGA   SPLS  WL PQL +MG AEAFN +GQ+EFYN++FP
Sbjct  431  SMVVAGLVEKKRRDSALAHGGADGSSPLSAMWLAPQLCLMGVAEAFNAVGQVEFYNRQFP  490

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M ++  SL   +   A Y+S+ L+  V K TG  GR  WL+DDIN GR++ +Y++IA 
Sbjct  491  EHMQTLAGSLFHCSLAGASYLSSFLIAFVQKRTGGPGRASWLDDDINVGRVDYYYYLIAA  550

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NL+YFMV A  YRYK
Sbjct  551  LGVGNLLYFMVCAHLYRYK  569



>gb|KJB48085.1| hypothetical protein B456_008G052800 [Gossypium raimondii]
Length=578

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G   +IPAGS+ V++L+ IA+ LPFYDRV+V    K T+  GGIT+LQR+GIG  FSIL 
Sbjct  376  GPSIKIPAGSVGVITLIAIAIWLPFYDRVVVAALEKVTKQEGGITLLQRIGIGNLFSILT  435

Query  185  MAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
            M VSGF+E +RR +A       G +P++V WL PQL+++GF+E F+I+G IEFYNK+FPE
Sbjct  436  MLVSGFIETERRLSALSHGGTDGIAPMTVMWLTPQLILIGFSEIFSIVGLIEFYNKQFPE  495

Query  350  NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
            +M SIGNSL+ +T+  A Y S+++++ VH  +  HG  +WL+DDIN  +L+ FYF+IAG+
Sbjct  496  HMRSIGNSLIYLTFSFASYASSIVISVVHDVSARHGS-NWLSDDINTSKLDYFYFLIAGI  554

Query  530  GVVNLVYFMVVARRYRYKSKV  592
              +N ++F+  ARRY Y+S V
Sbjct  555  SSLNFLFFLFCARRYHYRSSV  575



>ref|XP_007227399.1| hypothetical protein PRUPE_ppb015207mg [Prunus persica]
 gb|EMJ28598.1| hypothetical protein PRUPE_ppb015207mg [Prunus persica]
Length=615

 Score =   214 bits (546),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 106/201 (53%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQ+PAGS+ ++SL+++ + LPFYDRVL P  +K T+   GIT LQR+G+G  FSIL
Sbjct  390  IGPNFQMPAGSIKMMSLISLCICLPFYDRVLQPALKKITKHENGITTLQRIGLGYLFSIL  449

Query  182  AMAVSGFVEIKRRA-----AANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
              AV+G VE +RRA     A+  G +P+SV WLFPQLM +G  E F ++G IE YNKEFP
Sbjct  450  FAAVAGLVEQQRRASSLSHASADGVAPMSVFWLFPQLMFLGLFELFGVVGHIELYNKEFP  509

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SI NSL  +      Y+ST++V+ V++ TG HG+P+WL +DINAGRL+ FYF+IA 
Sbjct  510  EKMRSIANSLFYLCVAGGTYLSTLVVSIVYRVTGKHGQPNWLGNDINAGRLDYFYFLIAA  569

Query  527  MGVVNLVYFMVVARRYRYKSK  589
            +GV+N VYF   AR Y Y  K
Sbjct  570  LGVLNFVYFWSCARGYTYNYK  590



>gb|KJB61233.1| hypothetical protein B456_009G346900 [Gossypium raimondii]
Length=588

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
             G   +IPAGS+ V++L+ IAV LPFYDRVLVP   K T++ GGIT+LQR+G+G  FSIL
Sbjct  385  FGSTIKIPAGSVGVITLIAIAVWLPFYDRVLVPALEKITKLEGGITVLQRIGVGNLFSIL  444

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M VSGF+E KRR +A       G +P+SV WL PQL+++GFAE F+I+G IEFYNK+FP
Sbjct  445  TMLVSGFIETKRRNSALSHGGPDGVAPMSVMWLTPQLILIGFAEIFSIVGLIEFYNKQFP  504

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNSL+ +T+ +A Y S  ++  V+  TG  G   WL+ DIN  +L+ FYF+IAG
Sbjct  505  EHMRSIGNSLIYLTFSLASYASNWIITIVNDVTGRSGS-SWLSGDINTSKLDKFYFLIAG  563

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            + +++ V FM  ARRY Y+  V ++
Sbjct  564  ISLLDFVVFMFCARRYHYRGSVRIN  588



>ref|XP_004971025.1| PREDICTED: nitrate transporter 1.7-like isoform X2 [Setaria italica]
Length=570

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGS+  +SL+ + V +P YD+++VP ARK T + GGIT+LQR G+GL  S +
Sbjct  344  LGPHFEIPAGSVVSISLIALTVFIPIYDQLMVPLARKLTGLEGGITLLQRQGVGLVISPI  403

Query  182  AMAVSGFVEIKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR +A  NGG SP++V WL PQL++MG AEAF  +GQIEFYNK+FPE+M
Sbjct  404  SMVVAGLVEHKRRDSALSNGGMSPMTVLWLAPQLVLMGIAEAFIAVGQIEFYNKQFPEHM  463

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL+      A Y+ST LVN   K T  HG   WL D+IN G+L+ +Y+ IA +GV
Sbjct  464  QTLAGSLLFCAIAAANYLSTALVNITRKVTARHGHTSWLTDNINNGKLDYYYYFIAILGV  523

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF+  +  Y+YK+
Sbjct  524  LNLFYFLTCSHYYQYKA  540



>gb|EMS49861.1| Nitrate transporter 1.7 [Triticum urartu]
Length=622

 Score =   214 bits (544),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 105/197 (53%), Positives = 137/197 (70%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGS+  +SL+ +   +P YDR+LVP AR+ T V  GIT+LQR GIGL  S +
Sbjct  396  LGTHFEIPAGSVISISLIALTAFMPIYDRILVPIARRFTGVESGITLLQRQGIGLVISPI  455

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR  A +NGG SP+SV WL PQL++MG AEAFN +GQIEFYNK+FPE M
Sbjct  456  SMVVAGLVEHKRRNSALSNGGKSPMSVVWLAPQLILMGIAEAFNAVGQIEFYNKQFPEQM  515

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL  VT   A Y+ST L N   K T   G   WL DDIN G+L+ +++ IA +GV
Sbjct  516  LTLAGSLFFVTLAGANYLSTALANITRKVTTRDGHTSWLTDDINLGKLDYYFYFIALIGV  575

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF++ +  Y+YKS
Sbjct  576  LNLFYFLICSHYYQYKS  592



>ref|NP_001045170.1| Os01g0913300 [Oryza sativa Japonica Group]
 dbj|BAD82445.1| putative nitrate transporter NRT1-5 [Oryza sativa Japonica Group]
 dbj|BAF07084.1| Os01g0913300 [Oryza sativa Japonica Group]
 dbj|BAG94725.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55874.1| hypothetical protein OsJ_04516 [Oryza sativa Japonica Group]
Length=600

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 138/195 (71%), Gaps = 2/195 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  F+IPAGS+  +SL+ + + +P YDR+LVP AR  T V  GIT+LQR GIGLA S ++
Sbjct  375  GTHFEIPAGSVVSISLIALTLFIPIYDRILVPIARGFTGVESGITLLQRQGIGLAISPIS  434

Query  185  MAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            M V+G VE KRR  A +NGG SP+SV WL PQL++MG AEAFN +GQIEFYNK+FPENM 
Sbjct  435  MVVAGLVERKRRNSALSNGGISPMSVLWLAPQLVLMGIAEAFNAVGQIEFYNKQFPENMQ  494

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            ++  SL   T   A Y+ST L N + K T   G   WL D+IN G+L+ +++ IA MGV+
Sbjct  495  TLAGSLFFCTIAGANYLSTALANIMRKVTTRDGHSSWLTDNINLGKLDYYFYFIALMGVL  554

Query  539  NLVYFMVVARRYRYK  583
            NL+YF++ +  Y+YK
Sbjct  555  NLIYFLICSHFYQYK  569



>ref|XP_004135202.1| PREDICTED: nitrate transporter 1.7-like [Cucumis sativus]
 gb|KGN51872.1| hypothetical protein Csa_5G604170 [Cucumis sativus]
Length=598

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQIP  S+ V+S LTI   +PFYD+ LVP  RK T    GIT LQRM IG+ F++L
Sbjct  380  MGSNFQIPPASIIVISFLTITFFIPFYDQFLVPTLRKFTGHPNGITELQRMAIGIVFAVL  439

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M V+G +E++RR  AN   S +SV WL PQ  +MG  EAFNI+GQIEF+NKEFPE+M +
Sbjct  440  SMVVAGLIEMQRRNQANNNGSIMSVFWLTPQFFLMGLCEAFNIIGQIEFFNKEFPEHMRT  499

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTT---GVHGRPDWLNDDINAGRLENFYFVIAGMG  532
            +GN+  S +  ++ Y++T +V  VH+TT   G HG+PDWL DD+N GRL+ FY+V+A   
Sbjct  500  MGNAFSSCSIALSSYINTAMVLIVHRTTGRGGAHGKPDWLIDDLNKGRLDYFYYVVAATA  559

Query  533  VVNLVYFMVVARRYRYKSKVWVD  601
              N  +F+  A+ YRYK  V  D
Sbjct  560  FFNFFFFLYCAKNYRYKGHVSDD  582



>gb|EMT16488.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=425

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 137/197 (70%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGS+  +S + +   LP YDR+LVP AR+ T V  GIT+LQR GIGL  S +
Sbjct  199  LGTHFEIPAGSVISISFIALTAFLPIYDRILVPIARRFTGVESGITLLQRQGIGLVISPI  258

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +  V+G VE KRR  A +NGG SP+SV WL PQL++MG A+AFN +GQ+EFYNK+FPE+M
Sbjct  259  STVVAGLVEHKRRNSALSNGGKSPMSVFWLAPQLILMGIADAFNAVGQLEFYNKQFPEHM  318

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL  VT   AGY+S  + N   K T   G   W+ DDIN G+L+ ++++IA MGV
Sbjct  319  LTLAGSLFYVTLAGAGYLSAAMTNITKKVTTRDGHRSWIADDINLGKLDYYFYLIALMGV  378

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF++ +  Y+YKS
Sbjct  379  LNLFYFLICSHYYQYKS  395



>gb|KHG01988.1| hypothetical protein F383_22454 [Gossypium arboreum]
Length=585

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
             G   +IPAGS+ V++L+ IAV LPFYDRVLVP   K T++ GGIT+LQR+G+G  FSIL
Sbjct  385  FGSTIKIPAGSVGVITLIAIAVWLPFYDRVLVPALEKITKLEGGITVLQRIGVGNLFSIL  444

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M VSGF E KRR +A       G +P+SV WL PQL+++GFAE F+I+G IEFYNK+FP
Sbjct  445  TMLVSGFTETKRRNSALSHGGLDGVAPMSVMWLTPQLILIGFAEIFSIVGLIEFYNKQFP  504

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNSL+ +T+ +A Y S  ++  V+  TG  G   WL+ DIN  +L+ FYF+IAG
Sbjct  505  EHMRSIGNSLIYLTFSLASYASNWIITIVNDVTGRSGS-SWLSGDINTSKLDKFYFLIAG  563

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            + +++ V FM  ARRY Y+ + 
Sbjct  564  ISLLDFVVFMFCARRYHYRGQC  585



>ref|XP_004971024.1| PREDICTED: nitrate transporter 1.7-like isoform X1 [Setaria italica]
Length=610

 Score =   212 bits (539),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPAGS+  +SL+ + V +P YD+++VP ARK T + GGIT+LQR G+GL  S +
Sbjct  384  LGPHFEIPAGSVVSISLIALTVFIPIYDQLMVPLARKLTGLEGGITLLQRQGVGLVISPI  443

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR  A +NGG SP++V WL PQL++MG AEAF  +GQIEFYNK+FPE+M
Sbjct  444  SMVVAGLVEHKRRDSALSNGGMSPMTVLWLAPQLVLMGIAEAFIAVGQIEFYNKQFPEHM  503

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL+      A Y+ST LVN   K T  HG   WL D+IN G+L+ +Y+ IA +GV
Sbjct  504  QTLAGSLLFCAIAAANYLSTALVNITRKVTARHGHTSWLTDNINNGKLDYYYYFIAILGV  563

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF+  +  Y+YK+
Sbjct  564  LNLFYFLTCSHYYQYKA  580



>ref|XP_010232727.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Brachypodium distachyon]
Length=600

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 137/197 (70%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IPA S+  +S + + V +P YDR+LVP AR+ T V  GIT+LQR GIGL  S +
Sbjct  379  LGPHFEIPAASVITISFIALTVFMPIYDRILVPMARRFTGVESGITLLQRQGIGLVISPI  438

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR  A +NGG SPLSV WL PQL++MG AEAFN +GQIEFYNK+FPE+M
Sbjct  439  SMVVAGLVECKRRNSALSNGGKSPLSVFWLAPQLVLMGIAEAFNAVGQIEFYNKQFPEHM  498

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL  VT   A Y+ST L +   K T   G   WL D+IN G+L+ +++ IA MGV
Sbjct  499  LTLAGSLFFVTLAGANYLSTALASITGKVTSRDGHTSWLTDNINLGKLDYYFYFIALMGV  558

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF++ +  Y+YKS
Sbjct  559  LNLFYFLICSHYYQYKS  575



>ref|XP_007226648.1| hypothetical protein PRUPE_ppa022076mg [Prunus persica]
 gb|EMJ27847.1| hypothetical protein PRUPE_ppa022076mg [Prunus persica]
Length=579

 Score =   210 bits (535),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 138/201 (69%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGS+ V+SL+T+ + +P Y+RVL P  RK T+   GIT LQR+G+G   SIL
Sbjct  373  IGPNFEMPAGSIKVMSLITLCLCIPLYNRVLQPALRKITKHENGITTLQRIGLGYLLSIL  432

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
               V+G VE +RRA+A       G +P+SV WLFPQLM++G  E F  +G IE YNKEFP
Sbjct  433  FAVVAGLVEQQRRASALSQASADGVAPMSVFWLFPQLMLLGMVELFGFVGHIELYNKEFP  492

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL+ +    A Y+ST++V+ V+  TG HG P+WL++DINAGRL+ F+ +IA 
Sbjct  493  EKMRSIGNSLIYLCIAGATYLSTLMVSIVYSVTGKHGEPNWLDNDINAGRLDYFFILIAA  552

Query  527  MGVVNLVYFMVVARRYRYKSK  589
            +GV+N  YF   AR Y Y S 
Sbjct  553  LGVLNFAYFWSCARGYTYTSS  573



>gb|KHF99049.1| Nitrate transporter 1.7 -like protein [Gossypium arboreum]
Length=578

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 145/202 (72%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
             G   +IPAGS+ V++L+ IA+ LPFYD V+V    K T+  GGIT+LQR+GIG  FSIL
Sbjct  375  FGPSIKIPAGSVGVITLIAIAIWLPFYDGVVVAALEKVTKQEGGITLLQRIGIGNLFSIL  434

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M VSGF+E +RR +A       G +P++V WL PQL+++GF+E F+I+G IEFYNK+FP
Sbjct  435  TMLVSGFIETERRLSALSHGGTDGIAPMTVMWLTPQLILIGFSEIFSIVGLIEFYNKQFP  494

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNSL+ +T+  A Y S+ +++ VH  +  HG  +WL+DDIN  +L+ FYF+IAG
Sbjct  495  EHMRSIGNSLIYLTFSFASYASSTVISVVHDVSARHGS-NWLSDDINTSKLDYFYFLIAG  553

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +  +N ++F+  ARRY Y+S V
Sbjct  554  ISSLNFLFFLFCARRYHYRSSV  575



>gb|KHN48151.1| Nitrate transporter 1.7 [Glycine soja]
Length=553

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 133/199 (67%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+I AGS+ V+ +L+I V LP YD+++ P   K T+  GG+T LQR+G+G AF +L
Sbjct  350  LGHNFEIHAGSVNVIMMLSIGVFLPIYDQIIAPALEKITKQEGGLTTLQRIGLGHAFGVL  409

Query  182  AMAVSGFVEIKRRA-----AANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M VSG VEIKRR       A+ G +P+SV WL PQ M++     F  +G  EF+NKEFP
Sbjct  410  SMVVSGLVEIKRRELAISKGASDGVAPMSVMWLAPQFMLLACCHVFGTVGHTEFFNKEFP  469

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            + M SIGNSL+ +    A  +S+ +VN VH  T   G+PDWL+ DIN GRLE FYF IA 
Sbjct  470  DGMKSIGNSLLCLNVSAASNLSSFIVNIVHSYTRKLGQPDWLDGDINKGRLEYFYFFIAA  529

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV+N+ YF+  +RRY YK
Sbjct  530  LGVLNMCYFIFCSRRYHYK  548



>ref|XP_003553207.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
Length=574

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 133/199 (67%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+I AGS+ V+ +L+I V LP YD+++ P   K T+  GG+T LQR+G+G AF +L
Sbjct  371  LGHNFEIHAGSVNVIMMLSIGVFLPIYDQIIAPALEKITKQEGGLTTLQRIGLGHAFGVL  430

Query  182  AMAVSGFVEIKRRA-----AANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M VSG VEIKRR       A+ G +P+SV WL PQ M++     F  +G  EF+NKEFP
Sbjct  431  SMVVSGLVEIKRRELAISKGASDGVAPMSVMWLAPQFMLLACCHVFGTVGHTEFFNKEFP  490

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            + M SIGNSL+ +    A  +S+ +VN VH  T   G+PDWL+ DIN GRLE FYF IA 
Sbjct  491  DGMKSIGNSLLCLNVSAASNLSSFIVNIVHSYTRKLGQPDWLDGDINKGRLEYFYFFIAA  550

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV+N+ YF+  +RRY YK
Sbjct  551  LGVLNMCYFIFCSRRYHYK  569



>emb|CBH32526.1| peptide transporter, putative, expressed [Triticum aestivum]
Length=609

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 136/197 (69%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IP GS+  +S + +   LP YD++LVP AR+ T V  GIT+LQR GIGL  S +
Sbjct  383  LGTHFEIPPGSVISISFIALTAFLPIYDQILVPIARRFTGVESGITLLQRQGIGLVISPI  442

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+G VE KRR  A +NGG SP+SV WL PQL++MG A+AFN +GQ EFYNK+FPE M
Sbjct  443  SMVVAGLVEHKRRNSALSNGGKSPMSVFWLAPQLILMGIADAFNAVGQFEFYNKQFPEQM  502

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL  VT   AGY+ST + N   K T   G   W+ DDIN G+L+ ++++IA MGV
Sbjct  503  LTLAGSLFYVTLAGAGYLSTAMTNITKKVTTRDGHNSWIADDINLGKLDYYFYLIALMGV  562

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF++ +  Y+YKS
Sbjct  563  LNLFYFLICSHYYQYKS  579



>ref|XP_006415996.1| hypothetical protein EUTSA_v10007235mg [Eutrema salsugineum]
 gb|ESQ34349.1| hypothetical protein EUTSA_v10007235mg [Eutrema salsugineum]
Length=566

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 143/197 (73%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G+ F+IPAGS+ V++ +TI + +P YDRVLVP  W  ++ R    +T+LQRMGIG+ F+
Sbjct  363  MGQHFEIPAGSVSVITFITIGIWVPIYDRVLVPSLWRIRKFR----LTLLQRMGIGIVFA  418

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            ILAM  +GFVE  RR  A   ++  SV WL  QLM+MG  E+FN +GQIEF+N +FPE+M
Sbjct  419  ILAMFTAGFVESVRRPRALK-STQTSVFWLALQLMLMGLCESFNFIGQIEFFNSQFPEHM  477

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y++++LV TVHK +G    PDWLN+D++ G+L+ FY++IAG+GV
Sbjct  478  RSIANSLFPLSFAAAHYLTSLLVTTVHKFSGGKDHPDWLNNDLDRGKLDYFYYMIAGLGV  537

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y YK+
Sbjct  538  VNLVYFWYCARSYHYKT  554



>ref|XP_011463116.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Fragaria vesca 
subsp. vesca]
Length=605

 Score =   207 bits (528),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 100/200 (50%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G + Q+PAG++ ++SL  I + LP YDRV+ P  ++ T+   GI  L+++GIG  FSIL
Sbjct  394  IGTKLQMPAGAIKMMSLSIIIIWLPLYDRVIQPALKRITKSEDGIPTLKKIGIGYIFSIL  453

Query  182  AMAVSGFVEIKRRAAAN------GGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
             M V+G VE +RR  A        G +P+SV WLFPQL+++G +E F  LG IEFYNKEF
Sbjct  454  CMLVAGLVEQQRRTLATLHGESPNGVAPISVFWLFPQLVLLGLSEVFGALGHIEFYNKEF  513

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PE M SIGNSL+ +    A Y+S+++V  VH  TG HG+P+WL++DINAGRL+ FYF++A
Sbjct  514  PEKMKSIGNSLIYLCMAGATYLSSLVVTIVHSFTGKHGQPNWLDNDINAGRLDYFYFLLA  573

Query  524  GMGVVNLVYFMVVARRYRYK  583
            G+G++N VYF+  A  Y YK
Sbjct  574  GLGLLNFVYFLFCACGYSYK  593



>ref|XP_009408470.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LGR FQIP GSL  ++++ + + +P YDRVLVP AR+ T    GITILQR G G+  ++ 
Sbjct  394  LGRSFQIPPGSLATIAMVALTLFIPVYDRVLVPVARRITGNESGITILQRQGAGMVIAVA  453

Query  182  AMAVSGFVEIKRR--AAANGGA---SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR  A A+GGA   SPLSV WL PQL ++G AEAFN +GQIEFYN++FP
Sbjct  454  SMVVAGLVEQKRRNSALAHGGANGTSPLSVLWLAPQLCLVGVAEAFNAVGQIEFYNRQFP  513

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M ++  SL   +   A Y+S++LV  V + TG  GR  WL+D+IN GR++ FY+++A 
Sbjct  514  EHMQTLAGSLFYCSISGASYLSSLLVALVRRRTGGEGRTGWLDDNINVGRVDYFYYMVAL  573

Query  527  MGVVNLVYFMVVARRYRYK  583
            +GV NL+YF+V A  YRYK
Sbjct  574  LGVANLLYFLVCAHFYRYK  592



>ref|XP_006838787.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
 gb|ERN01356.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
Length=597

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IP GSL V ++LT+   +P YDRV+VP  R  T    GIT+LQRMGIGL  SI+
Sbjct  369  IGPNFKIPPGSLTVFAMLTLTFWIPIYDRVIVPALRPITMKETGITLLQRMGIGLFISII  428

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M  +  VE  RR++A       G + +S  WL PQ ++ G AEAFN +GQIEFY +EFP
Sbjct  429  SMLAAAIVESHRRSSALTHPLPDGLAAMSALWLVPQFVLSGLAEAFNAIGQIEFYYREFP  488

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            ENM S+  SL   T   A ++S+ +VN +H+ TG +G P+WL +++N GRL+ FY+ IAG
Sbjct  489  ENMRSLAGSLFFCTMAFANFLSSFIVNIIHRYTGKNGHPNWLENNLNLGRLDLFYYFIAG  548

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            MGVVNLVYFMV A+ YRYK  V
Sbjct  549  MGVVNLVYFMVCAKWYRYKDTV  570



>ref|XP_009397037.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++P GSL ++SLL I + +P YDR LVP AR  T +  GIT+LQR G G+  +I+
Sbjct  350  LGPSFEVPPGSLGIISLLAIILFIPVYDRALVPMARSLTGIESGITLLQRQGAGMVVAII  409

Query  182  AMAVSGFVEIKRR--AAANGG---ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR  A A+GG   +SPLS  WL PQL +MG AEAFN +GQ+EFYN++FP
Sbjct  410  SMVVAGLVEKKRRDSAVAHGGVNGSSPLSAMWLAPQLCLMGIAEAFNAVGQVEFYNRQFP  469

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M +I  SL   +   A YVST LV  + K+T   G+  WL D+IN GR++ FY++IA 
Sbjct  470  EHMQTIAGSLFHCSLAGASYVSTFLVTFIRKSTAGPGQASWLEDNINVGRVDYFYYLIAV  529

Query  527  MGVVNLVYFMVVARRYRYK  583
            +G  NL+YF+V A  YRYK
Sbjct  530  LGAGNLLYFVVCAHFYRYK  548



>ref|XP_009397036.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=587

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++P GSL ++SLL I + +P YDR LVP AR  T +  GIT+LQR G G+  +I+
Sbjct  373  LGPSFEVPPGSLGIISLLAIILFIPVYDRALVPMARSLTGIESGITLLQRQGAGMVVAII  432

Query  182  AMAVSGFVEIKRR--AAANGG---ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR  A A+GG   +SPLS  WL PQL +MG AEAFN +GQ+EFYN++FP
Sbjct  433  SMVVAGLVEKKRRDSAVAHGGVNGSSPLSAMWLAPQLCLMGIAEAFNAVGQVEFYNRQFP  492

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M +I  SL   +   A YVST LV  + K+T   G+  WL D+IN GR++ FY++IA 
Sbjct  493  EHMQTIAGSLFHCSLAGASYVSTFLVTFIRKSTAGPGQASWLEDNINVGRVDYFYYLIAV  552

Query  527  MGVVNLVYFMVVARRYRYK  583
            +G  NL+YF+V A  YRYK
Sbjct  553  LGAGNLLYFVVCAHFYRYK  571



>gb|AES96528.2| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            L + F+IP G + +V++LTIA+++PFYD+V+ P   K T   GG+T LQR+G+G  F+IL
Sbjct  370  LTQNFEIPPGWMIIVTMLTIAIVIPFYDKVISPTLTKMTNQDGGLTNLQRIGLGHFFAIL  429

Query  182  AMAVSGFVEIKRRAAANG-GAS----PLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M ++G VE +RR ++   G S     +S+ WL PQ + +GF +AF+I+G  EF+NKE P
Sbjct  430  TMVIAGLVEQRRRVSSTSLGESYEITQMSIMWLVPQFITLGFNQAFSIVGHTEFFNKESP  489

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            + M SIGNSL+S+   VA  +ST +VN +H  +G  G PDWL+ D+N G+LE FYF++AG
Sbjct  490  DKMRSIGNSLLSLQTAVASNLSTFIVNIIHSFSGKQGEPDWLDSDVNKGKLEYFYFIVAG  549

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+N  +F+  A RYRYK+ V ++
Sbjct  550  LGVLNFGWFLFCACRYRYKTFVKIE  574



>gb|KFK44623.1| hypothetical protein AALP_AA1G282800 [Arabis alpina]
Length=569

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IP GS+ V++ +TI++ LP YDR+L+P  W   + R     T+LQRMGIG+ F 
Sbjct  363  MGPHFEIPPGSVSVITFITISIWLPIYDRILIPSLWRIHKFR----FTLLQRMGIGIVFG  418

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+   +GFVE  RR  A+  A  +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  419  ILSTFTAGFVETVRRTRASESAQ-MSVFWLALQLILMGLSESFNFIGQIEFFNTQFPEHM  477

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++G + Y+S++LV TVHK +G   +P WLN+D++ G+L+ FY++IAG+GV
Sbjct  478  RSIANSLFPLSFGASNYLSSLLVTTVHKLSGRKHQPGWLNNDLDRGKLDYFYYLIAGLGV  537

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR YRYK+
Sbjct  538  VNLVYFWYCARSYRYKA  554



>ref|XP_004489982.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=570

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            L + F+IP G L ++++LTIA+++P Y++V+ P   K T+  GG+T LQR+GIG  F+I+
Sbjct  366  LTKNFEIPPGWLIILTMLTIAIIIPIYEKVISPILTKVTKQEGGLTTLQRIGIGHFFAIV  425

Query  182  AMAVSGFVEIKRRAAANGG-------ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
             M ++GFVE +RR  ++            +S+ WL PQ + +G  +AF+I+GQ EF+NKE
Sbjct  426  TMVIAGFVEHQRRVVSSTSLRESINETKQMSIIWLAPQFIFLGINQAFSIVGQTEFFNKE  485

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
             P+ M SIGNSL+S+   VA  +ST +VN +H  +G  G+PDWL+ D+N GRLE FYF++
Sbjct  486  SPDKMRSIGNSLLSLQTSVASNISTFIVNIIHNFSGKQGQPDWLDSDVNKGRLEYFYFIV  545

Query  521  AGMGVVNLVYFMVVARRYRYKSKV  592
            AG+G+ N ++FM  AR YRYK+ V
Sbjct  546  AGLGLFNFLFFMSCARVYRYKTFV  569



>ref|XP_003613570.1| Peptide transporter [Medicago truncatula]
Length=599

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            L + F+IP G + +V++LTIA+++PFYD+V+ P   K T   GG+T LQR+G+G  F+IL
Sbjct  392  LTQNFEIPPGWMIIVTMLTIAIVIPFYDKVISPTLTKMTNQDGGLTNLQRIGLGHFFAIL  451

Query  182  AMAVSGFVEIKRRAAANG-GAS----PLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M ++G VE +RR ++   G S     +S+ WL PQ + +GF +AF+I+G  EF+NKE P
Sbjct  452  TMVIAGLVEQRRRVSSTSLGESYEITQMSIMWLVPQFITLGFNQAFSIVGHTEFFNKESP  511

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            + M SIGNSL+S+   VA  +ST +VN +H  +G  G PDWL+ D+N G+LE FYF++AG
Sbjct  512  DKMRSIGNSLLSLQTAVASNLSTFIVNIIHSFSGKQGEPDWLDSDVNKGKLEYFYFIVAG  571

Query  527  MGVVNLVYFMVVARRYRYKSKVWVD  601
            +GV+N  +F+  A RYRYK+ V ++
Sbjct  572  LGVLNFGWFLFCACRYRYKTFVKIE  596



>ref|XP_008787832.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=569

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 138/196 (70%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  FQIP GS+  ++LL +A+ LP YD+V VP AR+ T++  GIT+LQR GIGL  S L
Sbjct  367  LGSHFQIPPGSVVTINLLALALFLPIYDKVFVPMARRITKIETGITLLQRQGIGLVISSL  426

Query  182  AMAVSGFVEIKRR--AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            +M V+  VE KRR  A ++G A  +SV WL PQL++   AE FN +GQ+EFYN++FPE+M
Sbjct  427  SMVVAALVERKRRDLALSHGRAMQMSVLWLSPQLILTAIAEGFNAVGQVEFYNRQFPEHM  486

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             ++  SL   +   A Y+S+ LV+ V K TG  GR  WL+++IN GR++ +Y+VIA MGV
Sbjct  487  QTLAGSLFFCSLAGANYLSSFLVSVVKKITGGGGRASWLDNNINIGRVDYYYYVIAIMGV  546

Query  536  VNLVYFMVVARRYRYK  583
            VN++YF+V A  YRYK
Sbjct  547  VNVLYFLVCAHYYRYK  562



>gb|EEC72017.1| hypothetical protein OsI_04891 [Oryza sativa Indica Group]
Length=503

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = +2

Query  29   GSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFVE  208
            GS+  +SL+ + + +P YDR+LVP AR+ T V  GIT+LQR GIGLA S ++M V+G VE
Sbjct  286  GSVVSISLIALTLFIPIYDRILVPIARRFTGVESGITLLQRQGIGLAISPISMVVAGLVE  345

Query  209  IKRRAAA--NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNSLVS  382
             KRR +A  NGG SP+SV WL PQL++MG AEAFN +GQIEFYNK+FPENM ++  SL  
Sbjct  346  RKRRNSALSNGGISPMSVLWLAPQLVLMGIAEAFNAVGQIEFYNKQFPENMQTLAGSLFF  405

Query  383  VTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVYFMVV  562
             T   A Y+ST L N + K T   G   WL D+IN G+L+ +++ IA MGV+NL+YF++ 
Sbjct  406  CTIAGANYLSTALANIMRKVTTRDGHSSWLTDNINLGKLDYYFYFIALMGVLNLIYFLIC  465

Query  563  ARRYRYK  583
            +  Y+YK
Sbjct  466  SHFYQYK  472



>ref|XP_008221752.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=602

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 137/202 (68%), Gaps = 8/202 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGS+ V+SL+T+ V +P Y+RVL P  RK T+   GIT LQR+G+G  FSIL
Sbjct  392  IGPNFEMPAGSIKVMSLITLCVGIPLYNRVLQPALRKITKHENGITTLQRIGLGYLFSIL  451

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
               V   VE +RRA+A       G +P+SV WLFPQLM +G  E F  +G IE YNKEFP
Sbjct  452  FAVV---VERQRRASALSQASEDGVAPMSVFWLFPQLMFLGMVELFGFVGHIELYNKEFP  508

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL+ +    A Y+ST++V+ V+  TG HG P+WL++DINAGRL+ F+ +IA 
Sbjct  509  EKMRSIGNSLIYLCISGATYLSTLMVSIVYSVTGKHGEPNWLDNDINAGRLDYFFILIAA  568

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +GV+N  YF   AR Y Y S V
Sbjct  569  LGVLNFAYFWSCARGYTYTSSV  590



>gb|AEN81203.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81204.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81205.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81206.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81207.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81208.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81209.1| AT1G69870-like protein, partial [Capsella rubella]
 gb|AEN81210.1| AT1G69870-like protein, partial [Capsella rubella]
Length=170

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = +2

Query  41   VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFVEIKRR  220
            V+SLLTI + LPFYDRV VP+AR+ T    GIT+LQR+G G+ F+I +M V+G VE  RR
Sbjct  2    VISLLTIGIFLPFYDRVFVPFARRVTGHKSGITLLQRIGTGIVFAIFSMIVAGIVERMRR  61

Query  221  -----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNSLVSV  385
                 A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FPE+M SI NSL S+
Sbjct  62   IRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSL  121

Query  386  TWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMG  532
            ++  + Y+S+ LV  VHK TG H RPDWLN ++NAG+L+ FY++IA +G
Sbjct  122  SFAGSSYLSSFLVTIVHKFTGGHDRPDWLNKNLNAGKLDYFYYLIAVLG  170



>ref|XP_008340336.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Malus domestica]
Length=609

 Score =   203 bits (517),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 103/202 (51%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++PAGS+ ++S++T+ + LP Y+RVL P  RK T+   G+  LQR+GIG  FSIL
Sbjct  396  IGLNFEMPAGSIKLMSMMTVIISLPLYNRVLQPAIRKITKHEDGLPALQRIGIGYFFSIL  455

Query  182  AMAVSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M V+G +E +RRA A     + G + +SV WLFPQ +++G  E F  +G IEFYNKEFP
Sbjct  456  CMMVAGLIEQRRRALATSQDSSNGIAAMSVFWLFPQQILLGLLEVFGTVGHIEFYNKEFP  515

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E+M SIGNSL  +    A Y+S+++V+ VH  TG HG+P+WL++DIN GRL+N+YF+IAG
Sbjct  516  ESMKSIGNSLPYLCLAGATYLSSVVVSIVHSVTGKHGQPNWLDNDINVGRLDNYYFLIAG  575

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
            +GVVN +YF+  AR Y YK+ V
Sbjct  576  LGVVNFLYFLSCARGYTYKASV  597



>gb|ADG38047.1| AT1G69870-like protein [Capsella grandiflora]
 gb|ADG38048.1| AT1G69870-like protein [Capsella grandiflora]
 gb|ADG38049.1| AT1G69870-like protein [Capsella grandiflora]
 gb|ADG38050.1| AT1G69870-like protein [Capsella grandiflora]
Length=168

 Score =   191 bits (485),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = +2

Query  41   VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFVEIKRR  220
            V+SLLTI + LPFYDRV VP+AR+ T    GIT+LQR+G G+ F+I +M V+G VE  RR
Sbjct  2    VISLLTIGIFLPFYDRVFVPFARRVTGHKSGITLLQRIGTGIVFAIFSMIVAGIVERMRR  61

Query  221  -----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNSLVSV  385
                 A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FPE+M SI NSL S+
Sbjct  62   IRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSL  121

Query  386  TWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            ++  + Y+S+ LV  VHK TG H RPDWLN ++NAG+L+ FY++IA
Sbjct  122  SFAGSSYLSSFLVTIVHKFTGGHDRPDWLNKNLNAGKLDYFYYLIA  167



>ref|XP_010460223.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Camelina sativa]
Length=568

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 139/197 (71%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + LP YDR+LVP  W  ++ R     T+LQRMGIG+ F+
Sbjct  361  MGPHFEIPAASVVVISYITIGIWLPIYDRLLVPSLWRIRKFR----FTLLQRMGIGIIFA  416

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +GFVE  RR   +   +  SV WL   L++MGF E+FN +GQIEF+N +FPE+M
Sbjct  417  ILSMFTAGFVEGVRRTR-DTTVTQTSVFWLAVPLILMGFCESFNFIGQIEFFNSQFPEHM  475

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G   +PDWLN D++ G+L+ +Y+ IAG+GV
Sbjct  476  RSIANSLFPLSFAAANYLSSLLVTTVHKFSGTKDQPDWLNKDLDKGKLDYYYYTIAGLGV  535

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  536  VNLVYFWYCARNYQYKA  552



>gb|ADG38051.1| AT1G69870-like protein [Capsella grandiflora]
 gb|ADG38052.1| AT1G69870-like protein [Capsella grandiflora]
Length=168

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = +2

Query  41   VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFVEIKRR  220
            V+SLLTI + LPFYDRV VP+AR+ T    GIT+LQR+G G+ F+I +M V+G VE  RR
Sbjct  2    VISLLTIGIFLPFYDRVFVPFARRVTGHKSGITLLQRIGTGIVFAIXSMIVAGIVERMRR  61

Query  221  -----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNSLVSV  385
                 A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FPE+M SI NSL S+
Sbjct  62   IRSINAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSL  121

Query  386  TWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            ++  + Y+S+ LV  VHK TG H RPDWLN ++NAG+L+ FY++IA
Sbjct  122  SFAGSSYLSSFLVTIVHKFTGGHDRPDWLNKNLNAGKLDYFYYLIA  167



>gb|AAT45007.1| nitrate transporter, partial [Xerophyta humilis]
Length=275

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 134/202 (66%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F IPA S  V ++L + + +P YDR++VP  RK T   GGIT+LQRMG+GL  +I+ M V
Sbjct  51   FLIPAASYSVFAMLAMTIWIPIYDRIIVPRFRKLTGQEGGITLLQRMGVGLVLAIIGMVV  110

Query  194  SGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  +EI+RR+          A +GGA S +S  WL PQL+++G +EAFN +GQIEFY K+
Sbjct  111  SAIIEIQRRSYAIHRPTIGTAPSGGAISSMSSLWLIPQLVILGLSEAFNAIGQIEFYYKQ  170

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S+  SL  +    A Y+S  L+  VH+ TG     +WL  D+N GRL+ +YF I
Sbjct  171  FPENMRSVAGSLFFLGAATANYLSGALIGVVHRVTGRGAGKNWLAGDLNKGRLDYYYFFI  230

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            AG+GV+NLVYFM+ A+ Y+YK 
Sbjct  231  AGLGVLNLVYFMMCAKWYKYKE  252



>ref|XP_010923294.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=597

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 140/202 (69%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +FQIPA S  V ++L + + +P YDR+LVPW R+ T   GG T+LQRMGIG+  S++AM 
Sbjct  371  KFQIPAASFTVFAMLALTIWIPVYDRILVPWLRRVTGKEGGFTLLQRMGIGIVLSVVAMI  430

Query  191  VSGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VSG VE +RR+          A +GGA S +S  WL PQL+++G AEAFN++GQ+EFY K
Sbjct  431  VSGLVEERRRSYALHRPALGTAPSGGAISSMSSFWLVPQLVLLGLAEAFNLIGQVEFYYK  490

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM S+  +++      A Y+S  +V  VH+TTG +G+ +WL  D+N GRL+ FY++
Sbjct  491  QFPENMRSLAGAVLFCGMACANYLSGFMVTVVHQTTGHNGKDNWLASDLNQGRLDYFYYL  550

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA MGVV+ ++F+V A  YRYK
Sbjct  551  IALMGVVDFLFFIVFANWYRYK  572



>ref|XP_006304643.1| hypothetical protein CARUB_v10011778mg [Capsella rubella]
 gb|EOA37541.1| hypothetical protein CARUB_v10011778mg [Capsella rubella]
Length=579

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 139/197 (71%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + LP YDR+LVP  W  ++ R     T+LQRMGIG+ F+
Sbjct  361  MGPHFEIPAASVTVISYITIGIWLPIYDRLLVPSLWRIQKFR----FTLLQRMGIGIIFA  416

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +GFVE  RR  A    + +SV WL   L++MG  E+FN +GQIEF+N +FPE+M
Sbjct  417  ILSMFTAGFVEGVRRTQATE-RTQMSVFWLALPLILMGLCESFNFIGQIEFFNSQFPEHM  475

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G   +PDWLN D++ G+L+ +Y++IAG+GV
Sbjct  476  RSIANSLFPLSFAAANYLSSLLVTTVHKFSGTKDQPDWLNKDLDKGKLDYYYYLIAGLGV  535

Query  536  VNLVYFMVVARRYRYKS  586
            VN VYF   AR Y+YK+
Sbjct  536  VNFVYFWYCARSYQYKA  552



>ref|XP_008340338.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Malus domestica]
Length=621

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 135/201 (67%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F IPAGS+ ++S++T+ + L  YDRVL     K T+   GI  L+R+GIG  FS +
Sbjct  405  IGPNFAIPAGSVKMMSIMTLFISLTLYDRVLQRALTKFTKCEDGIPPLRRIGIGYFFSAM  464

Query  182  AMAVSGFVEIKRRAAANGGASP-----LSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M V+G VE +RRA A   AS      +SV WLFPQ M++G  E F ++G +EFYNKEFP
Sbjct  465  CMVVAGLVEQQRRALATSQASSNGVVAMSVFWLFPQEMLLGLCEMFGVVGLLEFYNKEFP  524

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL+ +    A  +S++ V+ VH  TG HGRP+WL++DINAGRL+ FYF+IAG
Sbjct  525  ETMKSIGNSLLYLCLAGASCLSSVTVSIVHGVTGKHGRPNWLDNDINAGRLDYFYFLIAG  584

Query  527  MGVVNLVYFMVVARRYRYKSK  589
            +GVVN  YF+  A  Y YK+ 
Sbjct  585  LGVVNFFYFLFCAXGYAYKAS  605



>ref|XP_010477772.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Camelina sativa]
Length=568

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + LP YDR+LVP  W  +  R     T+LQRMGIG+ F+
Sbjct  361  MGPHFEIPAASVVVISYITIGIWLPIYDRLLVPSLWRIREFR----FTLLQRMGIGIIFA  416

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +GFVE  RR   +   +  SV WL   L++MG  E+FN +GQIEF+N +FPE+M
Sbjct  417  ILSMFTAGFVEGVRRTR-DTAVTQTSVFWLAVPLILMGLCESFNFIGQIEFFNSQFPEHM  475

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G   +PDWLN D++ G+L+ +Y++IAG+GV
Sbjct  476  RSIANSLFPLSFAAANYLSSLLVTTVHKFSGTKDQPDWLNKDLDKGKLDYYYYMIAGLGV  535

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  536  VNLVYFWYCARNYQYKA  552



>ref|XP_009103775.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.12-like 
[Brassica rapa]
Length=562

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPAGS+ V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F 
Sbjct  356  MGPHFEIPAGSVSVISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFG  411

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            I++M  +  VE  RR  A    + +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  412  IVSMFTAAIVERVRRTQALK-MTQVSVFWLAWQLVLMGLSESFNYIGQIEFFNSQFPEHM  470

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+ NSL  +++  + Y++++LV TVHK +G   +PDWL++D+N GRL+ FY++IAG+GV
Sbjct  471  RSLANSLFPLSFAASHYLTSLLVTTVHKFSGGKDKPDWLDNDLNKGRLDYFYYMIAGLGV  530

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  531  VNLVYFWYCARSYQYKA  547



>emb|CDY25813.1| BnaA07g09690D [Brassica napus]
Length=568

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPAGS+ V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F 
Sbjct  362  MGPHFEIPAGSVSVISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFG  417

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            I++M  +  VE  RR  A    + +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  418  IVSMFTAAIVERVRRTQALK-MTQVSVFWLAWQLVLMGLSESFNYIGQIEFFNSQFPEHM  476

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+ NSL  +++  + Y++++LV TVHK +G   +PDWL++D+N GRL+ FY++IAG+GV
Sbjct  477  RSLANSLFPLSFAASHYLTSLLVTTVHKFSGGKDKPDWLDNDLNKGRLDYFYYMIAGLGV  536

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  537  VNLVYFWYCARSYQYKA  553



>gb|ADG38053.1| AT1G69870-like protein [Neslia paniculata]
Length=168

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = +2

Query  41   VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFVEIKRR  220
            V+SLLTI ++LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G VE  RR
Sbjct  2    VISLLTIGIVLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIVERMRR  61

Query  221  -----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNSLVSV  385
                 A    G +P+SV WL PQL++MG  EAFNI+GQIEF+N +FPE+M SI NSL S+
Sbjct  62   RRSISAGDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSL  121

Query  386  TWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            ++  + Y+S+ LV  VHK +G H RPDWLN ++NAG+L+ FY++IA
Sbjct  122  SFAGSSYLSSFLVTIVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIA  167



>gb|KEH19852.1| peptide/nitrate transporter [Medicago truncatula]
Length=587

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 129/197 (65%), Gaps = 5/197 (3%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+I AGS+ V+SL+ I + LPFYD+V+ P   K T+   G+T LQR+G+G   +ILA+ 
Sbjct  386  NFEIHAGSVTVISLIAIGIFLPFYDQVISPLLEKITKQEQGLTSLQRIGLGHGAAILAVV  445

Query  191  VSGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            V+G VE  RR  A     + G +P+SV WL PQ +++ F   F  +G  EF+NKE PE+M
Sbjct  446  VAGLVEKTRRDLAISMGDSNGVAPMSVMWLAPQFLLIAFCHIFGTVGHTEFFNKESPESM  505

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL+ +   V   +ST +VN VH  TG  G  DWL+ DIN GRLE FYF+IAG+ V
Sbjct  506  RSISNSLLCLNLSVGSNLSTFIVNIVHSYTGKQGEADWLDSDINKGRLEYFYFIIAGLAV  565

Query  536  VNLVYFMVVARRYRYKS  586
            +NL YF+  ARRY YKS
Sbjct  566  LNLCYFIFCARRYHYKS  582



>ref|XP_007153856.1| hypothetical protein PHAVU_003G070400g [Phaseolus vulgaris]
 gb|ESW25850.1| hypothetical protein PHAVU_003G070400g [Phaseolus vulgaris]
Length=591

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 133/202 (66%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+I  GS+ V+ L+ I ++LPFYDR++VP   K T+  GG+T LQR+G G AF  L
Sbjct  388  LGHNFEIHPGSVNVIMLVAIGIVLPFYDRIVVPALEKVTKQEGGLTTLQRIGFGHAFGFL  447

Query  182  AMAVSGFVEIKRR-----AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M VSG VEIKRR     + A+ G +P+SV WL PQ +++G    F  +G IEF+N E P
Sbjct  448  SMVVSGLVEIKRRELAISSGASDGVAPISVLWLAPQFILLGCCHVFATVGHIEFFNNESP  507

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E + S+ NSL+ +    A  VS+ +VN VH  TG  G+PDWL+ DIN GRLE FYFVI  
Sbjct  508  EGLRSVANSLLCLNLSAASNVSSFIVNIVHSFTGKQGQPDWLDGDINKGRLEYFYFVIGA  567

Query  527  MGVVNLVYFMVVARRYRYKSKV  592
              ++N++ F++ +R Y YK+ V
Sbjct  568  FCLLNMLCFILSSRSYHYKAFV  589



>ref|XP_009103122.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Brassica rapa]
Length=568

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPAGS+ V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F 
Sbjct  362  MGPHFEIPAGSVSVISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFG  417

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            I++M  +  VE  RR  A    + +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  418  IVSMFTAAIVERVRRTQALK-MTQVSVFWLAWQLVLMGLSESFNYIGQIEFFNSQFPEHM  476

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+ NSL+ +++  + Y++++LV TVHK +G   +PDWL++D+N GRL+  Y++IAG+GV
Sbjct  477  RSLANSLLPLSFAASHYLTSLLVTTVHKFSGGKDKPDWLDNDLNKGRLDYLYYMIAGLGV  536

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  537  VNLVYFWYCARSYQYKA  553



>ref|XP_010498968.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Camelina sativa]
Length=568

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F+IPA S+ V+S +TI + LP YDR+LVP   +        T+LQRMGIG+ F+IL
Sbjct  361  MGPHFEIPAASVVVISYITIGIWLPIYDRLLVPSLSRIQEF--RFTLLQRMGIGIIFAIL  418

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            +M  +GFVE  RR   +   +  SV WL   L++MG  E+FN +GQIEF+N +FPE+M S
Sbjct  419  SMFTAGFVEGVRRTR-DTAVTQTSVFWLAVPLILMGLCESFNFIGQIEFFNSQFPEHMRS  477

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            I NSL  +++  A Y+S++LV TVHK +G   +PDWLN D++ G+L+ +Y++IAG+GVVN
Sbjct  478  IANSLFPLSFAAANYLSSLLVTTVHKFSGTKDQPDWLNRDLDKGKLDYYYYMIAGLGVVN  537

Query  542  LVYFMVVARRYRYKS  586
            LVYF   AR Y+YK+
Sbjct  538  LVYFWYCARNYQYKA  552



>emb|CDY40280.1| BnaA07g09200D [Brassica napus]
Length=568

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 141/197 (72%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPAGS+ V+S +TI + LP YDRV+VP  W  ++ RV    T+LQRMGIG+ F 
Sbjct  362  MGPHFEIPAGSVSVISFITIGIWLPIYDRVIVPSLWRIRKFRV----TLLQRMGIGIVFG  417

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            I++M  +  VE  RR  A    + +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  418  IVSMFTAAIVERVRRTQALK-MTQMSVFWLAWQLVLMGLSESFNYIGQIEFFNSQFPEHM  476

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+ NSL  +++  + Y++++LV TVHK +G   +PDWL++D+N GRL+  Y++IAG+GV
Sbjct  477  RSLANSLFPLSFAASHYLTSLLVTTVHKFSGGKDKPDWLDNDLNKGRLDYLYYMIAGLGV  536

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   AR Y+YK+
Sbjct  537  VNLVYFWYCARSYQYKA  553



>ref|XP_010933709.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Elaeis guineensis]
Length=597

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 139/202 (69%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +FQIPA S+ V ++L + + +P YDR+LVP  R+ T   GG+T+LQRMGIG+  SI+AM 
Sbjct  372  KFQIPAASINVFAMLALTIWVPIYDRILVPQLRRITGRGGGLTLLQRMGIGIILSIIAMV  431

Query  191  VSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            +SG VE +RR+ A           GGA S +S  WL PQL+++G AEAFN++ QIEFY K
Sbjct  432  ISGLVEERRRSYALHRPNLGTTLTGGAISSMSSFWLVPQLVLLGVAEAFNLISQIEFYYK  491

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            EFPENM S+   L+      A Y+S  +V  VH+TTG +G+ +WL+ D+N GRLE FY++
Sbjct  492  EFPENMRSVAGGLLLSGIACANYLSGFMVTLVHRTTGHNGKENWLDGDLNKGRLEYFYYL  551

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA +GV+N + F+V A+ YRYK
Sbjct  552  IAIIGVLNFMVFIVCAKWYRYK  573



>ref|XP_010112576.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXC34211.1| putative peptide/nitrate transporter [Morus notabilis]
Length=588

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 132/202 (65%), Gaps = 10/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  V +++T+ + +P YDR+LVP  RK T +  GITILQR+G+GL  SI+AM +
Sbjct  366  FKIPAASYSVFTMITVTIWIPIYDRILVPRLRKYTGIDSGITILQRIGVGLVLSIVAMIL  425

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG +E KRR+ A           G  SPLS  W  PQL +MG +E F ++G IEFY K+F
Sbjct  426  SGLIEDKRRSLALSKPIGKEPRRGAISPLSGYWFVPQLAIMGLSEGFAVIGYIEFYYKQF  485

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM SIG S + +   ++ Y+S +LV+ +H TT      DW  DD+N G+L+ FY++IA
Sbjct  486  PENMRSIGGSFLFLGMAMSSYLSGLLVSIIHSTTSGSSMGDWFPDDLNKGKLDYFYYLIA  545

Query  524  GMGVVNLVYFMVVARRYRYKSK  589
             +GVVN  YF+V A+ Y+YK  
Sbjct  546  ALGVVNFAYFLVCAKWYKYKES  567



>ref|NP_174028.2| nitrate transporter 1.6 [Arabidopsis thaliana]
 sp|Q9LFX9.2|PTR13_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.12; Short=AtNPF2.12; 
AltName: Full=Nitrate transporter 1.6 [Arabidopsis thaliana]
 gb|ABX61048.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEE30777.1| nitrate transporter 1.6 [Arabidopsis thaliana]
Length=576

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 137/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + +P Y+ +LVP  W  ++ RV    T+LQRMGIG+ F+
Sbjct  358  MGPHFEIPAASITVISYITIGIWVPIYEHLLVPFLWRMRKFRV----TLLQRMGIGIVFA  413

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +GFVE  RR  A    + +SV WL   L++MG  E+FN +G IEF+N +FPE+M
Sbjct  414  ILSMFTAGFVEGVRRTRATE-MTQMSVFWLALPLILMGLCESFNFIGLIEFFNSQFPEHM  472

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G    PDWLN D++ G+L+ FY++IA +GV
Sbjct  473  RSIANSLFPLSFAAANYLSSLLVTTVHKVSGTKDHPDWLNKDLDRGKLDYFYYLIAVLGV  532

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   A RY+YK+
Sbjct  533  VNLVYFWYCAHRYQYKA  549



>ref|XP_002317993.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE96213.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=583

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  + S+L + + +P YDR++VPW  K T+  GGITILQ+MG+G+A  I+ M +
Sbjct  363  FKIPAASYAIFSMLGLTIWIPIYDRLIVPWLAKHTKKEGGITILQKMGVGMALGIVTMLI  422

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE +RRA A           N   S LS  WL PQL+++G +EAF I+ QIE Y K+
Sbjct  423  SGIVEERRRALAISSPIGVDSRSNVNVSSLSALWLAPQLILIGISEAFTIIAQIELYYKQ  482

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V   V+ Y+S  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  483  FPENMRSIGGSLSFVGVAVSSYLSAFLISMVHQITKKSACGDWLPEDLNKGRLDLFYYLV  542

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +GV+N+ YF+V A+ Y+YK
Sbjct  543  AALGVINMGYFIVCAKWYKYK  563



>ref|XP_002893357.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69616.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + +P Y+R+LVP  W  ++ R     T+LQRMGIG+ F+
Sbjct  319  MGPHFEIPAASIAVISYITIGIWVPIYERLLVPFLWRIRKFR----FTLLQRMGIGIVFA  374

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +G VE  RR  A    + +SV WL   L++MG  E+FN +GQIEF+N +FPE+M
Sbjct  375  ILSMFTAGIVEGVRRTRATE-MTQMSVFWLALPLILMGLCESFNFIGQIEFFNSQFPEHM  433

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G   +PDWLN D++ G+L+ FY++IA +GV
Sbjct  434  RSIANSLFPLSFAAANYLSSLLVTTVHKVSGTKDQPDWLNKDLDRGKLDYFYYLIACLGV  493

Query  536  VNLVYFMVVARRYRYKS  586
            +NL+YF   AR Y+YK+
Sbjct  494  INLMYFWYCARSYQYKA  510



>ref|XP_010552600.1| PREDICTED: putative protein NRT1/ PTR FAMILY 2.14 [Tarenaya hassleriana]
Length=547

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 133/194 (69%), Gaps = 1/194 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  +Q+PA  + V+SL+TI + +PFYD  LV    K T+  GG+T+LQ++GIG  FSI+A
Sbjct  354  GTSYQVPASCITVISLITIGIWIPFYDAFLVHPLEKLTKQEGGMTLLQKVGIGNIFSIIA  413

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M VSG +E  RR +A GG S LSV WL P  ++MGFA+ F  +G IEF+NK+ P  M SI
Sbjct  414  MLVSGVIEHMRRDSALGG-SELSVFWLAPPQILMGFAQVFTFVGLIEFFNKQVPTRMRSI  472

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNL  544
            GNSL+ +    +GYVS+M+VN VH  TG  G   WL DD+N  +L+ FYF +AG+  +NL
Sbjct  473  GNSLMWLALSASGYVSSMVVNVVHDVTGRDGGESWLTDDVNTSKLDYFYFFVAGVSTLNL  532

Query  545  VYFMVVARRYRYKS  586
            ++++  A RYRY++
Sbjct  533  IFYLFSAHRYRYRN  546



>emb|CDY28441.1| BnaC07g12690D [Brassica napus]
Length=568

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 140/197 (71%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPAGS+ V+S +TI + LP YDRVLVP  W  ++ R    +T+LQRMGIG+ F 
Sbjct  362  MGPHFEIPAGSVSVISFITIGIWLPIYDRVLVPSLWRIRKFR----LTLLQRMGIGIVFG  417

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            I++M  +  VE  RR  A    + +SV WL  QL++MG +E+FN +GQIEF+N +FPE+M
Sbjct  418  IMSMFTAAIVERVRRTQALK-MTQMSVFWLAWQLVLMGLSESFNYIGQIEFFNSQFPEHM  476

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S+ NSL  +++  + Y+ ++L+ TVHK +G   +PDWL++D++ GRL+ FY++IAG+GV
Sbjct  477  RSLANSLFPLSFAASHYLISLLLTTVHKFSGGKDKPDWLDNDLDKGRLDYFYYMIAGLGV  536

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF    R Y+YK+
Sbjct  537  VNLVYFWYCVRSYQYKA  553



>gb|AAF79856.1|AC000348_9 T7N9.14 [Arabidopsis thaliana]
Length=700

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 137/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFS  175
            +G  F+IPA S+ V+S +TI + +P Y+ +LVP  W  ++ RV    T+LQRMGIG+ F+
Sbjct  482  MGPHFEIPAASITVISYITIGIWVPIYEHLLVPFLWRMRKFRV----TLLQRMGIGIVFA  537

Query  176  ILAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            IL+M  +GFVE  RR  A    + +SV WL   L++MG  E+FN +G IEF+N +FPE+M
Sbjct  538  ILSMFTAGFVEGVRRTRATE-MTQMSVFWLALPLILMGLCESFNFIGLIEFFNSQFPEHM  596

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI NSL  +++  A Y+S++LV TVHK +G    PDWLN D++ G+L+ FY++IA +GV
Sbjct  597  RSIANSLFPLSFAAANYLSSLLVTTVHKVSGTKDHPDWLNKDLDRGKLDYFYYLIAVLGV  656

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF   A RY+YK+
Sbjct  657  VNLVYFWYCAHRYQYKA  673



>ref|XP_010932898.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=590

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 139/202 (69%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +F+IPA S  V ++L + + +P YDR+++PW R+ T   GG T+LQRMGIG+  SI+AM 
Sbjct  369  KFEIPAASFNVFAMLALTIWIPIYDRIVLPWLRRITGKEGGFTLLQRMGIGIFLSIVAMV  428

Query  191  VSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VSG VE +RR+ A           +G  S LS  WL PQL+++GFAEAFN++GQ+EFY K
Sbjct  429  VSGLVEERRRSYAIHRPTLGVVSSSGAISSLSSFWLVPQLVILGFAEAFNVIGQVEFYYK  488

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM SI   L+      A Y+S  +V  VH+TTG +GR +WL  D+N  RL+ FY++
Sbjct  489  QFPENMRSIAGGLLFCGLACANYLSGFMVTIVHRTTGHNGRDNWLASDLNKARLDYFYYL  548

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA +GV++L+ F+V+AR YRYK
Sbjct  549  IALIGVIDLMVFIVLARWYRYK  570



>ref|XP_008807862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=595

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 136/203 (67%), Gaps = 12/203 (6%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +FQIPA S+ V ++L + + +P YDR+LVP  R+ T   GG+T+LQRMG+G+  SI+AM 
Sbjct  369  KFQIPAASITVFAMLALTIWVPIYDRILVPRLRRITGREGGLTLLQRMGVGIILSIVAMI  428

Query  191  VSGFVEIKRRAAA------------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYN  334
            +SGFVE +RR+ A             G  S +S  WL PQL+++G AEAFN++ QIEFY 
Sbjct  429  ISGFVEERRRSYALRRPILGSTLPGAGAISSMSSFWLVPQLVLLGLAEAFNLISQIEFYY  488

Query  335  KEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYF  514
            KEFPENM S+   L+      A Y+S  +V  VH+ TG +G+ +WL  D+N GRL+ FYF
Sbjct  489  KEFPENMRSVAGGLLLSGIACANYLSGFMVTLVHRVTGHNGKENWLAGDLNRGRLDYFYF  548

Query  515  VIAGMGVVNLVYFMVVARRYRYK  583
            +IA +GV+N + F+V A+ YRYK
Sbjct  549  LIAIIGVLNFMVFIVCAKWYRYK  571



>ref|XP_004510061.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=583

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 127/196 (65%), Gaps = 5/196 (3%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+I AGS+ V+SL+ I + LPFYDRV+ P   K T+   G+T LQR+G+G    ILA+ V
Sbjct  384  FEIHAGSVTVISLIAIGIFLPFYDRVISPLLEKITKHEQGLTTLQRIGVGHVSGILAVVV  443

Query  194  SGFVEIKRRAAA-----NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
            +G VE KRR  A     + G SP+SV WL PQ + +     F  +G  EF+NKE P++M 
Sbjct  444  AGLVEKKRRDLAISMGDSNGVSPMSVMWLAPQFLFIACFHVFGTVGHTEFFNKESPDSMR  503

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
            SI NSL+ +   V   +ST +VN VH  TG  G  DWL++DIN GRLE FYF+IAG+ V+
Sbjct  504  SISNSLMCLNVSVGSNLSTFIVNIVHSYTGKQGEADWLDNDINKGRLEYFYFIIAGLAVL  563

Query  539  NLVYFMVVARRYRYKS  586
            N+ YF+  ARRY Y +
Sbjct  564  NMCYFIFFARRYSYNA  579



>ref|XP_009413298.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 136/199 (68%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    LGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  FQIPA S  V  +L +++ +P YDR++ P   + T+  GG+T+LQRMGIGL  S+
Sbjct  370  LGRSNFQIPAASFVVFPMLAMSLWIPIYDRIVAPRLERITKKEGGLTLLQRMGIGLVLSV  429

Query  179  LAMAVSGFVEIKRRAAA---NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
            + MA +G +E +RR+ A   +   SP S  WL P L+++G +EAFN++ Q+EFY K+FPE
Sbjct  430  VVMATAGVIEERRRSHALRHHQIVSPFSSLWLIPPLIILGVSEAFNVISQVEFYYKQFPE  489

Query  350  NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
            NM SI  SL+   + + GY+S+++V  VH++TG     +WL +D+N G+L+ FYF IA +
Sbjct  490  NMRSIAGSLLFCGFALGGYLSSLMVTVVHRSTGRGQSKNWLAEDLNKGKLDLFYFSIAVL  549

Query  530  GVVNLVYFMVVARRYRYKS  586
            GV+N +YF   A+ YRYK+
Sbjct  550  GVLNFIYFAACAKWYRYKA  568



>ref|XP_002517462.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45004.1| nitrate transporter, putative [Ricinus communis]
Length=625

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 132/203 (65%), Gaps = 11/203 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA S+ V S+LT+ + +P YDR++VP+ RK T   GGITILQRMGIG+ FSI+ M V
Sbjct  409  FQIPAASIIVFSMLTLTIFIPIYDRIIVPFLRKMTGKDGGITILQRMGIGIIFSIITMIV  468

Query  194  SGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE +RR           +  GGA S +S  WL PQL + G  EA N +GQ EFY K+
Sbjct  469  SGLVEERRRHWALTRATLGLSEKGGAISSMSALWLIPQLALAGLTEALNSVGQTEFYYKQ  528

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S   +    + Y+S++LV+ VH  T      +WL +D+N GRL+ FY++I
Sbjct  529  FPENMRSIAGSFFYLGLAGSFYLSSLLVSIVHSVTRKSDGNNWLAEDLNKGRLDLFYYMI  588

Query  521  AGMGVVNLVYFMVVARRYRYKSK  589
            A +GV+N  YF+V A+ YRYK K
Sbjct  589  AVLGVINFGYFLVFAKWYRYKGK  611



>ref|XP_010933657.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Elaeis guineensis]
 ref|XP_010933665.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Elaeis guineensis]
Length=614

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 138/201 (69%), Gaps = 13/201 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG RFQIP+ S+ +V+LL + + +P YD++ VP AR+ T +  GIT+LQR G G+  + L
Sbjct  390  LGPRFQIPSASVPIVALLALTLFIPIYDQLFVPLARRFTGIESGITLLQRQGAGIVMAAL  449

Query  182  AMAVSGFVEIKRR--AAANGG---ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE KRR  A A+GG   +SPLS AWL PQL++MG AEAFN +GQ+EFYN++FP
Sbjct  450  SMVVAGVVERKRRDSAVAHGGLYGSSPLSAAWLVPQLVLMGVAEAFNAIGQVEFYNRQFP  509

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDD--INAGRLENFYFVI  520
            E+M +I  +  + +   A Y+S +LV+ V K T       WL DD  +NA RL+ FY++I
Sbjct  510  EHMQTIAAAFFTCSLAGASYLSAILVSAVRKYT------SWLEDDNNMNADRLDYFYYLI  563

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A + VVN +YF+V A  YRYK
Sbjct  564  AVLEVVNTLYFLVAAHFYRYK  584



>ref|XP_002517463.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45005.1| nitrate transporter, putative [Ricinus communis]
Length=532

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 136/202 (67%), Gaps = 13/202 (6%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S+ V S+LT+ + +PFYDR++VP+ RK T   GGITILQRMGIG+  SI+ M V
Sbjct  316  FEIPAASIIVFSMLTLTLFIPFYDRIIVPFLRKLTGKEGGITILQRMGIGVVLSIVTMVV  375

Query  194  SGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG +E +RR           +  GGA S +S  WL  QL + G  EA N +GQ EFY K+
Sbjct  376  SGLIEERRRHWALTRPAIGISPKGGAISSMSALWLIFQLALAGLTEALNSVGQTEFYYKQ  435

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHK-TTGVHGRPDWLNDDINAGRLENFYFV  517
            FPENM SI  S   +    + Y+S++LV+ VH  T G +GR DWL +D+N GRL+ FY++
Sbjct  436  FPENMRSIAGSFFYLGLAGSFYLSSILVSIVHHVTAGSNGR-DWLAEDLNKGRLDYFYYM  494

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA +GVVN VYF+VVA+ Y+YK
Sbjct  495  IAVLGVVNFVYFLVVAKWYKYK  516



>ref|XP_010256190.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Nelumbo nucifera]
Length=591

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 134/204 (66%), Gaps = 11/204 (5%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  F++PA S  V ++L++ + LP YDR++VP  R+ T   GGIT+LQRMGIG+A S+L 
Sbjct  362  GSNFRVPAASYIVFAMLSLTLWLPIYDRIIVPVLRRFTGKEGGITLLQRMGIGMALSVLT  421

Query  185  MAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            M VS  VE +RR+AA           GGA S +S  WL PQL + G +EAF+ +GQIEFY
Sbjct  422  MVVSALVEERRRSAALTRPTLGTAPGGGAISSMSGLWLVPQLTLAGLSEAFDSIGQIEFY  481

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             K+FPENM SI  S+      ++ Y++  LV+ VHKTT      +WL +D+N GRL+ FY
Sbjct  482  YKQFPENMRSIAGSMFFCVMAMSSYLNGFLVSVVHKTTAGAATGNWLPEDLNKGRLDYFY  541

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            ++IA +G +N  YF++ AR YRYK
Sbjct  542  YMIAALGTLNFGYFLLCARWYRYK  565



>ref|XP_002442576.1| hypothetical protein SORBIDRAFT_08g022290 [Sorghum bicolor]
 gb|EES16414.1| hypothetical protein SORBIDRAFT_08g022290 [Sorghum bicolor]
Length=597

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 131/195 (67%), Gaps = 6/195 (3%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  FQIPAGS  V ++L + + LPFYD VLVP  ++ T+  GGIT LQR+G+G+  SI+ 
Sbjct  382  GGSFQIPAGSFVVFNMLALTLWLPFYDGVLVPAMQRVTKREGGITQLQRIGVGIVLSIVT  441

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M V+  VE  RR   +      S   L PQ M+ G +EAF I+GQ+EFY K+FPENM S+
Sbjct  442  MLVAAAVERHRRRVGDA----TSCFLLVPQQMLAGLSEAFAIIGQVEFYYKQFPENMRSV  497

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTT--GVHGRPDWLNDDINAGRLENFYFVIAGMGVV  538
              +L+S+ + +A Y S ++V+ VH+TT  G  GRPDWL  D+N GR++ +Y +IA M  V
Sbjct  498  AGALLSLGFAIASYASGLMVSVVHRTTGGGRDGRPDWLAQDLNQGRVDLYYLLIAAMAAV  557

Query  539  NLVYFMVVARRYRYK  583
            NLVYF+V AR YR+K
Sbjct  558  NLVYFVVCARWYRFK  572



>ref|XP_002517461.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45003.1| nitrate transporter, putative [Ricinus communis]
Length=582

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 135/205 (66%), Gaps = 16/205 (8%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++PA S+ V S+LT+ + +P YDR+LVP+ RK T   GGITILQRMGIG+ FSI+ M V
Sbjct  367  FEVPAASIIVFSMLTLTIFIPIYDRMLVPFLRKLTGKEGGITILQRMGIGIIFSIVTMIV  426

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG VE +RR  A           G  S +S  WL PQL + G  EA N +GQ EFY K+F
Sbjct  427  SGLVEERRRHLALTGSAQGVSPRGAISSMSALWLIPQLALAGLTEALNSVGQTEFYYKQF  486

Query  344  PENMNSIGNSLVSVTWGVAG--YVSTMLVNTVHK-TTGVHGRPDWLNDDINAGRLENFYF  514
            PENM SI  S   +  G+AG  Y+S++LV+ VH  T G  GR DWL +D+N GRL+ FY+
Sbjct  487  PENMRSIAGSFFYL--GLAGSFYLSSILVSIVHHVTAGSSGR-DWLAEDLNKGRLDLFYY  543

Query  515  VIAGMGVVNLVYFMVVARRYRYKSK  589
            +IA +G +N  YF+V ++ YRYK K
Sbjct  544  MIAVLGTLNFGYFLVFSKWYRYKGK  568



>ref|XP_006367063.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Solanum tuberosum]
Length=585

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 133/204 (65%), Gaps = 11/204 (5%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
              +F+IPA S  V S+L++++ +P YDR++VP+ RK T+   GIT+LQ+MGIGL  ++L 
Sbjct  360  ASKFKIPAASYSVFSMLSLSIWIPIYDRIIVPFLRKITKKEAGITVLQKMGIGLVIAVLT  419

Query  185  MAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            M VS  VE +RR  A            GG S +S  WL PQL + G +EAF I+ Q+EF+
Sbjct  420  MLVSAVVETRRRDIALRHPTLGIEPRRGGISAMSANWLIPQLALAGLSEAFTIIAQVEFF  479

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             K+FPENM S   S +   + +A Y+S++L+  VHKTT +    +WL +D+N GRL+ FY
Sbjct  480  YKQFPENMRSFAGSFLFCGFALANYMSSLLITIVHKTTRISDTENWLAEDLNKGRLDYFY  539

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            +++A + V++  YF++ A+ Y+YK
Sbjct  540  YLVAALEVLDFGYFLICAKWYKYK  563



>ref|XP_008796643.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X1 [Phoenix 
dactylifera]
Length=595

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 136/202 (67%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +F+IPA S  V ++L + + +P YDR+LVPW R+ T   GG T+LQRMGIG+  S++AM 
Sbjct  373  KFEIPAASFNVFAMLALTIWIPVYDRILVPWLRRVTGREGGFTLLQRMGIGIVLSVVAMI  432

Query  191  VSGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            V+  VE +RR+          A +GGA S +S  WL PQL+++G AEAFN++GQ+EFY K
Sbjct  433  VARLVEERRRSYALHRPALGIAPSGGAISSMSSFWLVPQLVLLGLAEAFNMIGQVEFYYK  492

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM S+   L+      A Y+S  +V  VH+TTG HG+ DWL  D+N GRL+ FYF+
Sbjct  493  QFPENMRSLAGGLLFCGLACANYLSGFMVTVVHRTTGRHGKDDWLASDLNQGRLDYFYFL  552

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA +GV N ++F+  A  YRYK
Sbjct  553  IAFIGVFNFIFFIAFASWYRYK  574



>ref|XP_011087208.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Sesamum indicum]
Length=580

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 129/196 (66%), Gaps = 5/196 (3%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +FQIPA S  V ++L +A  +P YDR+ VP+AR+ T+  GGITILQRMG+GL  +I+   
Sbjct  364  KFQIPAASYVVFAMLGLAFWVPIYDRLFVPFARRITKKEGGITILQRMGVGLFITIIESL  423

Query  191  VSGFVEIKRRAAANGGASPLSVA-----WLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            V   VE +RRA A  G  P++V+     WL PQL + G AEAFN +GQ+EFY K+FPENM
Sbjct  424  VGAIVEERRRALALAGPEPVAVSPMSGMWLVPQLALGGLAEAFNAIGQLEFYYKQFPENM  483

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             S G +       ++ YV + L++ VH+TT    + +WL +D+N GRL+ FY++IA +  
Sbjct  484  RSFGGAFFFCGNALSSYVYSFLISVVHQTTEGSSKGNWLPEDLNKGRLDYFYYLIAALCA  543

Query  536  VNLVYFMVVARRYRYK  583
            +N  YF+V A  YRYK
Sbjct  544  LNFCYFLVCAHWYRYK  559



>ref|XP_004236178.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Solanum lycopersicum]
Length=585

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 133/204 (65%), Gaps = 11/204 (5%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  F+IPA S  V S+L++++ +P YDR++VP+ RK T+   GIT+LQ+MGIGL  ++L 
Sbjct  360  GSEFKIPAASYSVFSMLSLSIWIPIYDRIIVPFLRKITKKEAGITVLQKMGIGLVIAVLT  419

Query  185  MAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            M VS  VE +RR  A            GG S +S  WL PQL + G +EAF I+ Q+EF+
Sbjct  420  MLVSAVVETRRRDIALRHPTLGIEPRRGGISAMSANWLIPQLALAGLSEAFTIIAQVEFF  479

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             K+FPENM S   S +   + +A Y+S++L+  VHKTT +    +WL +D+N G+L+ FY
Sbjct  480  YKQFPENMRSFAGSFLFCGFALANYMSSLLITIVHKTTRISDTENWLAEDLNKGKLDYFY  539

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            +++A + V++  YF++ A+ Y+YK
Sbjct  540  YLVAALEVLDFGYFLLCAKWYKYK  563



>ref|XP_009105658.1| PREDICTED: putative protein NRT1/ PTR FAMILY 2.14 [Brassica rapa]
Length=551

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 130/195 (67%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  + IP  S+ V+SLLTI + LPFY+ VLV      T+  GGI++LQ++GIG  FSIL
Sbjct  357  LGSSYLIPPASITVISLLTIGIWLPFYETVLVRHIEYITKQEGGISLLQKVGIGNFFSIL  416

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
             M +SG +E +RR  +  G S  SV WL PQ ++MGF E F I+G  EF+NK+ P NM S
Sbjct  417  TMIISGILERERRDLSRAGVSR-SVFWLAPQQVLMGFYEVFTIVGLTEFFNKQVPGNMRS  475

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            IGNSL+ +    A Y+S+  V+TVH  T   GR  WL DDI+ G+L+ FY+ IA +  +N
Sbjct  476  IGNSLLYLGMSFASYLSSATVSTVHSVTARGGRQSWLTDDIDTGKLDYFYYFIAALSTLN  535

Query  542  LVYFMVVARRYRYKS  586
            L++F+  A+RYRY++
Sbjct  536  LIFFLCCAQRYRYRN  550



>gb|EAZ28180.1| hypothetical protein OsJ_12153 [Oryza sativa Japonica Group]
Length=460

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 132/205 (64%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LGR FQIPA S  V ++L   + +P YDR+LVP  R+ T    G+T+LQR GIG+A S +
Sbjct  253  LGRSFQIPAASFTVFAMLAQTLWIPIYDRLLVPRLRRVTGKDEGLTLLQRQGIGIALSTV  312

Query  182  AMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM +S  VE +RR  A           GGA S +S  W+ PQLMV+G +EAFN++ QIEF
Sbjct  313  AMVMSAVVEDRRRHIALTQPTLGTTITGGAISAMSSLWMVPQLMVLGLSEAFNLISQIEF  372

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  LV  VH+TTG     +WL  D+N GRL+ F
Sbjct  373  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTGAGS--NWLAQDLNKGRLDLF  430

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+G+ N++YFM+ A+ YR+K
Sbjct  431  YWMIAGIGIFNIIYFMICAKWYRFK  455



>ref|XP_006373301.1| hypothetical protein POPTR_0017s11320g [Populus trichocarpa]
 gb|ERP51098.1| hypothetical protein POPTR_0017s11320g [Populus trichocarpa]
Length=598

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 130/206 (63%), Gaps = 11/206 (5%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++PA +  + +++T+ + +P YDR++VP+ ++ T   GG+T+LQRMGIG+  ++L
Sbjct  375  LGTSFEVPAATYVIFTMITLTIWIPLYDRIIVPFLQRLTGKEGGLTLLQRMGIGMVLAML  434

Query  182  AMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
               VSG VE KRR  A           GGA S LS  WL PQL + G +E FN + QIEF
Sbjct  435  CTIVSGLVEEKRRHIALTRPTIGITSKGGAISSLSAMWLIPQLSLSGLSEGFNYIAQIEF  494

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y K+FPENM SI  S       ++ Y+S  LV  VH+ T      DWL+DD+N G+L+ F
Sbjct  495  YYKQFPENMRSIAGSSFFAGIAISNYLSGFLVTIVHRITSGSKSGDWLDDDLNKGKLDCF  554

Query  509  YFVIAGMGVVNLVYFMVVARRYRYKS  586
            Y+VI G+G++N  YF++ A+ Y+YK 
Sbjct  555  YYVIVGLGILNFCYFLLCAKWYKYKD  580



>ref|XP_002317995.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE96215.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=607

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F IPA S  V  +L++++ +P YDR+LVP+ R+ T    GITILQR+G+G+  +I+ M V
Sbjct  390  FAIPAASYIVFLMLSMSIFIPIYDRILVPFLRRITGKEAGITILQRIGVGIFLTIVTMLV  449

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE KRR  A            G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  450  SGLVEEKRRTIALTKPTLGNAPRKGAISSMSALWLIPQLSLSGIAEAFGSIGQVEFYYKQ  509

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL       + Y S++L+  VH+TT      +WL++D+N GRL+ +Y++I
Sbjct  510  FPENMRSIGGSLFYCGMAASSYFSSLLITVVHQTTNGAATGNWLSEDLNKGRLDYYYYMI  569

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +GV+N+ YF++ AR Y+YK
Sbjct  570  AALGVLNMGYFLLCARWYKYK  590



>ref|XP_002517459.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45001.1| nitrate transporter, putative [Ricinus communis]
Length=615

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 132/203 (65%), Gaps = 16/203 (8%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++P  S  V ++LT+ + +P YDR++VP  RK T   GGI+ILQRMGIG+ FSIL M V
Sbjct  400  FEVPGASFIVFAMLTLTIFIPIYDRIIVPSLRKITGKEGGISILQRMGIGIIFSILTMIV  459

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG VE +RR  A           G  S +S  WL PQL + G  EA N +GQ EFY K+F
Sbjct  460  SGLVEERRRRMAITGSTIGVSPRGAISSMSALWLLPQLALAGLTEALNSVGQTEFYYKQF  519

Query  344  PENMNSIGNSLVSVTWGVAG--YVSTMLVNTVHK-TTGVHGRPDWLNDDINAGRLENFYF  514
            PENM SI  S   +  G+AG  Y+S++LV+ VH  T G +GR DWL +D+N GRL+ FY+
Sbjct  520  PENMRSIAGSFFYL--GLAGSFYLSSILVSIVHHATAGSNGR-DWLAEDLNKGRLDYFYY  576

Query  515  VIAGMGVVNLVYFMVVARRYRYK  583
            +IA +G +N  YF+V A+ YRYK
Sbjct  577  MIAVLGALNFCYFLVFAKYYRYK  599



>gb|ADE76434.1| unknown [Picea sitchensis]
Length=629

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 130/196 (66%), Gaps = 8/196 (4%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPAGS  V SLL +   LPFY+RV+VP AR+ T+   GIT+ QRMGIG + S L+M V
Sbjct  409  FQIPAGSFSVFSLLVLIAWLPFYERVVVPIARRITKDNRGITMFQRMGIGFSISALSMLV  468

Query  194  SGFVEIKRR--AAANGGAS------PLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
            +G VE+KRR  A ++G A       P+S  WL PQ  ++G  EAF+ +G +EF+  +FP 
Sbjct  469  AGLVEVKRRNTALSHGLADQPSAIVPISALWLLPQFCIVGLGEAFHTIGNMEFFYDQFPA  528

Query  350  NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
             M S   ++ S T  +  Y+S ++V  VH TTG  GRPDWL+D++N G LE FY++++ M
Sbjct  529  TMRSTAIAMSSCTSALGHYLSAIIVTVVHNTTGRDGRPDWLDDNLNRGHLEYFYWLLSTM  588

Query  530  GVVNLVYFMVVARRYR  577
              +NL+YF+V AR Y+
Sbjct  589  EALNLIYFVVCARWYK  604



>ref|XP_002443661.1| hypothetical protein SORBIDRAFT_08g023060 [Sorghum bicolor]
 gb|EES17499.1| hypothetical protein SORBIDRAFT_08g023060 [Sorghum bicolor]
Length=566

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 128/194 (66%), Gaps = 5/194 (3%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  FQIPAGS  V ++L + + LPFYD VLVP  ++ T+  GGIT LQR+G+G+  SI+ 
Sbjct  355  GSSFQIPAGSFVVFNMLALTLWLPFYDGVLVPAMQRVTKREGGITQLQRIGVGIVLSIVT  414

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M V+  VE  RR   +      S   L PQ M+ G +EAF ++GQ++FY K+FPENM S+
Sbjct  415  MLVAAAVERHRRRVGDA----TSCFLLVPQQMLAGLSEAFAVIGQVDFYYKQFPENMRSV  470

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
              +L+ + + +A Y S ++V  VH TT G  GRPDWL  D+N GR++ FY +IA M  VN
Sbjct  471  AGALLFLGFAIASYASGLMVTVVHHTTGGSDGRPDWLAQDLNKGRVDLFYLLIAAMAAVN  530

Query  542  LVYFMVVARRYRYK  583
            LVYF+V AR YR+K
Sbjct  531  LVYFVVCARWYRFK  544



>ref|XP_011464561.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.10-like 
[Fragaria vesca subsp. vesca]
Length=604

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 134/204 (66%), Gaps = 11/204 (5%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  F IPA +  V S+ ++ + +PFYDRV+VP  RK T +  GIT+LQ+M +G+   I+ 
Sbjct  379  GTSFDIPAATYIVFSMASLTLWIPFYDRVIVPKLRKVTGIEDGITLLQKMAVGMVLXIVT  438

Query  185  MAVSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYN  334
            M VS  VE+KR+  A           G  S +S  WL PQL ++G AEAF I+ Q+EFY 
Sbjct  439  MLVSALVEVKRKXLALSSPIGMDTRTGAISSMSAFWLIPQLTIIGLAEAFTIISQVEFYY  498

Query  335  KEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGR-PDWLNDDINAGRLENFY  511
            K+FPENM SIG + + V +  + Y+++ LV+ VH TT  +G   DWL +D+N G+L+ FY
Sbjct  499  KQFPENMRSIGAAFLFVGFAGSNYLNSFLVSIVHHTTSRNGSIGDWLPEDLNKGKLDYFY  558

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            +++AG+  +NLVYF++VAR ++YK
Sbjct  559  YLVAGLEFINLVYFVLVARWFKYK  582



>ref|XP_004982146.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Setaria italica]
Length=465

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 131/206 (64%), Gaps = 14/206 (7%)
 Frame = +2

Query  2    LGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  F+IPA S  V ++L   + +P YDR+L+P  RK T    G T+LQR GIG+A S 
Sbjct  258  LGRGSFEIPAASFTVFAMLAQTLWIPLYDRILLPKLRKMTGKEEGFTLLQRQGIGIALST  317

Query  179  LAMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            +AM +S  VE +RRA A            G  S +S  W+ PQLM++G +EAFN++ QIE
Sbjct  318  VAMVISAIVEDRRRAIALSQPTLGKTMMGGDISAMSSLWMVPQLMILGLSEAFNLISQIE  377

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY KE PE+M S+  +L      +  Y+S  LV  VH+TTG  GR +WL  D+N GRL+ 
Sbjct  378  FYYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGR-NWLAQDLNKGRLDL  435

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY+ IAG+GV NL+YF++ AR YR+K
Sbjct  436  FYWTIAGIGVFNLIYFLICARWYRFK  461



>ref|XP_011042616.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Populus euphratica]
Length=607

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F IPA S  V  +L++++ +P YDR+LVP+ R+ T    GITILQR+GIG+  +I+ M V
Sbjct  390  FAIPAASYIVFLMLSMSIFIPIYDRILVPFLRRITGKESGITILQRIGIGIFLTIVTMLV  449

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE KRR           A   G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  450  SGLVEGKRRNIALTKPTLGNAPRKGAISSMSALWLIPQLSLSGIAEAFGSIGQVEFYYKQ  509

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL       + Y S++L+  VH+TT      +WL++D+N GRL+ +Y++I
Sbjct  510  FPENMRSIGGSLFYCGIAASSYFSSLLITVVHQTTKGAATGNWLSEDLNKGRLDYYYYMI  569

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +GV+N+ YF++ AR Y+YK
Sbjct  570  AALGVLNMGYFLLCARWYKYK  590



>emb|CDY38766.1| BnaA07g28380D [Brassica napus]
Length=551

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 129/194 (66%), Gaps = 1/194 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  + IP  S+ V+SLLTI + LPFY+ VLV      T+  GGI++LQ++GIG  FSIL 
Sbjct  358  GSSYLIPPASITVISLLTIGIWLPFYETVLVRHIEYITKQEGGISLLQKVGIGNFFSILT  417

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M +SG +E +RR  +  G S  SV WL PQ ++MGF E F I+G  EF+NK+ P NM SI
Sbjct  418  MIISGILERERRDLSRAGVSR-SVFWLAPQQVLMGFYEVFTIVGLTEFFNKQVPGNMRSI  476

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNL  544
            GNSL+ +    A Y+S+  V+TVH  T   GR  WL DDI+ G+L+ FY+ IA +  +NL
Sbjct  477  GNSLLYLGMSFASYLSSATVSTVHSVTARGGRQSWLTDDIDTGKLDYFYYFIAALSTLNL  536

Query  545  VYFMVVARRYRYKS  586
            ++F+  A+RYRY++
Sbjct  537  IFFLCCAQRYRYRN  550



>ref|XP_010678901.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Beta vulgaris 
subsp. vulgaris]
Length=596

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQ+PA S  +  +L + + L  YDRVLVP  ++ T    GITILQRMG G++FS+L+M V
Sbjct  375  FQVPAASYVIFFMLAVTLCLAIYDRVLVPLLQRITGKECGITILQRMGTGISFSVLSMIV  434

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE KRR  A            G  S +S  WL PQL + G  EAF  +GQ+EFY KE
Sbjct  435  SALVEHKRRTIALTRPTLGHLPRKGSISSMSALWLIPQLTIAGIGEAFMAVGQMEFYYKE  494

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL   +  ++ Y+S+ LV  VH+ T   G+ +WL+DD+N GRL+ FY+++
Sbjct  495  FPENMRSIGGSLYYCSIAMSSYLSSFLVTAVHQLTEKGGKQNWLSDDLNKGRLDYFYYLL  554

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            A +  +N  YF+ V+  Y+YK 
Sbjct  555  AALSTLNFAYFLTVSMWYKYKD  576



>gb|AES91176.2| peptide/nitrate transporter [Medicago truncatula]
Length=601

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 129/201 (64%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + ++L++ + LP YDR +VP  RK T   GGIT+LQRMG+G+  +IL M 
Sbjct  373  NFKIPAASYTIFTMLSLTIWLPIYDRKIVPTMRKLTGKEGGITLLQRMGVGMFIAILCML  432

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            VSG VE KRR  A          NG  S +S  WL PQL + GF++AF ++GQ+EFY K+
Sbjct  433  VSGVVEWKRRTMAINNPIGFEPRNGAISSMSGMWLIPQLALAGFSDAFTLVGQVEFYYKQ  492

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S+  SL      ++ Y S++L+  +H+ T      +WL  D+N GRL+ FY++I
Sbjct  493  FPENMRSLAGSLFFCGLALSSYFSSLLITIIHRLTVKSATGNWLPQDLNEGRLDYFYYMI  552

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVNL YF++ +R YRYK
Sbjct  553  TGLEVVNLGYFVLCSRWYRYK  573



>gb|KDP45469.1| hypothetical protein JCGZ_09718 [Jatropha curcas]
Length=590

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 128/203 (63%), Gaps = 11/203 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             FQIPA +  + +++T+ + +P YDR+LVP+ +K T   GG T+LQRMGIG+  +IL M 
Sbjct  367  NFQIPAATYIIFTMVTLTIWIPIYDRILVPFLQKITGKEGGFTLLQRMGIGIILAILCMV  426

Query  191  VSGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            +SG VE +RR           A  GGA S +S  WL PQL + G +E FN + Q+EFY K
Sbjct  427  ISGLVEGRRRNLSFDKQTLGIAPRGGAISSMSSMWLVPQLALAGLSEGFNYVAQVEFYYK  486

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM SI  S       +A Y+S  LV+T HK +      DWL++D+N G+L+ FY+V
Sbjct  487  QFPENMRSIAGSAFFAGLALANYLSGFLVSTTHKISSRSKNGDWLSEDLNKGKLDYFYYV  546

Query  518  IAGMGVVNLVYFMVVARRYRYKS  586
            I G+GV+N  YF+  A+ YRYK 
Sbjct  547  IGGLGVLNFAYFLFCAKWYRYKD  569



>gb|EEC75965.1| hypothetical protein OsI_13072 [Oryza sativa Indica Group]
Length=585

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 132/205 (64%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LGR FQIPA S  V ++L   + +P YDR+LVP  R+ T    G+T+LQR GIG+A S +
Sbjct  378  LGRSFQIPAASFTVFAMLAQTLWIPIYDRLLVPRLRRVTGKDEGLTLLQRQGIGIALSTV  437

Query  182  AMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM +S  VE +RR  A           GGA S +S  W+ PQLMV+G +EAFN++ QIEF
Sbjct  438  AMVMSAVVEDRRRHIALTQPTLGTTITGGAISAMSSLWMVPQLMVLGLSEAFNLISQIEF  497

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  LV  VH+TTG     +WL  D+N GRL+ F
Sbjct  498  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTGAGS--NWLAQDLNKGRLDLF  555

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+G+ N++YFM+ A+ YR+K
Sbjct  556  YWMIAGIGIFNIIYFMICAKWYRFK  580



>tpg|DAA50699.1| TPA: hypothetical protein ZEAMMB73_457708 [Zea mays]
Length=479

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 133/206 (65%), Gaps = 14/206 (7%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S 
Sbjct  272  LGRAGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALST  331

Query  179  LAMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            +AM +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIE
Sbjct  332  VAMVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIE  391

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ 
Sbjct  392  FYYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDL  449

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY+ IAG+GV N +YF++ AR YR+K
Sbjct  450  FYWTIAGIGVFNFIYFVICARWYRFK  475



>gb|AAT85061.1| nitrate transporter, putative [Oryza sativa Japonica Group]
 gb|ABF98263.1| POT family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG89436.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94017.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=587

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 132/205 (64%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LGR FQIPA S  V ++L   + +P YDR+LVP  R+ T    G+T+LQR GIG+A S +
Sbjct  380  LGRSFQIPAASFTVFAMLAQTLWIPIYDRLLVPRLRRVTGKDEGLTLLQRQGIGIALSTV  439

Query  182  AMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM +S  VE +RR  A           GGA S +S  W+ PQLMV+G +EAFN++ QIEF
Sbjct  440  AMVMSAVVEDRRRHIALTQPTLGTTITGGAISAMSSLWMVPQLMVLGLSEAFNLISQIEF  499

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  LV  VH+TTG     +WL  D+N GRL+ F
Sbjct  500  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTGAGS--NWLAQDLNKGRLDLF  557

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+G+ N++YFM+ A+ YR+K
Sbjct  558  YWMIAGIGIFNIIYFMICAKWYRFK  582



>ref|XP_003608979.1| Nitrate transporter NRT1-2 [Medicago truncatula]
Length=597

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 129/201 (64%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + ++L++ + LP YDR +VP  RK T   GGIT+LQRMG+G+  +IL M 
Sbjct  369  NFKIPAASYTIFTMLSLTIWLPIYDRKIVPTMRKLTGKEGGITLLQRMGVGMFIAILCML  428

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            VSG VE KRR  A          NG  S +S  WL PQL + GF++AF ++GQ+EFY K+
Sbjct  429  VSGVVEWKRRTMAINNPIGFEPRNGAISSMSGMWLIPQLALAGFSDAFTLVGQVEFYYKQ  488

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S+  SL      ++ Y S++L+  +H+ T      +WL  D+N GRL+ FY++I
Sbjct  489  FPENMRSLAGSLFFCGLALSSYFSSLLITIIHRLTVKSATGNWLPQDLNEGRLDYFYYMI  548

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVNL YF++ +R YRYK
Sbjct  549  TGLEVVNLGYFVLCSRWYRYK  569



>ref|XP_010546036.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Tarenaya hassleriana]
Length=601

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V +  YDR+LVP+ R+ T    GITILQRMGIG+AF++L+M V
Sbjct  383  FEIPAATYVVFLMTGMTVFIIIYDRLLVPFLRRFTGKDTGITILQRMGIGMAFAVLSMVV  442

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGF+E +RR  A            G  S  S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  443  SGFIEERRRTIALTKPTLGMAPRKGEISSFSGLWLIPQLTLAGIAEAFTAIGQMEFYYKQ  502

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  G++ Y+S+ L++TVHKTT      +WL +D+N GRL+ FY++I
Sbjct  503  FPENMRSFAGSIFYVGTGISSYLSSFLISTVHKTTVNTSTGNWLAEDLNKGRLDYFYYMI  562

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            AG+  V+  YF+V+A+ YRYK
Sbjct  563  AGILAVDFAYFLVMAKWYRYK  583



>ref|XP_002517444.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF44986.1| nitrate transporter, putative [Ricinus communis]
Length=589

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 127/202 (63%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++PA S  + S+LT+ + +P YDR+L+P  RK T   GGIT+LQRMGIG+  SIL M V
Sbjct  366  FKVPAASFIIFSMLTLTIWIPIYDRILMPLLRKLTGNEGGITLLQRMGIGIVLSILTMLV  425

Query  194  SGFVEIKRR----------AAANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE +RR           A  GGA S +S  WL PQL + G AE F+ +GQ+EFY ++
Sbjct  426  SALVEERRRHFALTRATLGVAPKGGAISSMSALWLVPQLALAGVAETFSTIGQVEFYYRQ  485

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S + +    + Y+S  L++ VH  T      DWL +D+N G+L+ FY++I
Sbjct  486  FPENMRSIAGSFLFLGLAGSSYLSGFLISIVHHVTARSQHGDWLAEDLNKGKLDCFYYMI  545

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            A +G +N  YF+V A+ YRYK 
Sbjct  546  AALGFLNFCYFLVFAKWYRYKD  567



>ref|XP_010550650.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Tarenaya hassleriana]
Length=603

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  V  +  + V +  YDR+ VP+ R+ T    GITILQRMG G+AF++++M V
Sbjct  380  FQIPAATYVVFLMTGMTVFIVIYDRLFVPFMRRLTGKDTGITILQRMGTGIAFAVVSMVV  439

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE +RR  A            G  S  S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  440  SGIVEERRRTIALTKPTLGMAPRKGAISSFSGLWLIPQLTIAGIAEAFMAIGQMEFYYKQ  499

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  G++GY+S+ L++TVHKTT      +WL +D+N GRL+ +YF+I
Sbjct  500  FPENMRSFAGSIFYVGTGISGYLSSFLISTVHKTTRKTPTGNWLAEDLNKGRLDYYYFMI  559

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            AG+  VN  YF+V+A+ YRYK
Sbjct  560  AGILAVNFAYFLVMAKWYRYK  580



>dbj|BAJ91042.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 127/205 (62%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+LVP  RK T    G+T+LQR GIG+A S +
Sbjct  259  LGSSFHVPAASFTVFAMLAQTLWIPIYDRLLVPRLRKVTGKDEGLTLLQRQGIGIALSTV  318

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM VS  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  319  AMIVSAVVEDRRRDIALNQPNIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  378

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  379  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHRTTG--AGQNWLAQDLNKGRLDLF  436

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  437  YWMIAGIGVFNFVYFMICARWYRFK  461



>gb|ACN27476.1| unknown [Zea mays]
 gb|ACN27986.1| unknown [Zea mays]
 gb|AFW67959.1| hypothetical protein ZEAMMB73_231055 [Zea mays]
Length=591

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 132/204 (65%), Gaps = 13/204 (6%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S +A
Sbjct  386  GAGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALSTVA  445

Query  185  MAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            M +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIEFY
Sbjct  446  MVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIEFY  505

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ FY
Sbjct  506  YKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDLFY  563

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            + IAG+GV NL+YF++ AR YR+K
Sbjct  564  WTIAGIGVFNLIYFVICARWYRFK  587



>ref|NP_001130360.1| uncharacterized protein LOC100191455 [Zea mays]
 gb|ACF78551.1| unknown [Zea mays]
Length=591

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 132/204 (65%), Gaps = 13/204 (6%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S +A
Sbjct  386  GAGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALSTVA  445

Query  185  MAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            M +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIEFY
Sbjct  446  MVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIEFY  505

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ FY
Sbjct  506  YKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDLFY  563

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            + IAG+GV NL+YF++ AR YR+K
Sbjct  564  WTIAGIGVFNLIYFVICARWYRFK  587



>ref|XP_011007525.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Populus euphratica]
Length=601

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 128/202 (63%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++PA +  + ++LT+ + +P YDR++VP+ +K T   GGIT+LQRMGIG+  +IL   V
Sbjct  382  FKVPAATYIIFTMLTLTIWIPLYDRIIVPFLQKLTGKDGGITLLQRMGIGMILAILCTVV  441

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE  RR  A            G  S +S  WL PQL + G +E FN + QIEFY K+
Sbjct  442  SGLVEENRRHIALTRPPLGLTNKGGSISSMSGMWLIPQLALSGLSEGFNYIAQIEFYYKQ  501

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S       ++ Y+S +LV+ VH+ T      DWL+DD+N G+L+ FY+VI
Sbjct  502  FPENMRSIAGSAFFAGGALSNYLSGVLVSIVHQITSGSKTGDWLDDDLNKGKLDYFYYVI  561

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            AG+G++N  YF++ A+ YRYK 
Sbjct  562  AGLGILNFGYFLLCAKWYRYKD  583



>gb|KDO76033.1| hypothetical protein CISIN_1g007827mg [Citrus sinensis]
Length=484

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S+L + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  263  HFKIPAASYAIFSMLGLTIWIPIYDRIIVPRLQRLTKKEGGITILQRMAIGMILAIFTMI  322

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR+ A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  323  ISGIIEDKRRSLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  382

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y++  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  383  FPENMRSIGGSLAFVGFAISNYLNGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  442

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  443  AALGLLNFGFFLLCAKWYKYK  463



>ref|NP_001130581.1| uncharacterized protein LOC100191680 [Zea mays]
 gb|ACF78856.1| unknown [Zea mays]
Length=513

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 133/206 (65%), Gaps = 14/206 (7%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S 
Sbjct  306  LGRAGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALST  365

Query  179  LAMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            +AM +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIE
Sbjct  366  VAMVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIE  425

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ 
Sbjct  426  FYYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDL  483

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY+ IAG+GV N +YF++ AR YR+K
Sbjct  484  FYWTIAGIGVFNFIYFVICARWYRFK  509



>dbj|BAB19759.1| putative nitrate transporter NRT1-4 [Glycine max]
Length=228

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG +FQIPAGS+ V+SL+TIA+ LPFYDR+LVP  RK T+  GGIT+L R+GIG+ FSIL
Sbjct  73   LGAKFQIPAGSVSVISLITIALWLPFYDRILVPKLRKMTKHEGGITLLLRIGIGMVFSIL  132

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G+VE  RR +AN      G +P+SV WL P L++MG  EAFNI+GQIEF+N++FP
Sbjct  133  SMVVAGYVEKVRRDSANSNPTPLGIAPMSVLWLAPHLILMGLCEAFNIIGQIEFFNRQFP  192

Query  347  ENMNSIGNSLVSVTWGVAGYVSTML  421
            E+M SIGNS  S ++GV+ YVS+++
Sbjct  193  EHMRSIGNSFFSCSFGVSSYVSSII  217



>ref|XP_010923295.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 135/202 (67%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +F+IPA S  V S+L + + +P YDR+LVPW R+ T    G T+LQRMGIG+  +++AM 
Sbjct  396  KFEIPAASFTVFSMLALTIWIPVYDRILVPWLRRATGKEAGFTLLQRMGIGIVLTVVAMV  455

Query  191  VSGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VSG VE +RR           A + G  S +S  WL PQL+++GFAEAFN++GQ+EFY K
Sbjct  456  VSGLVEGRRRSYALHRPALGIAPSGGTISSMSSFWLVPQLVLLGFAEAFNLIGQVEFYYK  515

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM S+   +       A Y+S  +V  +H+TTG +G+ +WL +D+N GRL+ FYF+
Sbjct  516  QFPENMRSLAGGVFFFGLACANYLSGFMVTVIHRTTGHNGKDNWLANDLNHGRLDYFYFL  575

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA M VVN V+F+V A  YRYK
Sbjct  576  IALMEVVNFVFFIVFANWYRYK  597



>gb|ADH21397.1| nitrate transporter [Citrus trifoliata]
Length=588

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S+L + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  367  HFKIPAASYAIFSMLGLTIWIPIYDRIIVPRLQRLTKKEGGITILQRMAIGMILAIFTMI  426

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR+ A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  427  ISGIIEDKRRSLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y+S  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  487  FPENMRSIGGSLTFVGFAISNYLSGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  546

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  547  AALGLLNFGFFLLCAKWYKYK  567



>ref|NP_173322.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9M9V7.1|PTR8_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.9; Short=AtNPF2.9; AltName: 
Full=Nitrate transporter 1.9 [Arabidopsis thaliana]
 gb|AAF27093.1|AC011809_2 Similar to peptide transport proteins [Arabidopsis thaliana]
 gb|AAL49811.1| putative peptide transporter protein [Arabidopsis thaliana]
 gb|AAM51383.1| putative peptide transporter protein [Arabidopsis thaliana]
 gb|AEE29776.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=587

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 126/207 (61%), Gaps = 11/207 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPAGS  V  +L + + +P YDRVLVP+ RK T   GGIT LQR+G GL   I +M V
Sbjct  366  FQIPAGSYTVFLMLGMTIFIPIYDRVLVPFLRKYTGRDGGITQLQRVGAGLFLCITSMMV  425

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE  RR  A            G  S +S  WL PQL++MG A+A   +GQ+EFY K+
Sbjct  426  SAIVEQYRRKVALTKPTLGLAPRKGAISSMSGMWLIPQLVLMGIADALAGVGQMEFYYKQ  485

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   SL     G+A Y+ST L++ VH TT       WL +D+N GRLE FYF++
Sbjct  486  FPENMRSFAGSLYYCGIGLASYLSTFLLSAVHDTTEGFSGGSWLPEDLNKGRLEYFYFLV  545

Query  521  AGMGVVNLVYFMVVARRYRYKSKVWVD  601
            AGM  +NL YF++V+  YRYK  V  D
Sbjct  546  AGMMTLNLAYFLLVSHWYRYKDVVAKD  572



>ref|XP_006838790.1| hypothetical protein AMTR_s00002p00259450 [Amborella trichopoda]
 gb|ERN01359.1| hypothetical protein AMTR_s00002p00259450 [Amborella trichopoda]
Length=560

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 123/193 (64%), Gaps = 0/193 (0%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            RF+IP GS  V S+L + + LP YDR+++PWAR+ T    GIT+LQRMG G+  +ILAM 
Sbjct  351  RFEIPPGSFNVFSMLMLTLWLPVYDRLVMPWARRATGKEEGITLLQRMGTGMVIAILAMV  410

Query  191  VSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGN  370
            V+G VE KRR  A      +S  WL PQ  + G +EA  ++GQIE Y K+FPENM S+  
Sbjct  411  VAGLVESKRRVLAITDQQAMSAFWLVPQFCLTGLSEALGVIGQIELYYKQFPENMRSVAG  470

Query  371  SLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVY  550
            SL  +    A Y+S ++V  VH  +G     +WL DD++ GRL+ FY+ I  M +VNLVY
Sbjct  471  SLFFLGMAGANYLSALMVAVVHSASGGGHGANWLPDDLDHGRLDYFYYTIGVMVLVNLVY  530

Query  551  FMVVARRYRYKSK  589
            F+  AR Y YK +
Sbjct  531  FLACARWYVYKGE  543



>ref|XP_002300021.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa]
 gb|EEE84826.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa]
Length=596

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 128/202 (63%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++PA +  + ++LT+ + +P YDR++VP+ ++ T   GGIT+LQRMGIG+  +IL   V
Sbjct  382  FKVPAATYIIFTMLTLTIWIPLYDRIIVPFLQRLTGKDGGITLLQRMGIGMILAILCTVV  441

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE  RR  A            G  S +S  WL PQL + G +E FN + QIEFY K+
Sbjct  442  SGLVEENRRHIALTRPPLGQTNKGGSISSMSGMWLIPQLALSGLSEGFNYIAQIEFYYKQ  501

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S       +A Y+S +LV+ VH+ T      DWL+DD+N G+L+ FY+VI
Sbjct  502  FPENMRSIAGSAFFAGGALANYLSGVLVSIVHQITSGSKTGDWLDDDLNKGKLDYFYYVI  561

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            AG+G++N  YF++ A+ YRYK 
Sbjct  562  AGLGILNFGYFLLCAKWYRYKD  583



>ref|XP_010923296.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X2 [Elaeis 
guineensis]
Length=593

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 135/202 (67%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +F+IPA S  V S+L + + +P YDR+LVPW R+ T    G T+LQRMGIG+  +++AM 
Sbjct  372  KFEIPAASFTVFSMLALTIWIPVYDRILVPWLRRATGKEAGFTLLQRMGIGIVLTVVAMV  431

Query  191  VSGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VSG VE +RR           A + G  S +S  WL PQL+++GFAEAFN++GQ+EFY K
Sbjct  432  VSGLVEGRRRSYALHRPALGIAPSGGTISSMSSFWLVPQLVLLGFAEAFNLIGQVEFYYK  491

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM S+   +       A Y+S  +V  +H+TTG +G+ +WL +D+N GRL+ FYF+
Sbjct  492  QFPENMRSLAGGVFFFGLACANYLSGFMVTVIHRTTGHNGKDNWLANDLNHGRLDYFYFL  551

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA M VVN V+F+V A  YRYK
Sbjct  552  IALMEVVNFVFFIVFANWYRYK  573



>ref|XP_002464068.1| hypothetical protein SORBIDRAFT_01g011700 [Sorghum bicolor]
 gb|EER91066.1| hypothetical protein SORBIDRAFT_01g011700 [Sorghum bicolor]
Length=593

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 134/206 (65%), Gaps = 14/206 (7%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S 
Sbjct  386  LGRGGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALST  445

Query  179  LAMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            +AM +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIE
Sbjct  446  VAMVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIE  505

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ 
Sbjct  506  FYYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDL  563

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY+ IAG+GV NL+YF++ AR YR+K
Sbjct  564  FYWTIAGIGVFNLIYFVICARWYRFK  589



>gb|KDO76032.1| hypothetical protein CISIN_1g007827mg [Citrus sinensis]
Length=532

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S+L + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  311  HFKIPAASYAIFSMLGLTIWIPIYDRIIVPRLQRLTKKEGGITILQRMAIGMILAIFTMI  370

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR+ A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  371  ISGIIEDKRRSLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  430

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y++  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  431  FPENMRSIGGSLAFVGFAISNYLNGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  490

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  491  AALGLLNFGFFLLCAKWYKYK  511



>ref|XP_006439661.1| hypothetical protein CICLE_v10019426mg [Citrus clementina]
 gb|ESR52901.1| hypothetical protein CICLE_v10019426mg [Citrus clementina]
Length=484

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 131/201 (65%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S++ + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  263  HFKIPAASYAIFSMIGLTIWIPIYDRIIVPKLQRLTKKEGGITILQRMAIGMILAIFTMI  322

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR  A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  323  ISGIIEDKRRYLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  382

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y+S  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  383  FPENMRSIGGSLTFVGFAISNYLSGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  442

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  443  AALGLLNFGFFLLCAKWYKYK  463



>ref|XP_008807860.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=601

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 134/201 (67%), Gaps = 13/201 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  FQIP+ S+ +V+LL + + +P YD+V +P AR+ T +  GIT+LQR G G+  S L
Sbjct  390  IGPHFQIPSASVPIVALLALTLFIPVYDQVFIPLARRLTGMESGITVLQRQGAGIVISAL  449

Query  182  AMAVSGFVEIKRR--AAANGG---ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR  A A+GG   +SPL  AWL PQL++MG AEAFN +GQ+EFYN++FP
Sbjct  450  SMVVAGLVERMRRNSAVAHGGLYGSSPLPAAWLAPQLVLMGIAEAFNAVGQVEFYNRQFP  509

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDD--INAGRLENFYFVI  520
            E+M ++  +L + +     Y+S +LV  V K T       WL DD  +NA RL+ FY++I
Sbjct  510  EHMQTMAGALFNCSLAGGSYLSAILVVAVRKYT------TWLKDDNNVNANRLDYFYYLI  563

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A  GVVN +YF+V A  YRYK
Sbjct  564  AVFGVVNTLYFLVAAHFYRYK  584



>emb|CDY11648.1| BnaC06g30910D [Brassica napus]
Length=551

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 128/194 (66%), Gaps = 1/194 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  + IP  S+ V+SLLTI + LPFY+ VLV      T+  GGI++LQ++GIG  FSIL 
Sbjct  358  GSSYLIPPASITVISLLTIGIWLPFYETVLVRHIEYITKQEGGISLLQKVGIGNFFSILT  417

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M +SG +E +RR  +  G S  SV WL PQ ++MGF E F I+G  EF+NK+ P  M SI
Sbjct  418  MIISGILERERRDLSRAGVSR-SVFWLAPQQVLMGFYEVFTIVGLTEFFNKQVPGYMRSI  476

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNL  544
            GNSL+ +    A Y+S+  V+TVH  T   GR  WL DDI+ G+L+ FY+ IA +  +NL
Sbjct  477  GNSLLYLGMSFASYLSSATVSTVHSVTARGGRQSWLTDDIDTGKLDYFYYFIAALSTLNL  536

Query  545  VYFMVVARRYRYKS  586
            ++F+  A+RYRY++
Sbjct  537  IFFLCCAKRYRYRN  550



>ref|XP_004508785.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
isoform X2 [Cicer arietinum]
Length=605

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 127/201 (63%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F IP  S +V  ++++A+ LP YDR +VP+ ++ TR  GGIT+LQRMGIG+ F+IL+M 
Sbjct  380  EFMIPGASYYVFLMISLAIWLPIYDRKVVPFLQRITRKEGGITLLQRMGIGIFFAILSML  439

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            VS  VE +RR  A           G  S +S  WL PQL + G AEAF  + QIEFY K+
Sbjct  440  VSAIVEERRRTLALTKPLEVETRKGAISSMSGLWLIPQLTLAGLAEAFMSVAQIEFYYKQ  499

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  SL       + Y+S+ML++ +H  T       WL +D+N GRL+NFY +I
Sbjct  500  FPENMRSIAGSLFYAAHAGSSYLSSMLISVIHHITARSETGSWLPEDLNKGRLDNFYLII  559

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A + +VNL YF++ A+ YRYK
Sbjct  560  AALEIVNLGYFVLCAQWYRYK  580



>gb|EYU35890.1| hypothetical protein MIMGU_mgv1a018347mg [Erythranthe guttata]
Length=287

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 123/194 (63%), Gaps = 4/194 (2%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIP  +  V S+LT+ + +P YDR  VP+ RK T   GGIT+LQR+GIG+A +++   +
Sbjct  87   FQIPPATYAVFSMLTLTLWVPLYDRAAVPFLRKLTGKPGGITVLQRIGIGIALTVVESLI  146

Query  194  SGFVEIKRRAAANGGA----SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
            S  VE +RR  A GG     S +S  WL PQL + G AEAF  +GQ+EF+ KEFPENM S
Sbjct  147  SAAVEQERRRRAPGGGAGAVSAMSAMWLVPQLSLAGLAEAFCAIGQVEFFYKEFPENMRS  206

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            +  S        A Y++  L++ VH+ T      +WL +D+N GRL+ FY+++AG+  +N
Sbjct  207  VAGSFFFCGMAAANYLNGFLISVVHRATEGSPAGNWLPEDLNKGRLDYFYYLVAGLCALN  266

Query  542  LVYFMVVARRYRYK  583
             VYF+V A+ Y YK
Sbjct  267  FVYFLVCAKWYSYK  280



>gb|KFK34096.1| hypothetical protein AALP_AA5G101400 [Arabis alpina]
Length=601

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V +  YDRVLVP  R+ TR+  GIT+LQRMG G+AF IL+  V
Sbjct  375  FKIPAATYVVFLMSGMTVFIIIYDRVLVPSLRRVTRLETGITLLQRMGSGMAFVILSSLV  434

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGF+E KRR  A            G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  435  SGFIEEKRRTIALTKPTLGMAPRAGEISSMSALWLIPQLSLAGVAEAFTAIGQMEFYYKQ  494

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   SL  V  GV+GY+++ L++TVH++T      +W+ +D+N GRL+ FYF++
Sbjct  495  FPENMRSFAGSLFYVGAGVSGYLASFLISTVHRSTEHSPSGNWVAEDLNKGRLDYFYFML  554

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+ YF+++A+ YRYK
Sbjct  555  TGIEVVNMGYFLLMAKWYRYK  575



>ref|XP_008796703.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=613

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 140/207 (68%), Gaps = 13/207 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F+IP+ S+ +V+LL +A+ +P YD++ VP AR+ + +  GI++LQR G+G+  +  
Sbjct  391  LGPGFEIPSASVPIVALLALALFIPIYDQIFVPVARRLSGMESGISLLQRQGVGIVIAAS  450

Query  182  AMAVSGFVEIKRRAAA--NGG---ASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
            +M V+G VE  RR AA  +GG   +SPLS AWL PQL++MG AEAFN +GQ+EFY+++FP
Sbjct  451  SMVVAGLVERMRRGAALADGGLHGSSPLSAAWLAPQLILMGAAEAFNGVGQVEFYSRQFP  510

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDD--INAGRLENFYFVI  520
            E+M +I  +    +     Y+S +LV  V K TG      WL DD  +NA RL+ FY++I
Sbjct  511  EHMQTIACAFFFCSLAGGSYLSAILVAAVRKYTG------WLKDDNNVNANRLDYFYYLI  564

Query  521  AGMGVVNLVYFMVVARRYRYKSKVWVD  601
            A +GVVN +YF+V AR YRYK  V V+
Sbjct  565  AVIGVVNTLYFLVAARFYRYKGAVEVE  591



>ref|XP_004508784.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
isoform X1 [Cicer arietinum]
Length=609

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 127/201 (63%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F IP  S +V  ++++A+ LP YDR +VP+ ++ TR  GGIT+LQRMGIG+ F+IL+M 
Sbjct  384  EFMIPGASYYVFLMISLAIWLPIYDRKVVPFLQRITRKEGGITLLQRMGIGIFFAILSML  443

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            VS  VE +RR  A           G  S +S  WL PQL + G AEAF  + QIEFY K+
Sbjct  444  VSAIVEERRRTLALTKPLEVETRKGAISSMSGLWLIPQLTLAGLAEAFMSVAQIEFYYKQ  503

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  SL       + Y+S+ML++ +H  T       WL +D+N GRL+NFY +I
Sbjct  504  FPENMRSIAGSLFYAAHAGSSYLSSMLISVIHHITARSETGSWLPEDLNKGRLDNFYLII  563

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A + +VNL YF++ A+ YRYK
Sbjct  564  AALEIVNLGYFVLCAQWYRYK  584



>gb|KDP45468.1| hypothetical protein JCGZ_09717 [Jatropha curcas]
Length=547

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 131/206 (64%), Gaps = 12/206 (6%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LG + FQIPA S  + ++L + + +P YDR+LVP+ RK T+   GIT+LQRMGIGL  SI
Sbjct  329  LGNKGFQIPAASFVIFTMLGLTIWIPVYDRILVPFLRKLTKNEVGITLLQRMGIGLVLSI  388

Query  179  LAMAVSGFVEIKRRAAA---------NGG--ASPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            L M  S  VE +R+  A         + G   S +S  W  PQL + G  EAF+ +GQ E
Sbjct  389  LCMLTSALVEQRRKYLAFTKIPLGVTHKGLLISAMSAFWFVPQLTLAGLTEAFSSIGQTE  448

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY  +FPENM SI  SL  +    + Y+S  L++ VH  T      DWL++D+N G+L++
Sbjct  449  FYYNQFPENMRSIAMSLFFLCIAFSSYLSGFLISLVHHITKRTKGGDWLHEDLNKGKLDH  508

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY++IAG+GVVNL YF+V+++ YRYK
Sbjct  509  FYYIIAGLGVVNLCYFLVISKWYRYK  534



>ref|XP_007032430.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY03356.1| Major facilitator superfamily protein [Theobroma cacao]
Length=593

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 128/202 (63%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++PA S  V  +L++ + +P YDRVLVP  R+ T   GGIT+LQRMGIG+ FS++ M +
Sbjct  372  FKVPAASYTVFQMLSLTLWIPLYDRVLVPSLRRLTGKQGGITLLQRMGIGIIFSLITMLL  431

Query  194  SGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE +RR           A  GGA S +S  WL PQL + G  E FN +GQIEFY K+
Sbjct  432  SGLVEKQRRNLALTRPTLGIAPKGGAISSMSGWWLVPQLFLTGICEGFNCIGQIEFYYKQ  491

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S   +    + Y+S  LV+ VH  T      DWL +D+N G+L+ FY++I
Sbjct  492  FPENMRSIAGSFFFLGLAGSSYLSGFLVSIVHHITSRTEAGDWLPEDLNKGKLDYFYYLI  551

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            A +G +N VYF+V A+ Y+YK+
Sbjct  552  AALGFINFVYFLVCAKWYKYKA  573



>ref|XP_008670500.1| PREDICTED: uncharacterized protein LOC100191680 isoform X1 [Zea 
mays]
 gb|ACN34612.1| unknown [Zea mays]
 gb|ACR36295.1| unknown [Zea mays]
 tpg|DAA50698.1| TPA: hypothetical protein ZEAMMB73_457708 [Zea mays]
Length=589

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 133/206 (65%), Gaps = 14/206 (7%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LGR  FQIPA S  V ++L   + +PFYDR+L+P  RK T    G T+LQR GIG+A S 
Sbjct  382  LGRAGFQIPAASFTVFAMLAQTLWIPFYDRLLLPKLRKITGKEEGFTLLQRQGIGIALST  441

Query  179  LAMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            +AM +S  VE +RRA A           GGA S +S  W+ PQLM++G +EAFN++ QIE
Sbjct  442  VAMVISAIVEDRRRAIALSQPTLGTTITGGAISAMSSLWMVPQLMILGLSEAFNLISQIE  501

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY KE PE+M S+  +L      +  Y+S  LV  VH+TTG  G+ +WL  D+N GRL+ 
Sbjct  502  FYYKEIPEHMRSVAGALAFCNLALGNYLSGFLVTIVHRTTG-SGQ-NWLAQDLNKGRLDL  559

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            FY+ IAG+GV N +YF++ AR YR+K
Sbjct  560  FYWTIAGIGVFNFIYFVICARWYRFK  585



>gb|KDO76031.1| hypothetical protein CISIN_1g007827mg [Citrus sinensis]
Length=588

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S+L + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  367  HFKIPAASYAIFSMLGLTIWIPIYDRIIVPRLQRLTKKEGGITILQRMAIGMILAIFTMI  426

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR+ A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  427  ISGIIEDKRRSLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y++  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  487  FPENMRSIGGSLAFVGFAISNYLNGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  546

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  547  AALGLLNFGFFLLCAKWYKYK  567



>ref|XP_006367062.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Solanum tuberosum]
Length=591

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  + S+L++ + +P YDR++VP  R+ T   GGITILQRMG G+  ++L+  V
Sbjct  369  FQIPAATYTIFSMLSLTLWIPIYDRIVVPLLRRITGKEGGITILQRMGFGIFLTVLSSLV  428

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S F+E +RR            A  G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  429  SAFIEKRRRNLVFTNPALGLHAERGLVSSMSALWLVPQLSLAGLAEAFCAIGQVEFYYKQ  488

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S + +    + Y++++L+  VH TTG     +WL +D+N G+L+ FYF+I
Sbjct  489  FPENMRSIAGSFLFLGMAASSYLNSLLIYIVHNTTGKAKTGNWLPEDLNKGKLDYFYFLI  548

Query  521  AGMGVVNLVYFMVVARRYRYK  583
              +G++N+VYF++ AR Y+YK
Sbjct  549  TALGIMNVVYFIICARWYKYK  569



>ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Citrus sinensis]
Length=588

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S+L + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  367  HFKIPAASYAIFSMLGLTIWIPIYDRIIVPRLQRLTKKEGGITILQRMAIGMILAIFTMI  426

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR+ A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  427  ISGIIEDKRRSLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y++  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  487  FPENMRSIGGSLAFVGFAISNYLNGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  546

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  547  AALGLLNFGFFLLCAKWYKYK  567



>dbj|BAJ96711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 127/205 (62%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+LVP  RK T    G+T+LQR GIG+A S +
Sbjct  394  LGSSFHVPAASFTVFAMLAQTLWIPIYDRLLVPRLRKVTGKDEGLTLLQRQGIGIALSTV  453

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM VS  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  454  AMIVSAVVEDRRRDIALNQPNIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  513

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  514  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHRTTGAG--QNWLAQDLNKGRLDLF  571

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  572  YWMIAGIGVFNFVYFMICARWYRFK  596



>dbj|BAJ91141.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 127/205 (62%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+LVP  RK T    G+T+LQR GIG+A S +
Sbjct  394  LGSSFHVPAASFTVFAMLAQTLWIPIYDRLLVPRLRKVTGKDEGLTLLQRQGIGIALSTV  453

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM VS  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  454  AMIVSAVVEDRRRDIALNQPNIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  513

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  514  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHRTTGAG--QNWLAQDLNKGRLDLF  571

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  572  YWMIAGIGVFNFVYFMICARWYRFK  596



>dbj|BAJ94405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 127/205 (62%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+LVP  RK T    G+T+LQR GIG+A S +
Sbjct  394  LGSSFHVPAASFTVFAMLAQTLWIPIYDRLLVPRLRKVTGKDEGLTLLQRQGIGIALSTV  453

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM VS  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  454  AMIVSAVVEDRRRDIALNQPNIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  513

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  514  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHRTTG--AGQNWLAQDLNKGRLDLF  571

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  572  YWMIAGIGVFNFVYFMICARWYRFK  596



>dbj|BAK08097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 127/205 (62%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+LVP  RK T    G+T+LQR GIG+A S +
Sbjct  394  LGSSFHVPAASFTVFAMLAQTLWIPIYDRLLVPRLRKVTGKDEGLTLLQRQGIGIALSTV  453

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM VS  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  454  AMIVSAVVEDRRRDIALNQPNIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  513

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  514  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHRTTGAG--QNWLAQDLNKGRLDLF  571

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  572  YWMIAGIGVFNFVYFMICARWYRFK  596



>ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citrus clementina]
 gb|ESR52902.1| hypothetical protein CICLE_v10019426mg [Citrus clementina]
Length=588

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 131/201 (65%), Gaps = 10/201 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  + S++ + + +P YDR++VP  ++ T+  GGITILQRM IG+  +I  M 
Sbjct  367  HFKIPAASYAIFSMIGLTIWIPIYDRIIVPKLQRLTKKEGGITILQRMAIGMILAIFTMI  426

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +SG +E KRR  A           G  S LS  WL PQL ++GF+EAF I+ ++EFY K+
Sbjct  427  ISGIIEDKRRYLALSRPVGLEQRRGAISSLSGLWLIPQLSLIGFSEAFTIIAEVEFYYKQ  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SIG SL  V + ++ Y+S  L++ VH+ T      DWL +D+N GRL+ FY+++
Sbjct  487  FPENMRSIGGSLTFVGFAISNYLSGFLISMVHRFTKGASTGDWLPEDLNKGRLDYFYYLV  546

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +G++N  +F++ A+ Y+YK
Sbjct  547  AALGLLNFGFFLLCAKWYKYK  567



>gb|AHV83614.1| nitrate transporter [Camellia sinensis]
Length=605

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 126/202 (62%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +FQIPA S  V S+LT+++ +P YDR+LVP  R+ T   GGITILQRMGIG+  S L   
Sbjct  372  KFQIPAASYPVFSMLTLSLWIPIYDRILVPTLRRFTGKEGGITILQRMGIGIGLSALTSL  431

Query  191  VSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            V+ F+E  RR  A            G  S ++  WL PQL + G AEAF  +GQ+EFY K
Sbjct  432  VAAFIENWRRTTALTMPTLGIEQRRGAISSINALWLVPQLSLAGLAEAFMSIGQVEFYYK  491

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM SI  S       V+ Y+S  LV+ VHKTT   G   WL +D+N GRL+ FY++
Sbjct  492  QFPENMRSIAGSSFFCGMAVSNYLSGFLVSVVHKTTQRSGTGGWLTEDLNKGRLDYFYYL  551

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            +A +G +NL YF+V +  YRYK
Sbjct  552  VAILGAINLGYFLVCSMWYRYK  573



>dbj|BAJ34570.1| unnamed protein product [Thellungiella halophila]
Length=623

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V + FYDRVLVP  R+ TR+  GIT+LQR+G G+ F++L++ V
Sbjct  395  FKIPAATYVVFLMTGMTVFIIFYDRVLVPSLRRVTRLDTGITLLQRIGAGIFFAVLSLLV  454

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S F+E +RR  A            G  S +S  WL PQL++ G AEAF  +GQ+EFY K+
Sbjct  455  SAFIEERRRNFALTRPTLGIEPRRGEISSMSAMWLIPQLLLAGVAEAFAAIGQMEFYYKQ  514

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+S+ L++TVH+ T      +WL +D+N G+L+ FYF++
Sbjct  515  FPENMKSFAGSIFYVGAGVSSYLSSFLISTVHRMTEHSPSGNWLAEDLNKGKLDYFYFML  574

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+VYF++VA+ YRYK
Sbjct  575  TGLMVVNMVYFLLVAKWYRYK  595



>ref|XP_002517460.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45002.1| nitrate transporter, putative [Ricinus communis]
Length=583

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 130/203 (64%), Gaps = 12/203 (6%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S+ V ++LT+ + +P YDR++VP  RK T   GGITILQRMGIGL FSIL M V
Sbjct  369  FEIPAASIIVFAMLTLTIFIPIYDRIIVPSLRKITGKEGGITILQRMGIGLIFSILTMIV  428

Query  194  SGFVEIKRRAAANGGA----------SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG +E +RR  A  G+          S +S  WL PQL + G  EA N +GQ EFY K+F
Sbjct  429  SGLIEERRRRLAITGSTGISPKGGVISSMSALWLIPQLALAGLTEALNSVGQTEFYYKQF  488

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHK-TTGVHGRPDWLNDDINAGRLENFYFVI  520
            PENM SI  S   +    + Y+S++LV+ VH  T G  GR +WL +D+N  RL+ FY++I
Sbjct  489  PENMRSIAGSFFYLGLAGSFYLSSILVSIVHHVTAGSDGR-NWLAEDLNKARLDLFYYMI  547

Query  521  AGMGVVNLVYFMVVARRYRYKSK  589
            A +G +N   F+V A+ YRYK K
Sbjct  548  AVLGALNFGCFLVFAKFYRYKGK  570



>ref|XP_004236179.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Solanum lycopersicum]
Length=587

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  + S+L++ + +P YDR++VP  R+ T   GGITILQRMG G+  ++L+  V
Sbjct  369  FQIPAATYTIFSMLSLTLWIPIYDRIVVPLLRRITGKEGGITILQRMGFGIFLTVLSSLV  428

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S F+E +RR            +  G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  429  SAFIEKRRRNLVFTNPALGLHSERGLVSSMSALWLVPQLSLAGLAEAFCAIGQVEFYYKQ  488

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S + +    + Y++++L+  VH TTG     +WL +D+N G+L+ FYF+I
Sbjct  489  FPENMRSIAGSFLFLGMAASSYLNSLLIYIVHNTTGKAKTGNWLPEDLNKGKLDYFYFLI  548

Query  521  AGMGVVNLVYFMVVARRYRYK  583
              +G++N+VYF++ AR Y+YK
Sbjct  549  TALGIMNVVYFIICARWYKYK  569



>gb|KEH31902.1| peptide/nitrate transporter [Medicago truncatula]
Length=597

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 128/201 (64%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IP  S  V  +L++ + LP YDR++VP  R+ T    GIT+LQR+G+G+   IL++ V
Sbjct  385  FKIPGASYTVFLMLSMTLWLPIYDRIVVPCLRRFTEKEAGITVLQRIGVGIFLGILSILV  444

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            S FVE +RR  A           G  S +S  WL PQL++ GFAE F  +GQIEFY K+F
Sbjct  445  SAFVETQRRHLALTKPIGMQPRKGAISSMSGFWLVPQLILAGFAETFTAVGQIEFYYKQF  504

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM SIG SL       + Y+S  LV+ VH+TT      +WL +D+N GRLE FY++IA
Sbjct  505  PENMKSIGGSLFYCGMAGSSYLSAFLVSVVHRTTSKSATGNWLPEDLNKGRLEYFYYMIA  564

Query  524  GMGVVNLVYFMVVARRYRYKS  586
            G+ V+N VYF++ ++ Y+Y+ 
Sbjct  565  GIEVLNFVYFLMFSKWYKYRE  585



>ref|XP_006404313.1| hypothetical protein EUTSA_v10010180mg [Eutrema salsugineum]
 gb|ESQ45766.1| hypothetical protein EUTSA_v10010180mg [Eutrema salsugineum]
Length=654

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V + FYDRVLVP  R+ TR+  GIT+LQR+G G+ F++L++ V
Sbjct  426  FKIPAATYVVFLMTGMTVFIIFYDRVLVPSLRRVTRLDTGITLLQRIGAGIFFAVLSLLV  485

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S F+E +RR  A            G  S +S  WL PQL++ G AEAF  +GQ+EFY K+
Sbjct  486  SAFIEERRRNFALTRPTLGIEPRRGEISSMSAMWLIPQLLLAGVAEAFAAIGQMEFYYKQ  545

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+S+ L++TVH+ T      +WL +D+N G+L+ FYF++
Sbjct  546  FPENMKSFAGSIFYVGAGVSSYLSSFLISTVHRMTEHSPSGNWLAEDLNKGKLDYFYFML  605

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+VYF++VA+ YRYK
Sbjct  606  TGLMVVNMVYFLLVAKWYRYK  626



>ref|XP_010532304.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.9 
[Tarenaya hassleriana]
Length=585

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 129/205 (63%), Gaps = 15/205 (7%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  V  +L +   +P YDRVLVP+ R  T   GGIT+L R+G G+   I +M V
Sbjct  367  FQIPAATYTVFLMLGMTTFIPIYDRVLVPFLRMFTGKEGGITLLXRVGAGMVVCITSMLV  426

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S FVE +RR  A            G  S LS  W+ PQL +MG A+AF  +GQ+EFY KE
Sbjct  427  SAFVEERRRTVALTRPTLGIAPRKGAISSLSSMWMIPQLGLMGIADAFTGVGQMEFYYKE  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRP--DWLNDDINAGRLENFYF  514
            FPENM S   S+     G++ Y+ST L++ VH  T   G+P  +WL +D+N G+L++FYF
Sbjct  487  FPENMRSFAGSIYYCGIGLSSYLSTFLISVVHGKT--EGKPSGEWLPEDLNKGKLDHFYF  544

Query  515  VIAGMGVVNLVYFMVVARRYRYKSK  589
            ++AGM  VNL YF++V++ YRYK K
Sbjct  545  LVAGMMTVNLAYFLLVSQWYRYKEK  569



>dbj|BAJ93857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 125/193 (65%), Gaps = 5/193 (3%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIP GS  V  +L++ + +P YDR +VP  R+ T+  GGIT+LQR+G+GLA S+  M V
Sbjct  388  FQIPQGSFVVFQMLSLTLWIPVYDRFVVPALRRFTKREGGITLLQRIGVGLALSVATMVV  447

Query  194  SGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNS  373
            S  VE +RR       S +S  WL PQ ++ G +EAF  +GQIEFY ++FPENM S+  +
Sbjct  448  SAAVEQRRRKI----GSSMSCFWLVPQQLLAGLSEAFGAIGQIEFYYRQFPENMRSVAGA  503

Query  374  LVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVY  550
            L  + + +A Y S ++V  VH+ T G  GRPDWL  D++ GR++ FY V A +  VNLVY
Sbjct  504  LYFLGFALASYSSGLMVMVVHRATRGRDGRPDWLAQDLDEGRVDLFYLVTAAIAAVNLVY  563

Query  551  FMVVARRYRYKSK  589
            F+  AR YR+K  
Sbjct  564  FVFCARWYRFKKS  576



>ref|XP_003561175.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Brachypodium distachyon]
Length=588

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F +PA S  V ++L   + +P YDR+L+P  RK T    G T+LQR GIG+A S +
Sbjct  382  LGSSFHVPAASFTVFAMLAQTLWIPIYDRILLPRLRKVTGKDEGFTLLQRQGIGIALSTV  441

Query  182  AMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
            AM +S  VE +RR  A            GG S +S  W+ PQLM++G +EAFN++ QIEF
Sbjct  442  AMVISAIVEDRRRDIALNQPVIGTTQTGGGISAMSSFWMVPQLMILGLSEAFNLISQIEF  501

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y KE PE+M S+  +L      +  Y+S  L   VH+TTG     +WL  D+N GRL+ F
Sbjct  502  YYKEIPEHMRSVAGALAFCNLALGNYLSGFLTTIVHQTTG--AGQNWLAQDLNKGRLDLF  559

Query  509  YFVIAGMGVVNLVYFMVVARRYRYK  583
            Y++IAG+GV N VYFM+ AR YR+K
Sbjct  560  YWMIAGIGVFNFVYFMICARWYRFK  584



>emb|CDX68450.1| BnaC01g25280D [Brassica napus]
Length=615

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IP G+  V  +  + V + FYDRVLVP  R+ T +  GIT+LQR+G G+ F++L+M +
Sbjct  387  FKIPGGTYVVFLMSGMTVFIIFYDRVLVPSLRRVTGLDNGITLLQRIGSGIFFALLSMLI  446

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGFVE +RRA A            G  S +S  WL PQL++ G AEAF  +GQ+EFY K+
Sbjct  447  SGFVEERRRAIALTKPTLGIEPRAGEISSMSAMWLIPQLVLAGIAEAFAAVGQMEFYYKQ  506

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+++ L++TVHKTT      +WL +D+N G+L+ FYF+I
Sbjct  507  FPENMKSFAGSIFYVGAGVSSYLASFLISTVHKTTEHSRSGNWLAEDLNKGKLDYFYFMI  566

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+  VN+ YF+++A+ YRYK
Sbjct  567  TGLMFVNMGYFLLMAKFYRYK  587



>ref|XP_004508786.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
[Cicer arietinum]
Length=580

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 126/201 (63%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IP  S  V  +L++ + LPFYDR++VP  RK T    GITILQRMG+G+  SI+ M V
Sbjct  371  FKIPGASYSVFLMLSMTLWLPFYDRIVVPLLRKITGKDSGITILQRMGVGMFLSIICMLV  430

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            S FVE +RR  A           G  S +S  WL PQL++ G AE F  +GQIEFY K+F
Sbjct  431  SAFVETQRRHLAITNPIGIQPRKGAISSMSGFWLIPQLILAGLAETFASVGQIEFYYKQF  490

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM SIG SL       + Y+S  L++ VH+TT      +WL +D+N GRLE FY+++A
Sbjct  491  PENMKSIGGSLFYCGMAGSSYLSASLISIVHRTTSKSATGNWLPEDLNKGRLEFFYYMVA  550

Query  524  GMGVVNLVYFMVVARRYRYKS  586
             + ++N +YF+  ++ Y+Y+ 
Sbjct  551  ALELLNFLYFLTCSKWYKYRE  571



>ref|XP_008364618.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Malus domestica]
Length=590

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 130/196 (66%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    LGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LG+  FQIPA S  +  +L + + +P YDR+LVP+ ++ T  +GGIT+LQR+GIG+  S+
Sbjct  373  LGKTNFQIPAASYSIFLMLGMTIWIPIYDRLLVPFLQRLTGKVGGITLLQRIGIGIFLSV  432

Query  179  LAMAVSGFVEIKRRAAANGGASP-LSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENM  355
            + M VS FVE  RR  A     P +S  WL PQL + G AEAF  +GQIEFY K+FPENM
Sbjct  433  ITMLVSAFVEQHRRTIALTKPIPGMSGFWLVPQLTLAGLAEAFAAIGQIEFYYKQFPENM  492

Query  356  NSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
             SI  SL       + Y+S+ L+  VH+TT      +WL +D+N GRL+ FY++IA +GV
Sbjct  493  RSIAGSLFFCGMAGSSYLSSALIAIVHRTTEGATTGNWLPEDLNEGRLDYFYYLIAALGV  552

Query  536  VNLVYFMVVARRYRYK  583
            +NL YF++ +R Y+YK
Sbjct  553  INLGYFLMCSRWYKYK  568



>ref|XP_010678592.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Beta vulgaris 
subsp. vulgaris]
Length=591

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 132/206 (64%), Gaps = 12/206 (6%)
 Frame = +2

Query  2    LGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            LG+ +F++PA S  V  ++++ + +P YDR+LVP+  K  R  GGITILQRMGIG+ FSI
Sbjct  359  LGKTKFEVPASSYIVFMMISLTIWIPIYDRILVPFLEKFKRKEGGITILQRMGIGIVFSI  418

Query  179  LAMAVSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIE  325
            L M V+G VE  RR  A            G  S +S  WL   L + G  EAF  +GQ+E
Sbjct  419  LTMLVAGLVENHRRKLALTKPTLGIFPRKGKISSMSSFWLVFPLGLAGLGEAFMSIGQVE  478

Query  326  FYNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLEN  505
            FY K+FPENM S+  S+  +  G++ Y+S+ L++ VHKTT      DWL++D+N G+L+ 
Sbjct  479  FYYKQFPENMRSVAGSIFFLGIGMSSYLSSFLISIVHKTTKKGTSGDWLSEDLNKGKLDY  538

Query  506  FYFVIAGMGVVNLVYFMVVARRYRYK  583
            +Y++IAG+  +N VYF+  AR Y+YK
Sbjct  539  YYYMIAGLCTLNFVYFLGCARWYKYK  564



>ref|XP_011013862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like [Populus euphratica]
Length=480

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 128/206 (62%), Gaps = 11/206 (5%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  F++PA +  + +++T+ + +P YDR++VP+ ++ T   GG+T+LQRMGIG+  ++L
Sbjct  257  LGTSFEVPAATYVIFTMITLTIWIPLYDRIIVPFLQRLTGKEGGLTLLQRMGIGMVLAML  316

Query  182  AMAVSGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEF  328
               VSG VE  RR  A           GGA S LS  WL PQL + G +E FN + QIEF
Sbjct  317  CTIVSGLVEGNRRHIALTRPTIGITSKGGAISSLSALWLVPQLSLSGLSEGFNYIAQIEF  376

Query  329  YNKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENF  508
            Y K++PENM SI          ++ Y+S  LV  VH+ T      DWL+DD+N G+L+ F
Sbjct  377  YYKQYPENMRSIAGPSFFAGAAISNYLSGFLVTLVHRITSGSKTGDWLDDDLNKGKLDCF  436

Query  509  YFVIAGMGVVNLVYFMVVARRYRYKS  586
            Y++I G+G++N  YF++ A+ YRYK 
Sbjct  437  YYMIVGLGILNFGYFLLCAKWYRYKD  462



>ref|XP_009400863.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 134/203 (66%), Gaps = 11/203 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V ++  + V L  YDRV+VP  ++ T   GGIT+LQRMG G+A S++ M V
Sbjct  368  FEIPAATFPVFTMAAMTVWLFVYDRVVVPLLQRVTGKEGGITLLQRMGTGIALSVVMMTV  427

Query  194  SGFVEIKRRAAA----------NGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +G VE +RR+ A          +GGA S +S  WL PQL++ G ++AFN++GQ+EFY K+
Sbjct  428  AGLVEERRRSYALHKPTLGTTSSGGAISSMSSLWLIPQLVIAGLSDAFNVIGQVEFYYKQ  487

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S+   L+ + +  + Y+ ++++  VH+ TG H + +WL +D+N GRL+  YF I
Sbjct  488  FPENMRSMAGGLLFLGFACSNYLGSLIITIVHRITGGHQKSNWLAEDLNQGRLDLLYFSI  547

Query  521  AGMGVVNLVYFMVVARRYRYKSK  589
            A +  VN V+F+V A+ YRYK+ 
Sbjct  548  ASISAVNFVFFIVCAKWYRYKTS  570



>ref|XP_009400862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 134/203 (66%), Gaps = 11/203 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V ++  + + L  YDR +V   ++ T   GGIT+LQRMG G+A S++ M V
Sbjct  368  FEIPAATFTVFAMAAMTIWLLVYDRFVVRLLQRVTGKEGGITLLQRMGTGIALSVVMMIV  427

Query  194  SGFVEIKRRA----------AANGGA-SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
             G VE +RR+          A+NGGA S +S  WL PQL++ G ++AFN++GQ+EFY K+
Sbjct  428  GGLVEERRRSYALHKPTLGTASNGGAISSMSSLWLIPQLVIAGLSDAFNLVGQVEFYYKQ  487

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S+   L+ + +  + Y+ T+++  VH+TTG H + +WL +D+N GRL+  YF I
Sbjct  488  FPENMRSMAGGLLFLGFACSNYLGTLIITIVHRTTGGHQKSNWLAEDLNQGRLDLLYFSI  547

Query  521  AGMGVVNLVYFMVVARRYRYKSK  589
            A +  VNLV+F+V A+ Y+YK+ 
Sbjct  548  ASLSAVNLVFFIVCAKWYKYKTS  570



>ref|XP_007133916.1| hypothetical protein PHAVU_010G003000g [Phaseolus vulgaris]
 gb|ESW05910.1| hypothetical protein PHAVU_010G003000g [Phaseolus vulgaris]
Length=563

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 124/199 (62%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            +G  F++P  S   VSL+TI + LP ++  L P   K T+   G+T LQ++ IG  FS+L
Sbjct  345  IGAHFKLPPASYSAVSLITICIFLPCFELFLQPALAKVTKKEEGLTSLQKIVIGDIFSVL  404

Query  182  AMAVSGFVEIKRRAAANG-----GASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFP  346
             M  +G VE +R+  AN      G +P++  WL PQ +++G  E F ++G I+FY+ + P
Sbjct  405  TMVSAGLVEGRRKGVANSHGAGDGVAPMNAMWLVPQFVLLGLCEMFTLVGHIQFYSTQSP  464

Query  347  ENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAG  526
            E M SIGNSL  +    + YV T++VN VH+ T  HG  DWLNDDINAGRL+ +YF+IAG
Sbjct  465  EKMKSIGNSLQYLVLAFSIYVGTLVVNVVHQVTRKHGGIDWLNDDINAGRLDYYYFLIAG  524

Query  527  MGVVNLVYFMVVARRYRYK  583
               +NL+Y     +RY YK
Sbjct  525  FAAMNLLYIFFCVKRYHYK  543



>ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF52111.1| nitrate transporter, putative [Ricinus communis]
Length=602

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 126/202 (62%), Gaps = 11/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             F+IPA S  V  +L++ + +P YDR+LVP+ +K T   GGIT+LQR+GIG  FS  +M 
Sbjct  380  EFEIPAASYTVFLMLSLTIFIPIYDRILVPFVQKVTGKEGGITLLQRIGIGTVFSTASMI  439

Query  191  VSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VS  VE +RR  A            G  S +S  WL PQL + G AEAF  +G +EFY K
Sbjct  440  VSALVEEQRRTIALTKPTLGIAPRRGAISSMSGLWLVPQLTLAGLAEAFGAIGLVEFYYK  499

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM SI  SL       A Y+S++L+  VH+TT      +WL +D+N GRL+ +Y++
Sbjct  500  QFPENMRSIAGSLFFCGMAGASYLSSLLITVVHRTTEKTATGNWLAEDLNKGRLDYYYYL  559

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            IA +GV+N  YF++ A+ Y+YK
Sbjct  560  IAALGVLNFGYFLICAKWYKYK  581



>ref|XP_009150736.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like [Brassica rapa]
Length=615

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 138/202 (68%), Gaps = 13/202 (6%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLT-IAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            F+IP G+ +VV L++ + V + FYDRVLVP  R+ T +  GIT+LQR+G G+ F++L++ 
Sbjct  387  FKIP-GATYVVFLMSGMTVFIIFYDRVLVPSLRRVTGLDNGITLLQRIGSGIFFALLSLL  445

Query  191  VSGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            VSGFVE +RRA A            G  S +S  WL PQL++ G AEAF  +GQ+EFY K
Sbjct  446  VSGFVEERRRAIALTKPTLGIEPRAGEISSMSAMWLIPQLVLAGIAEAFAAVGQMEFYYK  505

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFV  517
            +FPENM S   S+  V  GV+ Y+++ L++TVHKTT      +WL +D+N G+L+ FYF+
Sbjct  506  QFPENMKSFAGSIFYVGAGVSSYLASFLISTVHKTTEHSRSGNWLAEDLNKGKLDYFYFM  565

Query  518  IAGMGVVNLVYFMVVARRYRYK  583
            + G+  VN+VYF+++A+ YRYK
Sbjct  566  LTGLMFVNMVYFLLMAKFYRYK  587



>ref|XP_004963333.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Setaria italica]
Length=600

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    LGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSI  178
            +GR  FQIPAGS  V ++L + V LP YD ++VP  ++ T+  GGIT LQR+G G+  SI
Sbjct  381  IGRSGFQIPAGSFVVFNMLALTVWLPIYDGLVVPALQRVTKREGGITQLQRIGTGIVMSI  440

Query  179  LAMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMN  358
              M ++  VE  RR   N      S   L PQ M+ G +EAF ++GQ++FY K+FPENM 
Sbjct  441  ATMVLAAAVERHRRRVGNA----TSCFVLVPQQMLAGLSEAFAVIGQVDFYYKQFPENMR  496

Query  359  SIGNSLVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGV  535
            S+  +L+ + + VA Y S ++V  VH+TT G  GRPDWL  D+N GR++ +Y VIA M  
Sbjct  497  SVAGALLFLGFAVASYASGLMVTVVHRTTGGSGGRPDWLTQDLNQGRVDLYYLVIAAMAA  556

Query  536  VNLVYFMVVARRYRYKS  586
            VNLVYF+V AR YR+K 
Sbjct  557  VNLVYFVVCARWYRFKE  573



>ref|XP_002517390.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF44932.1| nitrate transporter, putative [Ricinus communis]
Length=584

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 125/201 (62%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F +PA +  +  ++T+ V +P YDR+LVP+  + T   GG+T+LQRMGIG+A SI+ M V
Sbjct  366  FTVPAATYVIFIMITLTVWIPIYDRLLVPYLERLTGKDGGLTLLQRMGIGIALSIICMLV  425

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE  RR  A            G  S +S  WL PQL + G AE FN + QIEFY K+
Sbjct  426  SGLVEEHRRNVAFIRPTLGISPKGGSISSMSGMWLVPQLALAGLAEGFNYVAQIEFYYKQ  485

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  SL    + ++ Y+S  L++  H+ T      DWL +D+N G+L+ +Y++I
Sbjct  486  FPENMRSIAQSLFFAGYAISSYLSGFLISITHQITSRTKTGDWLAEDLNKGKLDYYYYMI  545

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+G++N VYF+  A+ YRY+
Sbjct  546  GGLGLLNFVYFLASAKWYRYR  566



>ref|XP_011071716.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Sesamum indicum]
Length=579

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 125/201 (62%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIP  +  + ++LT+ + +P YDR++VP+ R+ T   GGITILQRMGIG+  +I+   V
Sbjct  364  FQIPPATYNIFAMLTLTIWVPIYDRIIVPFLRRLTGKQGGITILQRMGIGIFLTIIESLV  423

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            +G VE KRR            A  G  S +S  WL PQL + G AEAF  +GQ+EF+ K+
Sbjct  424  AGLVEAKRRDMAISRPMEGIHAKRGAVSSMSALWLVPQLFLGGLAEAFCAIGQVEFFYKQ  483

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S       VA YV+  L++ VH+ T      +WL +D+N GRL+ FY+++
Sbjct  484  FPENMRSIAGSFFFCGMAVANYVNGFLISVVHRATEGSSTGNWLPEDLNKGRLDYFYYLV  543

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A + V+N  YF+V A+ YRYK
Sbjct  544  AALCVLNFCYFLVCAKWYRYK  564



>ref|XP_004959036.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At3g47960-like [Setaria italica]
Length=583

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 132/204 (65%), Gaps = 14/204 (7%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F++P  S  +  +L + + +PFYDR+++PW R+ T    GIT+LQRMG+G+  S++AM +
Sbjct  344  FEVPPASFTIFPMLALTIWIPFYDRLMLPWLRRLTGREEGITLLQRMGVGMVLSVVAMLI  403

Query  194  SGFVEIKRR------AAANGGA------SPLSVAWLFPQLMVMGFAEAFNILGQIEFYNK  337
            SG  E +RR      AAA+GG+      SP+S  WL PQL  +G +EAFN + Q+EFY K
Sbjct  404  SGMAEQRRRELALLHAAASGGSMSASRVSPMSAFWLVPQLAALGLSEAFNQVSQMEFYYK  463

Query  338  EFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTG--VHGRPDWLNDDINAGRLENFY  511
            +FPENM S+  SL+     ++ Y+S +LV  VH+TT     G   WL +D+N G+L++FY
Sbjct  464  QFPENMRSVAGSLLFSGLALSSYLSGLLVIVVHRTTAGSADGDDGWLAEDLNRGKLDSFY  523

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            F+I  +G  N + F++ A+ YRYK
Sbjct  524  FLIGFVGAANFLAFLLCAKWYRYK  547



>gb|EMT08635.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=611

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 125/193 (65%), Gaps = 5/193 (3%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIP GS  V  +L + + +P YDR +VP  R+ T+  GGIT+LQR+G+GLA S+  M V
Sbjct  400  FQIPQGSFVVFQMLALTMWIPVYDRFVVPALRRFTKREGGITLLQRIGVGLALSVATMVV  459

Query  194  SGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNS  373
            S  VE +RR       S +S  WL PQ ++ G +EAF  +GQIEFY ++FPENM S+  +
Sbjct  460  SAAVEQRRRRI----GSSMSCFWLVPQQLLAGLSEAFGAIGQIEFYYRQFPENMRSVAGA  515

Query  374  LVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVY  550
            L  + + +A Y S ++V  VH+ T G  G+PDWL  D++ GR++ FY V A +  VNLVY
Sbjct  516  LYFLGFAMASYASGLMVMVVHRATRGRDGQPDWLAQDLDEGRVDLFYLVTAAITAVNLVY  575

Query  551  FMVVARRYRYKSK  589
            F++ AR YR+K  
Sbjct  576  FVICARWYRFKKS  588



>ref|XP_006301787.1| hypothetical protein CARUB_v10022251mg [Capsella rubella]
 gb|EOA34685.1| hypothetical protein CARUB_v10022251mg [Capsella rubella]
Length=555

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 130/195 (67%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            LG  +QIP  S+ V+SLLTI + LPFY+ VLV   +  T   GGI++LQ++GIG  FSI 
Sbjct  358  LGTSYQIPPASITVISLLTIGIWLPFYETVLVRHIQSITNQEGGISLLQKVGIGNIFSIS  417

Query  182  AMAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNS  361
             M +SG +E KRR  +  G + +SV WL PQ ++MGF + F I+G  EF+ ++ P NM S
Sbjct  418  TMFISGILERKRRDLSLTGVN-ISVFWLAPQQVLMGFYQVFTIVGLTEFFTQQVPINMRS  476

Query  362  IGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVN  541
            IGNSL+ +   +A Y+S+ +V+ VH  T   GR  WL DDI+  +L+ FY+ IA +  +N
Sbjct  477  IGNSLLYLGLSLASYLSSAMVSIVHSVTARGGRQSWLTDDIDTSKLDYFYYFIAALSTLN  536

Query  542  LVYFMVVARRYRYKS  586
            L++F+  ARRYRY++
Sbjct  537  LIFFLWCARRYRYRN  551



>ref|XP_007155346.1| hypothetical protein PHAVU_003G193400g [Phaseolus vulgaris]
 gb|ESW27340.1| hypothetical protein PHAVU_003G193400g [Phaseolus vulgaris]
Length=600

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 126/204 (62%), Gaps = 10/204 (5%)
 Frame = +2

Query  2    LGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSIL  181
            L   F+IPA S  +  ++++ + LP YDR++VP  +K T+  GGIT+LQRMGIG+  S+L
Sbjct  371  LNSNFEIPAASYTIFQMMSLTIWLPIYDRIIVPLLQKFTKKEGGITVLQRMGIGMFLSVL  430

Query  182  AMAVSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
               VSGF E +RR  A           G  S +S  W  PQL + G +EAF ++GQ+EF+
Sbjct  431  CAMVSGFSEERRRTMALSNPIGIYPRKGEISSMSALWFIPQLALAGLSEAFTLVGQVEFF  490

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             K+FPENM S+  SL       + Y+ST+L++ +HK T      +WL  ++N GRL+ FY
Sbjct  491  YKQFPENMKSLAGSLFFCGLAGSSYLSTLLISIIHKVTANSATGNWLPQNLNKGRLDYFY  550

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
            +VIA + V NL YF++ A  Y+YK
Sbjct  551  YVIAALEVFNLGYFILCANWYKYK  574



>gb|KDP45400.1| hypothetical protein JCGZ_09649 [Jatropha curcas]
Length=591

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 11/200 (6%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  + ++LT+ V +P YDR++VP+ ++ T   GG T+LQRMGIG+  SIL M V
Sbjct  370  FKIPAATYTIFTMLTLTVWIPIYDRIVVPYLQRLTGKEGGFTLLQRMGIGIILSILCMLV  429

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SG VE  RR           A   G  S +S  WL PQL + G AE FN + QIEFY K+
Sbjct  430  SGLVEEHRRNLAFNKPTLGIAQKGGKISSISGMWLVPQLAISGLAEGFNYVAQIEFYYKQ  489

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S    +  ++ Y+S  LV+ VH+ T      DWL +D+N G+L+ FY++I
Sbjct  490  FPENMRSIAQSFFFASQAISSYLSGFLVSIVHQITSGTATGDWLAEDLNEGKLDYFYYMI  549

Query  521  AGMGVVNLVYFMVVARRYRY  580
                +VNL+YF+V A+ YRY
Sbjct  550  GVFEIVNLMYFLVCAKWYRY  569



>ref|XP_009117579.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Brassica rapa]
Length=592

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 124/207 (60%), Gaps = 11/207 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPAGS  V  +L + + +P YDRVLVP+ RK T   GGIT LQR+G GL   I +M V
Sbjct  371  FQIPAGSYMVFLMLGMTIFIPIYDRVLVPFFRKYTGRDGGITQLQRVGAGLFLCITSMLV  430

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE  RR  A            G  S +S  WL PQL++MG  +A   +GQ+EFY K+
Sbjct  431  SAAVEQHRRTVALTRPTLGVAPRKGAISSMSGMWLIPQLLLMGIGDALAGVGQMEFYYKQ  490

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   SL     G+A Y+S+ L++TVH  T      +WL +D+N GRLE FY+ +
Sbjct  491  FPENMRSFAGSLYYCGIGLASYLSSFLLSTVHNITEGSSAGNWLPEDLNKGRLEYFYYFV  550

Query  521  AGMGVVNLVYFMVVARRYRYKSKVWVD  601
            AGM  +N  YF++V+  YRYK  V  D
Sbjct  551  AGMMTLNFAYFLLVSHWYRYKDVVAKD  577



>ref|XP_009626986.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana tomentosiformis]
Length=602

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 127/201 (63%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  + S+L++ + LP YDR++VP  R+ T   GGITILQRMGIG+   +L+  V
Sbjct  380  FQIPAATYTIFSMLSLTLWLPIYDRIVVPLLRRLTGKEGGITILQRMGIGIFLIVLSSLV  439

Query  194  SGFVEIKRRA-----------AANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S F+E +RR            +  G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  440  SAFIEERRRKLVFTNPALGVHSERGLVSSMSALWLVPQLSLAGLAEAFCAIGQVEFYYKQ  499

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  S   +    + Y+++ L++ VH TT      +WL +D+N GRL+ FYF+I
Sbjct  500  FPENMRSIAGSFFFLGMAASSYLNSFLISIVHHTTEKAKTGNWLPEDLNKGRLDYFYFLI  559

Query  521  AGMGVVNLVYFMVVARRYRYK  583
              +G++N+ YF++ AR Y+YK
Sbjct  560  TALGILNVFYFIICARWYKYK  580



>ref|XP_008807861.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=583

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 128/204 (63%), Gaps = 14/204 (7%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  +  +L +A+ +P YDRV+V    K T   GGIT+LQRMGIG+ FS++AM +
Sbjct  362  FEIPAASFTIFPMLALAIWIPLYDRVIVSKLEKFTGKEGGITLLQRMGIGIIFSVVAMII  421

Query  194  SGFVEIKRRAAA--------------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFY  331
            S  +E +RR  A                  S +S  WL   LM++G +EAFN++ Q+EFY
Sbjct  422  SAVIEDQRRKYALRLPTIGIMAGGGGGAAVSSMSSLWLIAPLMLLGLSEAFNMVSQLEFY  481

Query  332  NKEFPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFY  511
             K+FPENM S+  SL+     +A Y+S +LV  VH TTG +G+ +WL +D+N GRL+ FY
Sbjct  482  YKQFPENMRSVAGSLLFCGIAIASYLSGLLVTIVHNTTGAYGKENWLAEDLNKGRLDLFY  541

Query  512  FVIAGMGVVNLVYFMVVARRYRYK  583
             +IA +GV+N   F+  A+ YRYK
Sbjct  542  ILIAVIGVINFFLFLAFAKWYRYK  565



>ref|XP_010474241.1| PREDICTED: putative protein NRT1/ PTR FAMILY 2.14 [Camelina sativa]
Length=498

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 128/194 (66%), Gaps = 1/194 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  + IP  S+ V+SLLTI + LPFY+ VLV      T+  GGI++LQ++GIG  FSIL 
Sbjct  304  GTSYLIPPASITVISLLTIGIWLPFYETVLVRHIENITKQEGGISLLQKVGIGNLFSILT  363

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M +S  VE KRR  +  G + +SV WL PQ ++MGF + F I+G  EF+NK+ P NM SI
Sbjct  364  MFISAIVERKRRDLSLTGVN-ISVFWLTPQQVLMGFYQVFTIVGLTEFFNKQVPINMRSI  422

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNL  544
            GNSL+ +   +A Y+S+ +V+ VH  T   GR  WL +DI+  +L+ FY+ IA +  +NL
Sbjct  423  GNSLLYLGLSLASYLSSAMVSIVHSFTARGGRQSWLTEDIDTSKLDYFYYFIAALSTLNL  482

Query  545  VYFMVVARRYRYKS  586
            ++F   ARRYRY++
Sbjct  483  IFFFWCARRYRYRT  496



>ref|XP_010415653.1| PREDICTED: putative protein NRT1/ PTR FAMILY 2.14 [Camelina sativa]
Length=552

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 129/194 (66%), Gaps = 2/194 (1%)
 Frame = +2

Query  5    GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILA  184
            G  + IP  S+ VVSLLTI + LPFY+ VLV      T+  GGI++LQ++GIG  FSIL 
Sbjct  359  GTSYLIPPASITVVSLLTIGIWLPFYETVLVRHIENITKQ-GGISLLQKVGIGNFFSILT  417

Query  185  MAVSGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSI  364
            M +S  VE KRR  +  G + +SV WL PQ ++MGF + F I+G  EF+NK+ P NM SI
Sbjct  418  MFISAIVEQKRRDLSLTGVN-ISVFWLTPQQVLMGFYQVFTIVGLTEFFNKQVPINMRSI  476

Query  365  GNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNL  544
            GNSL+ +   +A Y+S+ +VN VH  +   GR  WL DDI+  +L+ FY+ IA +  +NL
Sbjct  477  GNSLLYLGLSLASYLSSAMVNIVHSVSARGGRQSWLTDDIDTSKLDYFYYFIAALSTLNL  536

Query  545  VYFMVVARRYRYKS  586
            ++F+  ARRYRY++
Sbjct  537  IFFLWCARRYRYRT  550



>emb|CBI15285.3| unnamed protein product [Vitis vinifera]
Length=1053

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  + S+L + + +P YDR++VP  ++ T   GGIT+LQ+MG+G+  SI+ M V
Sbjct  408  FKIPAASYSIFSMLGLIIWIPIYDRIMVPLLQRFTGKEGGITVLQKMGVGMFLSIVTMLV  467

Query  194  SGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNS  373
            S FVE +RR  A    S +S  W  PQL ++G +EAF ++ Q+EF+ K+FPE+M S+G S
Sbjct  468  SAFVEHQRRTLALCAISSMSGLWFIPQLTLVGVSEAFTVIAQVEFFYKQFPESMRSVGGS  527

Query  374  LVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVYF  553
               +   V+ Y+S+ LV+TVH+ T      +WL +D+N GRL+ FY+++A +GV+NL YF
Sbjct  528  FSFLGVAVSSYLSSFLVSTVHRMTAGAASGNWLPEDLNKGRLDYFYYLVAALGVINLGYF  587

Query  554  MVVARRYRYK  583
            ++ A+ Y+YK
Sbjct  588  LLCAKWYKYK  597


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  11    RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             +FQIPA S  V S+L++ + +P YDR++VP+ R+ T    GITILQR+GIG+  S+L   
Sbjct  987   KFQIPAASYTVFSMLSLTIWVPIYDRIVVPFLRRITGKEAGITILQRIGIGIFLSVLTSL  1046

Query  191   VSGF  202
             VS  
Sbjct  1047  VSAL  1050



>ref|NP_001147815.1| ligA [Zea mays]
 gb|ACG28784.1| ligA [Zea mays]
 tpg|DAA47705.1| TPA: ligA isoform 1 [Zea mays]
 tpg|DAA47706.1| TPA: ligA isoform 2 [Zea mays]
Length=596

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 126/197 (64%), Gaps = 5/197 (3%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F IPAGS  V ++L + + LPFYD VLVP  ++ T   GGIT LQR+G G+  SI+ M V
Sbjct  387  FHIPAGSFVVFNMLALTLWLPFYDGVLVPAMQRLTGREGGITQLQRIGTGIVLSIVTMLV  446

Query  194  SGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNS  373
            +  VE  RR   +      S   L PQ M+ G +EAF I+GQ++FY K+FPENM S+  +
Sbjct  447  AAAVERHRRRLGDSA----SCFLLVPQQMLAGLSEAFGIIGQVDFYYKQFPENMRSVAGA  502

Query  374  LVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVY  550
            ++ + + +A Y S ++V+ VH+TT G  GRPDWL  D+N G ++ +Y +IA M  VNLVY
Sbjct  503  MLFLAFAIASYASGLMVSVVHRTTGGPDGRPDWLAQDLNQGHVDLYYLLIAAMAAVNLVY  562

Query  551  FMVVARRYRYKSKVWVD  601
            F+  AR YR+K+    D
Sbjct  563  FVACARWYRFKNPAAAD  579



>gb|KEH31904.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=605

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 10/202 (5%)
 Frame = +2

Query  11   RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
            +F IP  S +V  ++++A+ LP YDR +VP  ++ TR  GGIT+LQRMGIG+   IL+M 
Sbjct  381  KFMIPGASYYVFLMISVAIWLPIYDRKVVPLLQRITRKEGGITLLQRMGIGIFLGILSML  440

Query  191  VSGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            VS  VE +RR  A           G  S +S  WL PQL + G AEAF  + QIEFY K+
Sbjct  441  VSAIVEDRRRTLALTKPLEVESRKGAISSMSGLWLIPQLALAGLAEAFMSVAQIEFYYKQ  500

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM SI  SL       A Y+S+ML++++H  T       WL +D+N GRL+NFY +I
Sbjct  501  FPENMRSIAGSLYYAAHAGASYLSSMLISSIHHITVKSKTGSWLPEDLNKGRLDNFYLII  560

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            A + +VNL  F++ A+ YRYK 
Sbjct  561  AALEIVNLGCFVLCAQWYRYKE  582



>dbj|BAJ85122.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 125/192 (65%), Gaps = 6/192 (3%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIP GS  V S+L++ + +P YDR++VP  R+ T+  GGIT+LQR+G+GLA S+  M V
Sbjct  395  FQIPEGSFIVFSMLSLTLWIPVYDRLVVPALRRFTKQEGGITLLQRIGVGLALSVATMLV  454

Query  194  SGFVEIKRRAAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPENMNSIGNS  373
            S  VE +RR  A      +S  WL PQ+++ G +EAF  +GQ+EFY + FPENM S+  +
Sbjct  455  SVAVEHRRRRRA-----AMSCFWLVPQMLLAGLSEAFAGIGQLEFYYRHFPENMRSVAGA  509

Query  374  LVSVTWGVAGYVSTMLVNTVHKTT-GVHGRPDWLNDDINAGRLENFYFVIAGMGVVNLVY  550
            +  + + +A Y S  +V  VH+ T G  GRPDWL +D++ GR++ FY V A +  VN VY
Sbjct  510  VYYLGFALASYASGAMVTVVHRATMGRDGRPDWLAEDLDRGRVDLFYLVTAAIAAVNFVY  569

Query  551  FMVVARRYRYKS  586
            F+  AR YR K 
Sbjct  570  FVACARSYRSKE  581



>ref|XP_010533412.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Tarenaya hassleriana]
Length=585

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 125/202 (62%), Gaps = 11/202 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPA +  V  +L + V +P YDRVLVP+  + T   GGIT+LQR+GIGL   I  M V
Sbjct  367  FQIPAATYTVFLMLGLTVFIPIYDRVLVPFLTRITGKEGGITLLQRVGIGLVLCIGGMLV  426

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S FVE +RR  A            G  S LS  WL PQL +MG AEAF  +GQ+EFY K+
Sbjct  427  SAFVEERRRTIALTRPTLGIVPRKGEISSLSSMWLIPQLALMGIAEAFAGVGQMEFYYKQ  486

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   SL     G++ Y+ST L++ V+  T      DWL +D+N G+L+ FYF++
Sbjct  487  FPENMRSFAGSLYYCGIGISSYLSTFLISIVNDKTEKAASGDWLPEDLNKGKLDYFYFLV  546

Query  521  AGMGVVNLVYFMVVARRYRYKS  586
            +G+  VNL YF++V+  YRYK 
Sbjct  547  SGLMAVNLGYFLLVSYWYRYKD  568



>emb|CDX81902.1| BnaC08g36990D [Brassica napus]
Length=592

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 124/207 (60%), Gaps = 11/207 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            FQIPAGS  V  +L + + +P YDRVLVP+ RK T   GGIT LQR+G GL+  I +M V
Sbjct  371  FQIPAGSYMVFLMLGMTIFIPIYDRVLVPFLRKYTGRDGGITQLQRVGAGLSLCITSMLV  430

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE  RR  A            G  S +S  WL PQL++MG  +A   +GQ+EFY K+
Sbjct  431  SAAVEQHRRTVALTRPTLGVAPRKGAISSMSGMWLIPQLVLMGIGDALAGVGQMEFYYKQ  490

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   SL     G+A Y+S+ L++ VH  T      +WL +D+N GRLE FY+ +
Sbjct  491  FPENMRSFAGSLYYCGIGLASYLSSFLLSAVHNITEGSSAGNWLPEDLNKGRLEYFYYFV  550

Query  521  AGMGVVNLVYFMVVARRYRYKSKVWVD  601
            AGM  +N  YF++V+  YRYK  V  D
Sbjct  551  AGMMTLNFAYFLLVSHWYRYKDVVAKD  577



>gb|KJB19308.1| hypothetical protein B456_003G094400 [Gossypium raimondii]
Length=590

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 128/201 (64%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F IPA S  + +++ + + +P YDR++VPW +K T+  GGIT+LQ+M IG+  +I+ M +
Sbjct  368  FNIPAASFGIFTMIGVTIWIPIYDRLIVPWLQKYTKKEGGITLLQKMSIGMVLAIITMFI  427

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            S  VE +RRA A              S LS  WL PQL ++G +EAF ++G IEFY K+F
Sbjct  428  SAIVEDRRRALALSNPIGIDSKKRSISSLSTMWLIPQLTLIGLSEAFTLIGLIEFYYKQF  487

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM SI  S   +   ++ Y+S+ L++ VHK +      DWL +D+N G+L+ FY+++A
Sbjct  488  PENMRSIAGSFTFIGLALSSYLSSFLISVVHKISERSQTGDWLPEDLNKGKLDYFYYLVA  547

Query  524  GMGVVNLVYFMVVARRYRYKS  586
            G+ V+NL YF++ A  Y+YK 
Sbjct  548  GLEVMNLGYFIMCANWYKYKE  568



>ref|XP_004508781.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X1 [Cicer arietinum]
 ref|XP_004508782.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X2 [Cicer arietinum]
Length=598

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 126/200 (63%), Gaps = 10/200 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  + ++L++ + LP YDR++VP  R+ T   GGITILQR+GIG+  SIL M V
Sbjct  374  FKIPAASYTIFAMLSLTIFLPIYDRIIVPTLRRFTGKEGGITILQRIGIGMFVSILCMLV  433

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG VE KRR  A           G  S +S  WL PQL + G ++ F ++GQ+EFY K+F
Sbjct  434  SGVVEQKRRTMAINNPIGIEPRKGAISSMSGLWLVPQLTLAGLSDGFTLVGQVEFYYKQF  493

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM S+  SL      ++ Y S+ L++ +H+ +      +WL  D+N GRL+ FY++I 
Sbjct  494  PENMRSLAGSLFFCGLALSSYFSSFLISVIHRLSDASATGNWLPQDLNKGRLDYFYYIIT  553

Query  524  GMGVVNLVYFMVVARRYRYK  583
             + VVNL YF++ +R YRYK
Sbjct  554  LLEVVNLGYFVMCSRWYRYK  573



>gb|AAL16236.1|AF428467_1 AT3g47960/T17F15_170 [Arabidopsis thaliana]
Length=606

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V + FYDRVLVP  R+ T +  GI++LQR+G G  F+I+++ V
Sbjct  378  FRIPAATYVVFLMTGMTVFIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLV  437

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGF+E +RR           A   G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  438  SGFIEERRRNFALTKPTLGMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQ  497

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+++ L++TVH+TT      +WL +D+N  +L+ FYF++
Sbjct  498  FPENMKSFAGSIFYVGAGVSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFML  557

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+ YF+++AR YRYK
Sbjct  558  TGLMVVNMAYFLLMARWYRYK  578



>ref|XP_002270558.3| PREDICTED: uncharacterized protein LOC100263850 [Vitis vinifera]
Length=1166

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 126/198 (64%), Gaps = 7/198 (4%)
 Frame = +2

Query  11    RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMA  190
             +FQIPA S  V S+L++ + +P YDR++VP+ R+ T    GITILQR+GIG+  S+L   
Sbjct  962   KFQIPAASYTVFSMLSLTIWVPIYDRIVVPFLRRITGKEAGITILQRIGIGIFLSVLTSL  1021

Query  191   VSGFVEIKRRAAA-------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEFPE  349
             VS  VE  RR           GG S +S  WL PQL + G AEAF  +GQ+EFY K+FPE
Sbjct  1022  VSALVEEWRRTRPIIGVYPRRGGISSMSGFWLIPQLTLAGLAEAFTAIGQVEFYYKQFPE  1081

Query  350   NMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIAGM  529
             NM SI  S        + YVS +LV+ VH+TT      +WL +D+N GRL+ FY+++A +
Sbjct  1082  NMRSIAGSFFFCGMAASSYVSGLLVSIVHRTTAGAKTGNWLPEDLNKGRLDYFYYLVASL  1141

Query  530   GVVNLVYFMVVARRYRYK  583
             GV+NL YF+V A+ Y YK
Sbjct  1142  GVINLGYFLVCAKWYTYK  1159


 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  + S+L + + +P YDR++VP  ++ T   GGIT+LQ+MG+G+  SI+ M V
Sbjct  365  FKIPAASYSIFSMLGLIIWIPIYDRIMVPLLQRFTGKEGGITVLQKMGVGMFLSIVTMLV  424

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S FVE +RR  A            G  S +S  W  PQL ++G +EAF ++ Q+EF+ K+
Sbjct  425  SAFVEHQRRTLALCEPTLRIDPRRGAISSMSGLWFIPQLTLVGVSEAFTVIAQVEFFYKQ  484

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPE+M S+G S   +   V+ Y+S+ LV+TVH+ T      +WL +D+N GRL+ FY+++
Sbjct  485  FPESMRSVGGSFSFLGVAVSSYLSSFLVSTVHRMTAGAASGNWLPEDLNKGRLDYFYYLV  544

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A +GV+NL YF++ A+ Y+YK
Sbjct  545  AALGVINLGYFLLCAKWYKYK  565



>ref|XP_004508783.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X3 [Cicer arietinum]
Length=594

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 126/200 (63%), Gaps = 10/200 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  + ++L++ + LP YDR++VP  R+ T   GGITILQR+GIG+  SIL M V
Sbjct  370  FKIPAASYTIFAMLSLTIFLPIYDRIIVPTLRRFTGKEGGITILQRIGIGMFVSILCMLV  429

Query  194  SGFVEIKRRAAA----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKEF  343
            SG VE KRR  A           G  S +S  WL PQL + G ++ F ++GQ+EFY K+F
Sbjct  430  SGVVEQKRRTMAINNPIGIEPRKGAISSMSGLWLVPQLTLAGLSDGFTLVGQVEFYYKQF  489

Query  344  PENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVIA  523
            PENM S+  SL      ++ Y S+ L++ +H+ +      +WL  D+N GRL+ FY++I 
Sbjct  490  PENMRSLAGSLFFCGLALSSYFSSFLISVIHRLSDASATGNWLPQDLNKGRLDYFYYIIT  549

Query  524  GMGVVNLVYFMVVARRYRYK  583
             + VVNL YF++ +R YRYK
Sbjct  550  LLEVVNLGYFVMCSRWYRYK  569



>ref|NP_566896.2| glucosinolate transporter 1 [Arabidopsis thaliana]
 sp|Q944G5.3|PTR44_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.10; Short=AtNPF2.10; 
AltName: Full=Protein GLUCOSINOLATE TRANSPORTER-1 [Arabidopsis 
thaliana]
 emb|CAB41143.1| putative peptide transporter [Arabidopsis thaliana]
 gb|AEE78351.1| glucosinolate transporter 1 [Arabidopsis thaliana]
Length=636

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V + FYDRVLVP  R+ T +  GI++LQR+G G  F+I+++ V
Sbjct  408  FRIPAATYVVFLMTGMTVFIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLV  467

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGF+E +RR           A   G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  468  SGFIEERRRNFALTKPTLGMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQ  527

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+++ L++TVH+TT      +WL +D+N  +L+ FYF++
Sbjct  528  FPENMKSFAGSIFYVGAGVSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFML  587

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+ YF+++AR YRYK
Sbjct  588  TGLMVVNMAYFLLMARWYRYK  608



>gb|AAK44017.1|AF370202_1 putative peptide transporter protein [Arabidopsis thaliana]
Length=606

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 130/201 (65%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA +  V  +  + V + FYDRVLVP  R+ T +  GI++LQR+G G  F+I+++ V
Sbjct  378  FRIPAATYVVFLMTGMTVFIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLV  437

Query  194  SGFVEIKRR-----------AAANGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            SGF+E +RR           A   G  S +S  WL PQL + G AEAF  +GQ+EFY K+
Sbjct  438  SGFIEERRRNFALTKPTLGMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQ  497

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S+  V  GV+ Y+++ L++TVH+TT      +WL +D+N  +L+ FYF++
Sbjct  498  FPENMKSFAGSIFYVGAGVSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFML  557

Query  521  AGMGVVNLVYFMVVARRYRYK  583
             G+ VVN+ YF+++AR YRYK
Sbjct  558  TGLMVVNMAYFLLMARWYRYK  578



>ref|XP_009764700.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana sylvestris]
Length=585

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 127/201 (63%), Gaps = 11/201 (5%)
 Frame = +2

Query  14   FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAV  193
            F+IPA S  V  +L++ + +P YDR++VP+ +K T+   GIT+LQ+MGIGL  ++  M V
Sbjct  363  FKIPAASYAVFQMLSMTIWIPIYDRIIVPFLQKITKKEAGITVLQKMGIGLFIAVFTMLV  422

Query  194  SGFVEIKRRAAA-----------NGGASPLSVAWLFPQLMVMGFAEAFNILGQIEFYNKE  340
            S  VE +RR  A            G  S +   WL PQL + G +EAF ++ Q+EF+ K+
Sbjct  423  SAVVETRRRNVAFSHPTLGIETRRGEISAMPANWLIPQLALAGLSEAFTVIAQVEFFYKQ  482

Query  341  FPENMNSIGNSLVSVTWGVAGYVSTMLVNTVHKTTGVHGRPDWLNDDINAGRLENFYFVI  520
            FPENM S   S +   + +A Y+S+ L++ VHKTT      +WL +D+N GRL+ FY+++
Sbjct  483  FPENMRSFAGSFLFCGFALASYMSSFLISIVHKTTRTSDTENWLAEDLNKGRLDYFYYLV  542

Query  521  AGMGVVNLVYFMVVARRYRYK  583
            A + V+NL YF++ A+ Y+YK
Sbjct  543  AALEVLNLGYFLICAKWYKYK  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940